Top
CDC42BPB
Localization (UniProt annotation) Cytoplasm Cell membrane Cell junction Cell projection, lamellipodium Note=Displays a dispersed punctatedistribution and concentrates along the cell periphery, especiallyat the leading edge and cell-cell junction This concentration isPH-domain dependent (By similarity) Detected at the leading edgeof migrating cells Localization at the leading edge of migratingcells requires interaction with catalytically active CDC42(PubMed:21240187) Localizes in the lamellipodium in aFAM89B/LRAP25-dependent manner (By similarity) Function (UniProt annotation) Serine/threonine-protein kinase which is an importantdownstream effector of CDC42 and plays a role in the regulation ofcytoskeleton reorganization and cell migration Regulates actincytoskeletal reorganization via phosphorylation of PPP1R12C andMYL9/MLC2 (PubMed:21457715, PubMed:21949762) In concert withMYO18A and LURAP1, is involved in modulating lamellar actomyosinretrograde flow that is crucial to cell protrusion and migration(PubMed:18854160) Phosphorylates PPP1R12A (PubMed:21457715) Inconcert with FAM89B/LRAP25 mediates the targeting of LIMK1 to thelamellipodium resulting in its activation and subsequentphosphorylation of CFL1 which is important for lamellipodial F-actin regulation (By similarity) Catalytic Activity (UniProt annotation) ATP + a protein = ADP + a phosphoprotein Protein Sequence MSAKVRLKKLEQLLLDGPWRNESALSVETLLDVLVCLYTECSHSALRRDKYVAEFLEWAKPFTQLVKEMQLHREDFEIIK
VIGRGAFGEVAVVKMKNTERIYAMKILNKWEMLKRAETACFREERDVLVNGDCQWITALHYAFQDENHLYLVMDYYVGGD
LLTLLSKFEDKLPEDMARFYIGEMVLAIDSIHQLHYVHRDIKPDNVLLDVNGHIRLADFGSCLKMNDDGTVQSSVAVGTP
DYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERFQFPSHVTDVSEEAKDLIQRL
ICSRERRLGQNGIEDFKKHAFFEGLNWENIRNLEAPYIPDVSSPSDTSNFDVDDDVLRNTEILPPGSHTGFSGLHLPFIG
FTFTTESCFSDRGSLKSIMQSNTLTKDEDVQRDLEHSLQMEAYERRIRRLEQEKLELSRKLQESTQTVQSLHGSSRALSN
SNRDKEIKKLNEEIERLKNKIADSNRLERQLEDTVALRQEREDSTQRLRGLEKQHRVVRQEKEELHKQLVEASERLKSQA
KELKDAHQQRKLALQEFSELNERMAELRAQKQKVSRQLRDKEEEMEVATQKVDAMRQEMRRAEKLRKELEAQLDDAVAEA
SKERKLREHSENFCKQMESELEALKVKQGGRGAGATLEHQQEISKIKSELEKKVLFYEEELVRREASHVLEVKNVKKEVH
DSESHQLALQKEILMLKDKLEKSKRERHNEMEEAVGTIKDKYERERAMLFDENKKLTAENEKLCSFVDKLTAQNRQLEDE
LQDLAAKKESVAHWEAQIAEIIQWVSDEKDARGYLQALASKMTEELEALRSSSLGSRTLDPLWKVRRSQKLDMSARLELQ
SALEAEIRAKQLVQEELRKVKDANLTLESKLKDSEAKNRELLEEMEILKKKMEEKFRADTGLKLPDFQDSIFEYFNTAPL
AHDLTFRTSSASEQETQAPKPEASPSMSVAASEQQEDMARPPQRPSAVPLPTTQALALAGPKPKAHQFSIKSFSSPTQCS
HCTSLMVGLIRQGYACEVCSFACHVSCKDGAPQVCPIPPEQSKRPLGVDVQRGIGTAYKGHVKVPKPTGVKKGWQRAYAV
VCDCKLFLYDLPEGKSTQPGVIASQVLDLRDDEFSVSSVLASDVIHATRRDIPCIFRVTASLLGAPSKTSSLLILTENEN
EKRKWVGILEGLQSILHKNRLRNQVVHVPLEAYDSSLPLIKAILTAAIVDADRIAVGLEEGLYVIEVTRDVIVRAADCKK
VHQIELAPREKIVILLCGRNHHVHLYPWSSLDGAEGSFDIKLPETKGCQLMATATLKRNSGTCLFVAVKRLILCYEIQRT
KPFHRKFNEIVAPGSVQCLAVLRDRLCVGYPSGFCLLSIQGDGQPLNLVNPNDPSLAFLSQQSFDALCAVELESEEYLLC
FSHMGLYVDPQGRRARAQELMWPAAPVACSCSPTHVTVYSEYGVDVFDVRTMEWVQTIGLRRIRPLNSEGTLNLLNCEPP
RLIYFKSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDG
MQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTPS
NSSNPSGPPSPNSPHRSQLPLEGLEQPACDT
ELM Motif Motif Instance
Description Motif Regex NA NA NA NA
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CDC42 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct CDKN3 Affinity Capture-Western physical 24704824 , (Europe PMC )NA BioGRID DCD Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct FAM167A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GRPR Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID INKA2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LGR4 Affinity Capture-MS physical 24639526 , (Europe PMC )NA BioGRID LURAP1L Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MAP2K5 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct MTMR7 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID MYO18A Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 18854160 , 26496610 , (Europe PMC )0.53 BioGRID, IntAct NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID ORC2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPM1A Biochemical Activity physical 18586681 , (Europe PMC )NA BioGRID PRKCZ Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PTPRG Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID RIPK1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct RPL3 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RXRB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SP1 Affinity Capture-MS physical 22266860 , (Europe PMC )NA BioGRID UBXN2B Affinity Capture-MS physical 26186194 , 26389662 , 28514442 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source BRIX1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct CDC42 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct CDC42BPA two hybrid fragment pooling approach physical association 23414517 , (Europe PMC )0.37 IntAct DCD Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct DDX21 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct KRT78 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct KSR2 anti tag coimmunoprecipitation association 27086506 , (Europe PMC )0.35 IntAct LURAP1 anti bait coimmunoprecipitation association 18854160 , (Europe PMC )0.35 IntAct MAP2K5 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct MYO18A Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 18854160 , 26496610 , (Europe PMC )0.53 BioGRID, IntAct PPP5C pull down association 28330616 , (Europe PMC )0.35 IntAct PYGM two hybrid fragment pooling approach physical association 23414517 , (Europe PMC )0.37 IntAct RIPK1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct RPL3 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL35 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct RXRB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TJP1 anti bait coimmunoprecipitation, fluorescence microscopy colocalization, physical association 21240187 , (Europe PMC )0.46 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source BRIX1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct CDC42 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct CDC42BPA two hybrid fragment pooling approach physical association 23414517 , (Europe PMC )0.37 IntAct CDKN3 Affinity Capture-Western physical 24704824 , (Europe PMC )NA BioGRID DCD Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct DDX21 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct FAM167A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GRPR Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID INKA2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID KRT78 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct KSR2 anti tag coimmunoprecipitation association 27086506 , (Europe PMC )0.35 IntAct LGR4 Affinity Capture-MS physical 24639526 , (Europe PMC )NA BioGRID LURAP1 anti bait coimmunoprecipitation association 18854160 , (Europe PMC )0.35 IntAct LURAP1L Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MAP2K5 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct MTMR7 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID MYO18A Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 18854160 , 26496610 , (Europe PMC )0.53 BioGRID, IntAct NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID ORC2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPM1A Biochemical Activity physical 18586681 , (Europe PMC )NA BioGRID PPP5C pull down association 28330616 , (Europe PMC )0.35 IntAct PRKCZ Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PTPRG Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PYGM two hybrid fragment pooling approach physical association 23414517 , (Europe PMC )0.37 IntAct RIPK1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct RPL3 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL35 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct RXRB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SP1 Affinity Capture-MS physical 22266860 , (Europe PMC )NA BioGRID TJP1 anti bait coimmunoprecipitation, fluorescence microscopy colocalization, physical association 21240187 , (Europe PMC )0.46 IntAct, MINT UBXN2B Affinity Capture-MS physical 26186194 , 26389662 , 28514442 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
Unknown S1690_SNPSGPPsPNSPHRS , S1693_SGPPSPNsPHRSQLP , S852_ELEALRSsSLGSRTL , S914_LESKLKDsEAKNREL , Y1638_PPSRNKPyISWPSSG , HTP, in vivo 17081983 , 18669648 , 18691976 , 18707149 , 19651622 , 20068231 , 20166139 ,(Europe PMC )HPRD, PhosphoELM ,