Top
PPM1A
Localization (UniProt annotation) Nucleus Cytoplasm, cytosol MembraneNote=Weakly associates at the membrane and N-myristoylationmediates the membrane localization Function (UniProt annotation) Enzyme with a broad specificity Negatively regulatesTGF-beta signaling through dephosphorylating SMAD2 and SMAD3,resulting in their dissociation from SMAD4, nuclear export of theSMADs and termination of the TGF-beta-mediated signalingDephosphorylates PRKAA1 and PRKAA2 Plays an important role in thetermination of TNF-alpha-mediated NF-kappa-B activation throughdephosphorylating and inactivating IKBKB/IKKB Catalytic Activity (UniProt annotation) [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate Protein Sequence MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHIT
NNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFF
TQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDG
IWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEII
KKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKNDDTDSTSTDDMW
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Download FASTA sequences of PPM1A-substrates in HumansSubstrate Gene Name Substrate UniProt_AC DephosphoSite and sequence (+/-5) Bioassay Type PubMed ID View in Europe PMC Reliability of the interaction MAPK14 Q16539 NA In vitro and in vivo 9707433 , 18586681 , Europe PMC IKBKB O14920 Ser-177_ELDQGsLCTSF, , Ser-181_GSLCTsFVGTL , In vitro and in vivo 18930133 , Europe PMC AXIN1 O15169 NA In vitro and in vivo 10644691 , Europe PMC CDK9 P50750 Thr-186_QPNRYtNRVVT , In vitro and in vivo 18829461 , Europe PMC MAP2K6 P52564 NA In vitro and in vivo 9707433 , Europe PMC PAK1 Q13153 Ser-57_DRFYRsILAGD, , Ser-198 in ref. _PEHTKsVYTRS , In vitro and in vivo 18586681 , Europe PMC SMAD1 Q15797 NA In vitro and in vivo 16931515 , Europe PMC MAP2K4 P45985 NA In vitro and in vivo 9707433 , Europe PMC EEF2 P13639 Thr-57_GETRFtDTRKD, , Thr-59 _TRFTDtRKDEQ , In vitro 8386634 , 7548224 , 2176079 , Europe PMC CDC42BPA Q5VT25 NA In vitro 18586681 , Europe PMC SMAD3 P84022 NA In vitro 16751101 , Europe PMC CDK6 Q00534 Thr-177_FQMALtSVVVT , In vitro 10934208 , Europe PMC CDK2 P24941 Thr-160_PVRTYtHEVVT , In vitro 10934208 , Europe PMC MSN P26038 Thr-558_RDKYKtLRQIR , In vitro 10480873 , Europe PMC CDC42BPB Q9Y5S2 NA In vitro 18586681 , Europe PMC PIK3R1 P27986 Ser-608_TEDQYsLVEDD , In vivo 15016818 , Europe PMC PRKCD Q05655 Thr-507_ESRAStFCGTP, , Ser-645_EKARLsYSDKN, , Ser-664 _AFAGFsFVNPK , In vitro 11959144 , Europe PMC CETN1 Q12798 Thr-138_LGENLtDEELQ , In vitro 22820751 , Europe PMC PAK2 Q13177 NA In vitro 18586681 , Europe PMC GRM3 Q14832 Ser-845_HLNRFsVSGTG , In vitro 14663150 , Europe PMC SMAD2 Q15796 NA In vitro 16751101 , Europe PMC
Pathway ID Pathway Name Pathway Description (KEGG) hsa04010 MAPK signaling pathway The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-2173795 Downregulation of SMAD2/3:SMAD4 transcriptional activity. Transcriptional activity of SMAD2/3:SMAD4 heterotrimer can be inhibited by formation of a complex with SKI or SKIL (SNO), where SKI or SKIL recruit NCOR and possibly other transcriptional repressors to SMAD-binding promoter elements (Sun et al. 1999, Luo et al. 1999, Strochein et al. 1999). Higher levels of phosphorylated SMAD2 and SMAD3, however, may target SKI and SKIL for degradation (Strochein et al. 1999, Sun et al. 1999 PNAS, Bonni et al. 2001) through recruitment of SMURF2 (Bonni et al. 2001) or RNF111 i.e. Arkadia (Levy et al. 2007) ubiquitin ligases to SKI/SKIL by SMAD2/3. Therefore,the ratio of SMAD2/3 and SKI/SKIL determines the outcome: inhibition of SMAD2/3:SMAD4-mediated transcription or degradation of SKI/SKIL. SKI and SKIL are overexpressed in various cancer types and their oncogenic effect is connected with their ability to inhibit signaling by TGF-beta receptor complex. SMAD4 can be monoubiquitinated by a nuclear ubiquitin ligase TRIM33 (Ecto, Ectodermin, Tif1-gamma). Monoubiquitination of SMAD4 disrupts SMAD2/3:SMAD4 heterotrimers and leads to SMAD4 translocation to the cytosol. In the cytosol, SMAD4 can be deubiquitinated by USP9X (FAM), reversing TRIM33-mediated negative regulation (Dupont et al. 2009).Phosphorylation of the linker region of SMAD2 and SMAD3 by CDK8 or CDK9 primes SMAD2/3:SMAD4 complex for ubiquitination by NEDD4L and SMURF ubiquitin ligases. NEDD4L ubiquitinates SMAD2/3 and targets SMAD2/3:SMAD4 heterotrimer for degradation (Gao et al. 2009). SMURF2 monoubiquitinates SMAD2/3, leading to disruption of SMAD2/3:SMAD4 complexes (Tang et al. 2011). Transcriptional repressors TGIF1 and TGIF2 bind SMAD2/3:SMAD4 complexes and inhibit SMAD-mediated transcription by recruitment of histone deacetylase HDAC1 to SMAD-binding promoter elements (Wotton et al. 1999, Melhuish et al. 2001).PARP1 can attach poly ADP-ribosyl chains to SMAD3 and SMAD4 within SMAD2/3:SMAD4 heterotrimers. PARylated SMAD2/3:SMAD4 complexes are unable to bind SMAD-binding DNA elements (SBEs) (Lonn et al. 2010). Phosphorylated SMAD2 and SMAD3 can be dephosphorylated by PPM1A protein phosphatase, leading to dissociation of SMAD2/3 complexes and translocation of unphosphorylated SMAD2/3 to the cytosol (Lin et al. 2006) R-HSA-380972 Energy dependent regulation of mTOR by LKB1-AMPK. Upon formation of a trimeric LKB1:STRAD:MO25 complex, LKB1 phosphorylates and activates AMPK. This phosphorylation is immediately removed in basal conditions by PP2C, but if the cellular AMP:ATP ratio rises, this activation is maintained, as AMP binding by AMPK inhibits the dephosphorylation. AMPK then activates the TSC complex by phosphorylating TSC2. Active TSC activates the intrinsic GTPase activity of Rheb, resulting in GDP-loaded Rheb and inhibition of mTOR pathway
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTR5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ADAMTS12 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID AKT1 Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct ALDH3B1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ALK Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID ARRB1 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical, physical association 17620599 , (Europe PMC )0.50 BioGRID, IntAct ARRB2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical, physical association 17620599 , (Europe PMC )0.50 BioGRID, IntAct ASB2 Affinity Capture-MS physical 24337577 , (Europe PMC )NA BioGRID BCKDK Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CCL22 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CDC42BPA Biochemical Activity physical 18586681 , (Europe PMC )NA BioGRID CDC42BPB Biochemical Activity physical 18586681 , (Europe PMC )NA BioGRID CER1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CERKL Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CHEK1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CHST10 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID COQ2 Affinity Capture-MS physical 29128334 , (Europe PMC )NA BioGRID CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID DCP1B Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct DUSP12 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID DUSP22 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID EGFR Affinity Capture-Western, Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID ERBB2 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID ERBB3 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID ERBB4 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID FANCI Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID FBXL14 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FBXW11 Affinity Capture-MS physical 25900982 , (Europe PMC )NA BioGRID FGFR2 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GATD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GCN1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID GDF3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GRM3 Affinity Capture-Western, Two-hybrid physical 14663150 , (Europe PMC )NA BioGRID HAO2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HIP1R Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HNRNPD Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HSD17B4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HSDL2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HSFY1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct HSPB1 Two-hybrid, reverse ras recruitment system, two hybrid array physical, physical association 21988832 , 25277244 , (Europe PMC )0.55 BioGRID, IntAct IGF1R Affinity Capture-Western, Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID INPPL1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID INSL6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID INSR Affinity Capture-Western physical 28065597 , (Europe PMC )NA BioGRID INTS14 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID IWS1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID KDR Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID LETM1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID LMTK2 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID LXN Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MAP4K5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MAPK9 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MTERF2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NAA10 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NEDD1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NR4A1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PAK1 Biochemical Activity physical 18586681 , (Europe PMC )NA BioGRID PAK2 Biochemical Activity physical 18586681 , (Europe PMC )NA BioGRID PAK4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PEF1 Affinity Capture-MS physical 27716508 , (Europe PMC )NA BioGRID PIGS Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PKN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPM1B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PRKAA1 Biochemical Activity physical 20801214 , (Europe PMC )NA BioGRID PRKCA Biochemical Activity physical 18586681 , (Europe PMC )NA BioGRID PRKCI Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PRSS22 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PTK7 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID QARS Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RNASE13 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ROR2 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID RPLP0 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct RTEL1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SLC25A5 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID SLFN11 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID SMAD1 Affinity Capture-Western physical 22588298 , (Europe PMC )NA BioGRID SMURF1 Affinity Capture-MS physical 23184937 , (Europe PMC )NA BioGRID SOAT1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct TECPR2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TOR1AIP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct UBE3D Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID UGGT1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID VDAC1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct XRCC5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ZDHHC11 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AKT1 Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct ARRB1 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical, physical association 17620599 , (Europe PMC )0.50 BioGRID, IntAct ARRB2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical, physical association 17620599 , (Europe PMC )0.50 BioGRID, IntAct AXIN1 anti bait coimmunoprecipitation association, physical association 10644691 , (Europe PMC )0.50 IntAct, MINT CDK9 anti tag coimmunoprecipitation physical association 18829461 , (Europe PMC )0.40 IntAct, MINT COQ2 cross-linking study association 29128334 , (Europe PMC )0.35 IntAct CTNNB1 anti bait coimmunoprecipitation association 10644691 , (Europe PMC )0.35 IntAct, MINT DCP1B Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct DVL3 anti bait coimmunoprecipitation association 10644691 , (Europe PMC )0.35 IntAct, MINT FGFR2 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct HNRNPD Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HSFY1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct HSPB1 Two-hybrid, reverse ras recruitment system, two hybrid array physical, physical association 21988832 , 25277244 , (Europe PMC )0.55 BioGRID, IntAct LXN Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MAPK1 phosphatase assay, pull down dephosphorylation reaction, direct interaction, physical association 23560844 , (Europe PMC )0.61 IntAct, MINT MAPK14 phosphatase assay dephosphorylation reaction 23560844 , (Europe PMC )0.44 IntAct, MINT NEDD1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NR4A1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PIGS Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PRKCB anti tag coimmunoprecipitation physical association 18162466 , (Europe PMC )0.40 IntAct, MINT RANBP3 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down direct interaction, physical association 21960005 , (Europe PMC )0.60 IntAct, MINT RPLP0 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SGO1 anti bait coimmunoprecipitation physical association 16541025 , (Europe PMC )0.40 IntAct SGO2 anti bait coimmunoprecipitation physical association 16541025 , (Europe PMC )0.40 IntAct SMAD2 anti tag coimmunoprecipitation, pull down direct interaction, physical association 16751101 , (Europe PMC )0.54 IntAct, MINT SMAD3 pull down direct interaction 16751101 , (Europe PMC )0.44 IntAct, MINT SOAT1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct TOR1AIP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct VDAC1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct XRCC5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CDK9 anti tag coimmunoprecipitation physical association 18829461 , (Europe PMC )0.40 IntAct, MINT CTNNB1 anti bait coimmunoprecipitation association 10644691 , (Europe PMC )0.35 IntAct, MINT DVL3 anti bait coimmunoprecipitation association 10644691 , (Europe PMC )0.35 IntAct, MINT MAPK1 phosphatase assay, pull down dephosphorylation reaction, direct interaction, physical association 23560844 , (Europe PMC )0.61 IntAct, MINT MAPK14 phosphatase assay dephosphorylation reaction 23560844 , (Europe PMC )0.44 IntAct, MINT PRKCB anti tag coimmunoprecipitation physical association 18162466 , (Europe PMC )0.40 IntAct, MINT RANBP3 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down direct interaction, physical association 21960005 , (Europe PMC )0.60 IntAct, MINT SMAD2 anti tag coimmunoprecipitation, pull down direct interaction, physical association 16751101 , (Europe PMC )0.54 IntAct, MINT SMAD3 pull down direct interaction 16751101 , (Europe PMC )0.44 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTR5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ADAMTS12 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID AKT1 Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct ALDH3B1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ALK Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID ARRB1 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical, physical association 17620599 , (Europe PMC )0.50 BioGRID, IntAct ARRB2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical, physical association 17620599 , (Europe PMC )0.50 BioGRID, IntAct ASB2 Affinity Capture-MS physical 24337577 , (Europe PMC )NA BioGRID AXIN1 anti bait coimmunoprecipitation association, physical association 10644691 , (Europe PMC )0.50 IntAct, MINT BCKDK Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CCL22 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CDC42BPA Biochemical Activity physical 18586681 , (Europe PMC )NA BioGRID CDC42BPB Biochemical Activity physical 18586681 , (Europe PMC )NA BioGRID CDK9 anti tag coimmunoprecipitation physical association 18829461 , (Europe PMC )0.40 IntAct, MINT CER1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CERKL Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CHEK1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CHST10 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID COQ2 Affinity Capture-MS physical 29128334 , (Europe PMC )NA BioGRID COQ2 cross-linking study association 29128334 , (Europe PMC )0.35 IntAct CTNNB1 anti bait coimmunoprecipitation association 10644691 , (Europe PMC )0.35 IntAct, MINT CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID DCP1B Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct DUSP12 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID DUSP22 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID DVL3 anti bait coimmunoprecipitation association 10644691 , (Europe PMC )0.35 IntAct, MINT EGFR Affinity Capture-Western, Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID ERBB2 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID ERBB3 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID ERBB4 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID FANCI Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID FBXL14 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FBXW11 Affinity Capture-MS physical 25900982 , (Europe PMC )NA BioGRID FGFR2 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GATD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GCN1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID GDF3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GRM3 Affinity Capture-Western, Two-hybrid physical 14663150 , (Europe PMC )NA BioGRID HAO2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HIP1R Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HNRNPD Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HSD17B4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HSDL2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HSFY1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct HSPB1 Two-hybrid, reverse ras recruitment system, two hybrid array physical, physical association 21988832 , 25277244 , (Europe PMC )0.55 BioGRID, IntAct IGF1R Affinity Capture-Western, Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID INPPL1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID INSL6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID INSR Affinity Capture-Western physical 28065597 , (Europe PMC )NA BioGRID INTS14 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID IWS1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID KDR Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID LETM1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID LMTK2 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID LXN Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MAP4K5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MAPK1 phosphatase assay, pull down dephosphorylation reaction, direct interaction, physical association 23560844 , (Europe PMC )0.61 IntAct, MINT MAPK14 phosphatase assay dephosphorylation reaction 23560844 , (Europe PMC )0.44 IntAct, MINT MAPK9 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MTERF2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NAA10 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NEDD1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NR4A1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PAK1 Biochemical Activity physical 18586681 , (Europe PMC )NA BioGRID PAK2 Biochemical Activity physical 18586681 , (Europe PMC )NA BioGRID PAK4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PEF1 Affinity Capture-MS physical 27716508 , (Europe PMC )NA BioGRID PIGS Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PKN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPM1B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PRKAA1 Biochemical Activity physical 20801214 , (Europe PMC )NA BioGRID PRKCA Biochemical Activity physical 18586681 , (Europe PMC )NA BioGRID PRKCB anti tag coimmunoprecipitation physical association 18162466 , (Europe PMC )0.40 IntAct, MINT PRKCI Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PRSS22 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PTK7 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID QARS Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RANBP3 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down direct interaction, physical association 21960005 , (Europe PMC )0.60 IntAct, MINT RNASE13 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ROR2 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID RPLP0 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct RTEL1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SGO1 anti bait coimmunoprecipitation physical association 16541025 , (Europe PMC )0.40 IntAct SGO2 anti bait coimmunoprecipitation physical association 16541025 , (Europe PMC )0.40 IntAct SLC25A5 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID SLFN11 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID SMAD1 Affinity Capture-Western physical 22588298 , (Europe PMC )NA BioGRID SMAD2 anti tag coimmunoprecipitation, pull down direct interaction, physical association 16751101 , (Europe PMC )0.54 IntAct, MINT SMAD3 pull down direct interaction 16751101 , (Europe PMC )0.44 IntAct, MINT SMURF1 Affinity Capture-MS physical 23184937 , (Europe PMC )NA BioGRID SOAT1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct TECPR2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TOR1AIP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct UBE3D Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID UGGT1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID VDAC1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct XRCC5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ZDHHC11 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID