Top
CDK9
Localization (UniProt annotation) Nucleus Cytoplasm Nucleus, PML bodyNote=Accumulates on chromatin in response to replication stressComplexed with CCNT1 in nuclear speckles, but uncomplexed form inthe cytoplasm The translocation from nucleus to cytoplasm isXPO1/CRM1-dependent Associates with PML body when acetylated Function (UniProt annotation) Protein kinase involved in the regulation oftranscription Member of the cyclin-dependent kinase pair(CDK9/cyclin-T) complex, also called positive transcriptionelongation factor b (P-TEFb), which facilitates the transitionfrom abortive to productive elongation by phosphorylating the CTD(C-terminal domain) of the large subunit of RNA polymerase II(RNAP II) POLR2A, SUPT5H and RDBP This complex is inactive whenin the 7SK snRNP complex form Phosphorylates EP300, MYOD1,RPB1/POLR2A and AR, and the negative elongation factors DSIF andNELF Regulates cytokine inducible transcription networks byfacilitating promoter recognition of target transcription factors(eg TNF-inducible RELA/p65 activation and IL-6-inducible STAT3signaling) Promotes RNA synthesis in genetic programs for cellgrowth, differentiation and viral pathogenesis P-TEFb is alsoinvolved in cotranscriptional histone modification, mRNAprocessing and mRNA export Modulates a complex network ofchromatin modifications including histone H2B monoubiquitination(H2Bub1), H3 lysine 4 trimethylation (H3K4me3) and H3K36me3;integrates phosphorylation during transcription with chromatinmodifications to control co-transcriptional histone mRNAprocessing The CDK9/cyclin-K complex has also a kinase activitytowards CTD of RNAP II and can substitute for CDK9/cyclin-T P-TEFbin vitro Replication stress response protein; the CDK9/cyclin-Kcomplex is required for genome integrity maintenance, by promotingcell cycle recovery from replication arrest and limiting single-stranded DNA amount in response to replication stress, thusreducing the breakdown of stalled replication forks and avoidingDNA damage In addition, probable function in DNA repair ofisoform 2 via interaction with KU70/XRCC6 Promotes cardiacmyocyte enlargement RPB1/POLR2A phosphorylation on 'Ser-2' in CTDactivates transcription AR phosphorylation modulates ARtranscription factor promoter selectivity and cell growth DSIFand NELF phosphorylation promotes transcription by inhibitingtheir negative effect The phosphorylation of MYOD1 enhances itstranscriptional activity and thus promotes muscle differentiation Catalytic Activity (UniProt annotation) ATP + a protein = ADP + a phosphoprotein ATP + [DNA-directed RNA polymerase] = ADP +[DNA-directed RNA polymerase] phosphate Protein Sequence MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVN
LIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRD
GVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPM
PSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
CDK9 is dephosphorylated by following phosphatases:
Phosphatase Gene Name Phosphatase UniProt_AC DephosphoSite and sequence (+/-5) in CDK9 (P50750) Bioassay Type PubMed ID View in Europe PMC Reliability of the interaction PPP1CA P62136 Ser-175_LARAFsLAKNS, , Thr-186_QPNRYtNRVVT , In vitro 21533037 , 18483222 , Europe PMC PPM1A P35813 Thr-186_QPNRYtNRVVT , In vitro and in vivo 18829461 , Europe PMC PPP2CA P67775 NA In vitro 16048649 , Europe PMC PPP2CB P62714 NA In vitro 16048649 , Europe PMC PPM1B O75688 Thr-186_QPNRYtNRVVT , In vitro 18829461 , Europe PMC
Pathway ID Pathway Name Pathway Description (KEGG) hsa05202 Transcriptional misregulation in cancer In tumor cells, genes encoding transcription factors (TFs) are often amplified, deleted, rearranged via chromosomal translocation and inversion, or subjected to point mutations that result in a gain- or loss-of- function. In hematopoietic cancers and solid tumors, the translocations and inversions increase or deregulate transcription of the oncogene. Recurrent chromosome translocations generate novel fusion oncoproteins, which are common in myeloid cancers and soft-tissue sarcomas. The fusion proteins have aberrant transcriptional function compared to their wild-type counterparts. These fusion transcription factors alter expression of target genes, and thereby result in a variety of altered cellular properties that contribute to the tumourigenic process.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-112382 Formation of RNA Pol II elongation complex. TFIIS is a transcription factor involved in different phases of transcription, occurring in a major ubiquitous form and other tissue specific forms. TFIIS stimulates RNA Pol II complex out of elongation arrest. Other transcription factors like ELL, Elongin family members and TFIIF interact directly with elongating Pol II and increase its elongation rate. These factors have been observed to act on naked DNA templates by suppressing transient pausing by the enzyme at all or most steps of nucleotide addition. In Drosophila, ELL is found at a large number of transcriptionally active sites on polytene chromosomes. In general, ELL is suspected to have more unidentified functions. Elongin is a heterotrimeric protein complex that stimulates the overall rate of elongation. In addition, Elongin may act as an E3 Ubiquitin ligase. Ubiquitylation of RNA Pol II occurs rapidly after genotoxic assault by UV light or chemicals, and results in degradation by proteasome. The FACT complex appears to promote elongation by facilitating passage of polymerase through chromatin. All these factors contribute to the formation of a processive elongation complex centered around the RNA Pol II complex positioned on the DNA:RNA hybrid. This enables the RNA Pol II elongation complex to function as a platform that coordinates mRNA processing and export (Reviewed by Shilatifard et al., 2003) R-HSA-167152 Formation of HIV elongation complex in the absence of HIV Tat. During the formation of the HIV elongation complex in the absence of HIV Tat, eongation factors are recruited to form the HIV-1 elongation complex (Hill and Sundquist 2013) and P-TEFb complex hyperphosphorylates RNA Pol II CTD (Hermann and Rice, 2005, Zhou et al., 2000) R-HSA-167200 Formation of HIV-1 elongation complex containing HIV-1 Tat. This HIV-1 event was inferred from the corresponding human RNA Poll II transcription event in Reactome. The details relevant to HIV-1 are described below. For a more detailed description of the general mechanism, see the link to the corresponding RNA Pol II transcription event below. \nThe formation of the HIV-1 elongation complex involves Tat mediated recruitment of P-TEFb(Cyclin T1:Cdk9) to the TAR sequence (Wei et al, 1998) and P-TEFb(Cyclin T1:Cdk9) mediated phosphorylation of the RNA Pol II CTD as well as the negative transcriptional elongation factors DSIF and NELF (Herrmann, 1995; Ivanov et al. 2000; Fujinaga et al. 2004; Zhou et al., 2004) R-HSA-167238 Pausing and recovery of Tat-mediated HIV elongation. After Pol II pauses by back tracking 2 -4 nuleotides on the HIV-1 template, elongation of the HIV-1 transcript resumes R-HSA-167243 Tat-mediated HIV elongation arrest and recovery. RNA Pol II arrest is believed to be a result of irreversible backsliding of the enzyme by ~7-14 nucleotides. TFIIS reactivates arrested RNA Pol II by promoting the excision of nascent transcript ~7-14 nucleotides upstream of the 3' end R-HSA-167246 Tat-mediated elongation of the HIV-1 transcript. The Tat protein is a viral transactivator protein that regulates HIV-1 gene expression by controlling RNA Pol II-mediated elongation (reviewed in Karn 1999; Taube et al. 1999; Liou et al. 2004; Barboric and Peterlin 2005). Tat appears to be required in order to overcome the arrest of RNA Pol II by the negative transcriptional elongation factors DSIF and NELF (Wada et al. 1998; Yamaguchi et al. 1999; Yamaguchi et al 2002; Fujinaga et al. 2004). While Pol II can associate with the proviral LTR and initiate transcription in the absence of Tat, these polymerase complexes are non-processive and dissociate from the template prematurely producing very short transcripts (Kao et al. 1987). Tat associates with the RNA element, TAR, which forms a stem loop structure in the leader RNA sequence (Dingwall et al. 1989). Tat also associates with the cellular kinase complex P-TEFb(Cyclin T1:Cdk9) and recruits it to the TAR stem loop structure (Herrmann, 1995) (Wei et al. 1998). This association between Tat, TAR and P-TEFb(Cyclin T1:Cdk9) is believed to bring the catalytic subunit of this kinase complex (Cdk9) in close proximity to Pol II where it hyperphosphorylates the CTD of RNA Pol II (Zhou et al. 2000). The RD subunits of NELF and the SPT5 subunit of DSIF, which associate through RD with the bottom stem of TAR, are also phosphorylated by P-TEFb(Cyclin T1:Cdk9) (Yamaguchi et al. 2002; Fujinaga et al. 2004; Ivanov et al. 2000). Phosphorylation of RD results in its dissociation from TAR. Thus, Tat appears to facilitate transcriptional elongation of the HIV-1 transcript by hyperphosphorylating the RNA Poll II CTD and by removing the negative transcription elongation factors from TAR. In addition, there is evidence that the association of Tat with P-TEFb(Cyclin T1:Cdk9) alters the substrate specificity of P-TEFb enhancing phosphorylation of ser5 residues in the CTD of RNA Pol II (Zhou et al. 2000) R-HSA-167287 HIV elongation arrest and recovery. RNA Pol II arrest is believed to be a result of irreversible backsliding of the enzyme by ~7-14 nucleotides. TFIIS reactivates arrested RNA Pol II by promoting the excision of nascent transcript ~7-14 nucleotides upstream of the 3' end R-HSA-167290 Pausing and recovery of HIV elongation. After Pol II pauses by back tracking 2 -4 nuleotides on the HIV-1 template, elongation of the HIV-1 transcript resumes R-HSA-176034 Interactions of Tat with host cellular proteins. The elongation of HIV-1 mRNA depends upon the interaction of Tat with the host P-TEFb complex (Hermann and Rice, 1995; Wei et al., 1998) R-HSA-2173796 SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription. After phosphorylated SMAD2 and/or SMAD3 form a heterotrimer with SMAD4, SMAD2/3:SMAD4 complex translocates to the nucleus (Xu et al. 2000, Kurisaki et al. 2001, Xiao et al. 2003). In the nucleus, linker regions of SMAD2 and SMAD3 within SMAD2/3:SMAD4 complex can be phosphorylated by CDK8 associated with cyclin C (CDK8:CCNC) or CDK9 associated with cyclin T (CDK9:CCNT). CDK8/CDK9-mediated phosphorylation of SMAD2/3 enhances transcriptional activity of SMAD2/3:SMAD4 complex, but also primes it for ubiquitination and consequent degradation (Alarcon et al. 2009). The transfer of SMAD2/3:SMAD4 complex to the nucleus can be assisted by other proteins, such as WWTR1. In human embryonic cells, WWTR1 (TAZ) binds SMAD2/3:SMAD4 heterotrimer and mediates TGF-beta-dependent nuclear accumulation of SMAD2/3:SMAD4. The complex of WWTR1 and SMAD2/3:SMAD4 binds promoters of SMAD7 and SERPINE1 (PAI-1 i.e. plasminogen activator inhibitor 1) genes and stimulates their transcription (Varelas et al. 2008). Stimulation of SMAD7 transcription by SMAD2/3:SMAD4 represents a negative feedback loop in TGF-beta receptor signaling. SMAD7 can be downregulated by RNF111 ubiquitin ligase (Arkadia), which binds and ubiquitinates SMAD7, targeting it for degradation (Koinuma et al. 2003). SMAD2/3:SMAD4 heterotrimer also binds the complex of RBL1 (p107), E2F4/5 and TFDP1/2 (DP1/2). The resulting complex binds MYC promoter and inhibits MYC transcription. Inhibition of MYC transcription contributes to anti-proliferative effect of TGF-beta (Chen et al. 2002). SMAD2/3:SMAD4 heterotrimer also associates with transcription factor SP1. SMAD2/3:SMAD4:SP1 complex stimulates transcription of a CDK inhibitor CDKN2B (p15-INK4B), also contributing to the anti-proliferative effect of TGF-beta (Feng et al. 2000). MEN1 (menin), a transcription factor tumor suppressor mutated in a familial cancer syndrome multiple endocrine neoplasia type 1, forms a complex with SMAD2/3:SMAD4 heterotrimer, but transcriptional targets of SMAD2/3:SMAD4:MEN1 have not been elucidated (Kaji et al. 2001, Sowa et al. 2004, Canaff et al. 2012). JUNB is also an established transcriptional target of SMAD2/3:SMAD4 complex (Wong et al. 1999) R-HSA-674695 RNA Polymerase II Pre-transcription Events. For initiation, Pol II assembles with the general transcription factors TFIIB, TFIID, TFIIE, TFIIF and TFIIH, which are collectively known as the general transcription factors, at promoter DNA to form the pre-initiation complex (PIC). Until the nascent transcript is about 15 nucleotides long, the early transcribing complex is functionally unstable. In the beginning, short RNAs are frequently released and Pol II has to restart transcription (abortive cycling) R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes. Several DNA repair genes contain p53 response elements and their transcription is positively regulated by TP53 (p53). TP53-mediated regulation probably ensures increased protein level of DNA repair genes under genotoxic stress.TP53 directly stimulates transcription of several genes involved in DNA mismatch repair, including MSH2 (Scherer et al. 2000, Warnick et al. 2001), PMS2 and MLH1 (Chen and Sadowski 2005). TP53 also directly stimulates transcription of DDB2, involved in nucleotide excision repair (Tan and Chu 2002), and FANCC, involved in the Fanconi anemia pathway that repairs DNA interstrand crosslinks (Liebetrau et al. 1997). Other p53 targets that can influence DNA repair functions are RRM2B (Kuo et al. 2012), XPC (Fitch et al. 2003), GADD45A (Amundson et al. 2002), CDKN1A (Cazzalini et al. 2010) and PCNA (Xu and Morris 1999). Interestingly, the responsiveness of some of these DNA repair genes to p53 activation has been shown in human cells but not for orthologous mouse genes (Jegga et al. 2008, Tan and Chu 2002). Contrary to the positive modulation of nucleotide excision repair (NER) and mismatch repair (MMR), p53 can negatively modulate base excision repair (BER), by down-regulating the endonuclease APEX1 (APE1), acting in concert with SP1 (Poletto et al. 2016).
Expression of several DNA repair genes is under indirect TP53 control, through TP53-mediated stimulation of cyclin K (CCNK) expression (Mori et al. 2002). CCNK is the activating cyclin for CDK12 and CDK13 (Blazek et al. 2013). The complex of CCNK and CDK12 binds and phosphorylates the C-terminal domain of the RNA polymerase II subunit POLR2A, which is necessary for efficient transcription of long DNA repair genes, including BRCA1, ATR, FANCD2, FANCI, ATM, MDC1, CHEK1 and RAD51D. Genes whose transcription is regulated by the complex of CCNK and CDK12 are mainly involved in the repair of DNA double strand breaks and/or the Fanconi anemia pathway (Blazek et al. 2011, Cheng et al. 2012, Bosken et al. 2014, Bartkowiak and Greenleaf 2015, Ekumi et al. 2015)
R-HSA-6807505 RNA polymerase II transcribes snRNA genes. Small nuclear RNAs (snRNAs) play key roles in splicing and some of them, specifically the U1 and U2 snRNAs, are encoded by multicopy snRNA gene clusters containing tandem arrays of genes, about 30 in the RNU1 cluster (Bernstein et al. 1985) and about 10-20 in the RNU2 cluster (Van Ardsell and Weiner 1984). Whereas U6 snRNA genes are transcribed by RNA polymerase III, U1,U2, U4, U4atac, U5, U11, and U12 genes are transcribed by RNA polymerase II. Transcription of the U1 and U2 genes has been most extensively studied and the other snRNA genes as well as other genes with similar promoter structures, for example the SNORD13 gene, are inferred to be transcribed by similar reactions. The snRNA genes transcribed by RNA polymerase II are distinguished from mRNA-encoding genes by the presence of a proximal sequence element (PSE) rather than a TATA box and the presence of the Integrator complex rather than the Mediator complex (reviewed in Egloff et al. 2008, Jawdeker and Henry 2008).The snRNA genes are among the most rapidly transcribed genes in the genome. The 5' transcribed region of the U2 snRNA gene is largely single-stranded during interphase and metaphase (Pavelitz et al. 2008) and chromatin within the transcribed region is cleared of nucleosomes (O'Reilly et al. 2014). Transcriptional activation of the RNA polymerase II transcribed snRNA genes begins with binding of transcription factors to the distal sequence element (DSE) of the promoter (reviewed in Hernandez 2001, Egloff et al. 2008, Jawdeker and Henry 2008). The factors, which include POU2F1 (Oct-1), POU2F2 (Oct-2), ZNF143 (Staf) and Sp1, promote binding of the SNAPc complex (also known as PTF and PBP) to the PSE. SNAPc helps clear the gene of nucleosomes (O'Reilly et al. 2014) and recruits initiation factors (TFIIA, TFIIB, TFIIE, TFIIF, and snTAFc:TBP) which recruit RNA polymerase II. Phosphorylation of the C-terminal domain (CTD) of RNA polymerase II (reviewed in Egloff and Murphy 2008) by CDK7 recruits RPAP2 and the Integrator complex, which is required for later processing of the 3' end of the pre-snRNA transcript (reviewed in Chen and Wagner 2010, Baillat and Wagner 2015). The Little Elongation Complex (LEC) also appears to bind around the time of transcription initiation (Hu et al. 2013). As transcription proceeds, RPAP2 dephosphorylates serine-5 and P-TEFb phosphorylates serine-2 of the CTD. As transcription reaches the end of the snRNA gene serine-7 of the CTD is phosphorylated. These marks serve to bind protein complexes and are required for 3' processing of the pre-snRNA (reviewed in Egloff and Murphy 2008). After transcription proceeds through the conserved 3' processing sequence of the pre-snRNA the Integrator complex cleaves the pre-snRNA. Transcription then terminates downstream in a less well characterized reaction that requires elements of the polyadenylation system R-HSA-75955 RNA Polymerase II Transcription Elongation. The mechanisms governing the process of elongation during eukaryotic mRNA synthesis are being unraveled by recent studies. These studies have led to the expected discovery of a diverse collection of transcription factors that directly regulate the activities of RNA Polymerase II and unexpected discovery of roles for many elongation factors in other basic processes like DNA repair, recombination, etc. The transcription machinery and structural features of the major RNA polymerases are conserved across species. The genes active during elongation fall under different classes like, housekeeping, cell-cycle regulated, development and differentiation specific genes etc. The list of genes involved in elongation has been growing in recent times, and include: -TFIIS,DSIF, NELF, P-Tefb etc. that are involved in drug induced or sequence-dependent arrest - TFIIF, ELL, elongin, elongator etc. that are involved in increasing the catalytic rate of elongation by altering the Km and/or the Vmax of Pol II -FACT, Paf1 and other factors that are involved chromatin modification - DNA repair proteins, RNA processing and export factors, the 19S proteasome and a host of other factors like Spt5-Spt5, Paf1, and NELF complexes, FCP1P etc. (Arndt and Kane, 2003). Elongation also represents processive phase of transcription in which the activities of several mRNA processing factors are coupled to transcription through their binding to RNA polymerase (Pol II). One of the key events that enables this interaction is the differential phosphorylation of Pol II CTD. Phosphorylation pattern of CTD changes during transcription, most significantly at the beginning and during elongation process. TFIIH-dependent Ser5 phosphorylation is observed primarily at promoter regions while P-Tefb mediated Ser2 phosphorylation is seen mainly in the coding regions, during elongation. Experimental evidence suggests a dynamic association of RNA processing factors with differently modified forms of the polymerase during the transcription cycle. (Komarnitsky et al., 2000) R-HSA-9018519 Estrogen-dependent gene expression. Estrogens mediate their transcriptional effects through interaction with the estrogen receptors, ESR1 (also known as ER alpha) and ESR2 (ER beta). ESR1 and ESR2 share overlapping but distinct functions, with ESR1 playing the primary role in transcriptional activation in most cell types (Hah and Krauss, 2014; Haldosén et al, 2014. The receptors function as ligand-dependent dimers and can activate target genes either through direct binding to an estrogen responsive element (ERE) in the target gene promoter, or indirectly through interaction with another DNA-binding protein such as RUNX1, SP1, AP1 or NF-kappa beta (reviewed in Bai and Gust, 2009; Hah and Krause, 2014). Binding of estrogen receptors to the DNA promotes the assembly of higher order transcriptional complexes containing methyltransferases, histone acetyltransferases and other transcriptional activators, which promote transcription by establishing active chromatin marks and by recruiting general transcription factors and RNA polymerase II. ESR1- and estrogen-dependent recruitment of up to hundreds of coregulators has been demonstrated by varied co-immunoprecipitation and proteomic approaches (Kittler et al, 2013; Mohammed et al, 2013; Foulds et al, 2013; Mohammed et al, 2015; Liu et al, 2014; reviewed in Magnani and Lupien, 2014; Arnal, 2017). In some circumstances, ligand-bound receptors can also promote the assembly of a repression complex at a target gene, and in some cases, heterodimers of ESR1 and ESR2 serve as repressors of ESR1-mediated target gene activation (reviewed in Hah and Kraus, 2014; Arnal et al, 2017). Phosphorylation of the estrogen receptor also modulates its activity, and provides cross-talk between nuclear estrogen-dependent signaling and non-genomic estrogen signaling from the plasma membrane (reviewed in Anbalagan and Rowan, 2015; Halodsèn et al, 2014; Schwartz et al, 2016) A number of recent genome wide studies highlight the breadth of the transcriptional response to estrogen. The number of predicted estrogen-dependent target genes ranges from a couple of hundred (based on microarray studies) to upwards of 10000, based on ChIP-chip or ChIP-seq (Cheung and Kraus, 2010; Kinnis and Kraus, 2008; Lin et al, 2004; Welboren et al, 2009; Ikeda et al, 2015; Lin et al, 2007; Carroll et al, 2006). Many of these predicted sites may not represent transcriptionally productive binding events, however. A study examining ESR1 binding by ChIP-seq in 20 primary breast cancers identified a core of 484 ESR-binding events that were conserved in at least 75% of ER+ tumors, which may represent a more realistic estimate (Ross-Innes et al, 2012). These studies also highlight the long-range effect of estrogen receptor-binding, with distal enhancer or promoter elements regulating the expression of many target genes, often through looping or other higher order chromatin structures (Kittler et al, 2013; reviewed in Dietz and Carroll, 2008; Liu and Cheung, 2014; Magnani and Lupien, 2014). Transcription from a number of estrogen-responsive target genes also appears to be primed by the binding of pioneering transcription factors such as FOXA1, GATA3, PBX1 among others
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AFF1 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 20153263 , 21030982 , 21729782 , 23455922 , 23602568 , 24367103 , 26186194 , 28514442 , (Europe PMC )0.78 BioGRID, IntAct AFF3 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , 23602568 , 26186194 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct AFF4 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 12065898 , 17643375 , 20153263 , 21729782 , 21873227 , 22483617 , 23455922 , 23602568 , 26186194 , 28514442 , (Europe PMC )0.78 BioGRID, IntAct AIP Affinity Capture-MS, tandem affinity purification association, physical 23455922 , 26186194 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct ALK Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID ANXA2 Co-fractionation physical 9184228 , (Europe PMC )NA BioGRID APC Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID AR Affinity Capture-Western, Reconstituted Complex physical 11266437 , (Europe PMC )NA BioGRID ARID3B Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID ATM Co-localization physical 24957606 , (Europe PMC )NA BioGRID ATP1A1 Affinity Capture-MS physical 20305087 , (Europe PMC )NA BioGRID ATR Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 20930849 , (Europe PMC )0.56 BioGRID, IntAct, MINT ATRIP Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 20930849 , (Europe PMC )0.56 BioGRID, IntAct, MINT BARD1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID BCL10 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct BRCA1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID BRCA2 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID BRD4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Synthetic Lethality, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, direct interaction, genetic, physical, physical association 16109376 , 16109377 , 16980611 , 17643375 , 17690245 , 18039861 , 19766566 , 21555454 , 24360279 , 24367103 , 26659056 , 27453043 , (Europe PMC )0.35, 0.66 BioGRID, IntAct BRDT Affinity Capture-Western physical 17690245 , (Europe PMC )NA BioGRID CASK Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct CASP8 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID CCAR2 Affinity Capture-MS, Co-fractionation physical 17643375 , 22863883 , (Europe PMC )NA BioGRID CCDC87 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CCNH Co-fractionation physical 9184228 , (Europe PMC )NA BioGRID CCNK Reconstituted Complex, Two-hybrid physical 10574912 , (Europe PMC )NA BioGRID CCNT1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-fractionation, Co-localization, Co-purification, Phenotypic Suppression, Protein-RNA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, ion exchange chromatography, protein kinase assay, pull down, tandem affinity purification, x-ray crystallography association, direct interaction, genetic, phosphorylation reaction, physical, physical association 10465067 , 10574912 , 10656684 , 10958691 , 11282025 , 11689688 , 11713532 , 11713533 , 12115727 , 12588988 , 12832472 , 12894230 , 12944466 , 14580347 , 14627702 , 15107825 , 15328539 , 15528190 , 15546612 , 15713661 , 15713662 , 16109377 , 16980611 , 17643375 , 17700062 , 18483487 , 18566585 , 19387490 , 19818711 , 19914168 , 20153263 , 20305087 , 20535204 , 20562857 , 21697490 , 21729782 , 22483617 , 22939629 , 22959624 , 23064645 , 23455922 , 23602568 , 24367103 , 26186194 , 26344197 , 26659056 , 28514442 , 9491887 , 9499409 , 9872325 , (Europe PMC )0.97 BioGRID, IntAct, MINT CCNT2 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Reconstituted Complex physical 10465067 , 11713533 , 16331689 , 17643375 , 18566585 , 21729782 , 23455922 , 23602568 , 26186194 , 26344197 , 28514442 , 9499409 , (Europe PMC )NA BioGRID CCT3 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CCT4 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CCT5 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CCT8 Affinity Capture-MS physical 17643375 , 20305087 , (Europe PMC )NA BioGRID CDC34 Affinity Capture-Western, Reconstituted Complex physical 11689688 , (Europe PMC )NA BioGRID CDC37 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 20305087 , 23455922 , 24189400 , 25036637 , 26186194 , 28514442 , (Europe PMC )0.67 BioGRID, IntAct CDC5L Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT CDC7 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct CDC73 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17643375 , 26659056 , (Europe PMC )0.35 BioGRID, IntAct CDK12 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , 23602568 , (Europe PMC )0.53 BioGRID, IntAct CDK15 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct CDK5R1 Affinity Capture-Western physical 22654103 , (Europe PMC )NA BioGRID CDK7 Biochemical Activity, Co-fractionation physical 11145967 , 23064645 , 9184228 , (Europe PMC )NA BioGRID CDK9 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-fractionation physical 10958691 , 11572868 , 14580347 , 15328539 , 18566585 , 18971272 , 20603019 , 21729782 , 23602568 , 8870681 , 9491887 , 9557739 , (Europe PMC )NA BioGRID CENPA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHEK1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID CKAP5 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CLSPN Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 20930849 , (Europe PMC )0.56 BioGRID, IntAct, MINT CNOT9 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CSNK2A1 Affinity Capture-Western physical 16741955 , (Europe PMC )NA BioGRID CSNK2B Affinity Capture-MS, Affinity Capture-Western physical 16741955 , 17643375 , (Europe PMC )NA BioGRID CTDP1 Biochemical Activity physical 15201869 , 16109377 , 19914168 , (Europe PMC )NA BioGRID CTR9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CUL1 Affinity Capture-Western physical 11689688 , 12861003 , (Europe PMC )NA BioGRID DDX5 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID DLD Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DTYMK Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID EAF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21729782 , (Europe PMC )0.35 BioGRID, IntAct ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID ELL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21729782 , (Europe PMC )0.35 BioGRID, IntAct ELL2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 21729782 , 21873227 , 22483617 , (Europe PMC )0.35 BioGRID, IntAct EXOSC5 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID FBXL19 Affinity Capture-Western physical 28453857 , (Europe PMC )NA BioGRID FBXO25 Biochemical Activity physical 23940030 , (Europe PMC )NA BioGRID FGFR1 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct FGFR4 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct FGR Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID FKBP5 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 17643375 , 23455922 , 23602568 , 25036637 , 26186194 , 28363942 , 28514442 , (Europe PMC )0.71 BioGRID, IntAct GATA6 Affinity Capture-Western physical 20081228 , (Europe PMC )NA BioGRID GRN Affinity Capture-Western physical 12588988 , (Europe PMC )NA BioGRID GSS Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID GTF2F1 Biochemical Activity, Co-fractionation physical 12591939 , 22939629 , (Europe PMC )NA BioGRID HEXIM1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 12832472 , 14580347 , 15169877 , 15201869 , 15713661 , 15713662 , 16109377 , 16980611 , 17643375 , 18483487 , 20562857 , 22483617 , 22948151 , 23455922 , 24360279 , 24367103 , 25470060 , 26186194 , 28514442 , (Europe PMC )0.83 BioGRID, IntAct, MINT HEXIM2 Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 15713661 , 15713662 , 17643375 , 23455922 , 26186194 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct HINT1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HIST2H2BE Co-fractionation, Reconstituted Complex physical 24837678 , (Europe PMC )NA BioGRID HLTF Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct HNRNPA0 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPA1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPA2B1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPD Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPH1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPK Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPR Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPU Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HSP90AA1 Affinity Capture-Luminescence, Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 20305087 , 22939624 , 23455922 , 25036637 , 26186194 , 28514442 , (Europe PMC )0.56 BioGRID, IntAct HSP90AA4P Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HSP90AA5P Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HSP90AB1 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 17643375 , 22939624 , 23455922 , 26186194 , 28514442 , (Europe PMC )0.56 BioGRID, IntAct HSP90AB3P Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HSP90AB4P Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HSPA1A Affinity Capture-Western physical 10617616 , (Europe PMC )NA BioGRID HSPA2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HSPA5 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HSPA6 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HSPD1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID IGF2BP1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID IGF2BP2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID IL6ST Reconstituted Complex physical 12386808 , (Europe PMC )NA BioGRID ILF2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID ILKAP Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID IMMT Co-fractionation physical 9184228 , (Europe PMC )NA BioGRID ING5 Synthetic Lethality genetic 27453043 , (Europe PMC )NA BioGRID KLC4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KMT2A Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 20153263 , 20854876 , 22094252 , (Europe PMC )0.35 BioGRID, IntAct KPNA2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID LANCL2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID LARP7 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 17643375 , 18281698 , 18483487 , 20562857 , 23455922 , 23602568 , 24367103 , 26186194 , 26659056 , 28514442 , (Europe PMC )0.88 BioGRID, IntAct, MINT MARS Affinity Capture-MS physical 20305087 , (Europe PMC )NA BioGRID MATR3 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID MBP Biochemical Activity physical 15328539 , 8170997 , (Europe PMC )NA BioGRID MDFIC Affinity Capture-Western, Reconstituted Complex physical 12944466 , (Europe PMC )NA BioGRID MDM2 Affinity Capture-Western physical 19617712 , (Europe PMC )NA BioGRID MED1 Affinity Capture-MS physical 20133760 , (Europe PMC )NA BioGRID MED12 Affinity Capture-MS physical 20133760 , (Europe PMC )NA BioGRID MED26 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 21729782 , (Europe PMC )0.35 BioGRID, IntAct MED28 Affinity Capture-MS physical 20133760 , (Europe PMC )NA BioGRID MEPCE Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 17643375 , 23455922 , 23602568 , 24367103 , 26186194 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct MLLT1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 19956800 , 20153263 , 20431927 , 21729782 , 21873227 , 22483617 , 23455922 , 23602568 , 25921070 , 26186194 , 28514442 , (Europe PMC )0.73 BioGRID, IntAct MLLT3 Affinity Capture-MS, Affinity Capture-Western physical 20431927 , 20854876 , 21729782 , 21873227 , 23455922 , 23602568 , 25417107 , 26186194 , 28514442 , (Europe PMC )NA BioGRID MRPS27 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID MSH2 Affinity Capture-MS physical 20305087 , (Europe PMC )NA BioGRID MSL1 Co-fractionation physical 24837678 , (Europe PMC )NA BioGRID MSL2 Co-fractionation physical 24837678 , (Europe PMC )NA BioGRID MYBL2 Affinity Capture-Western, Biochemical Activity, Phenotypic Suppression, Reconstituted Complex genetic, physical 10656684 , (Europe PMC )NA BioGRID MYC Affinity Capture-Western, Reconstituted Complex physical 11673469 , 12944920 , 17700062 , 19818711 , 26687678 , (Europe PMC )NA BioGRID NUFIP1 Affinity Capture-Western physical 15107825 , (Europe PMC )NA BioGRID OXSR1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID P4HA1 Affinity Capture-MS physical 20305087 , (Europe PMC )NA BioGRID PAF1 Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation association, physical 21873227 , 24837678 , 26659056 , (Europe PMC )0.35 BioGRID, IntAct PAXIP1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PCBP2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID PDGFRA Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID PGC Affinity Capture-Western physical 18200011 , (Europe PMC )NA BioGRID PIK3CA Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID PLEC Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PMS1 Affinity Capture-Western physical 17148452 , (Europe PMC )NA BioGRID POLR2A Affinity Capture-Western, Biochemical Activity, Co-fractionation, anti bait coimmunoprecipitation association, physical 11278802 , 12036313 , 12052871 , 12591939 , 12861003 , 14580347 , 14627702 , 15009212 , 15169877 , 15328539 , 15713661 , 16735508 , 17234882 , 18391197 , 18566585 , 21030982 , 21873227 , 22379099 , 22592529 , 23064645 , 24837678 , 26659056 , (Europe PMC )0.35 BioGRID, IntAct PRKDC Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID RAD21 Affinity Capture-Western physical 22145905 , (Europe PMC )NA BioGRID RB1 Affinity Capture-Western, Biochemical Activity, Co-fractionation, Reconstituted Complex physical 12037672 , 8170997 , 8870681 , 9258347 , (Europe PMC )NA BioGRID RBM39 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RCHY1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 23603988 , (Europe PMC )NA BioGRID RELA Affinity Capture-Western, Reconstituted Complex physical 12173051 , (Europe PMC )NA BioGRID RFC4 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RMND5B Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct RN7SK Affinity Capture-RNA, Affinity Capture-Western, Protein-RNA physical 11713532 , 11713533 , 14580347 , 15713661 , 16109377 , 18483487 , (Europe PMC )NA BioGRID RNF20 Co-fractionation physical 24837678 , (Europe PMC )NA BioGRID RNF40 Co-fractionation physical 24837678 , (Europe PMC )NA BioGRID ROR1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID RPN1 Affinity Capture-MS physical 20305087 , (Europe PMC )NA BioGRID RPS11 Synthetic Lethality genetic 27453043 , (Europe PMC )NA BioGRID RPS4X Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RRM2 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID RUNX1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID RUVBL1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RUVBL2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID SART3 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID SEC31A Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SETD1B Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 28655758 , (Europe PMC )NA BioGRID SKIV2L Affinity Capture-Western physical 12861003 , (Europe PMC )NA BioGRID SKP1 Affinity Capture-Western, Reconstituted Complex physical 11689688 , (Europe PMC )NA BioGRID SKP2 Affinity Capture-Western physical 11689688 , (Europe PMC )NA BioGRID SMAD1 Biochemical Activity physical 19914168 , (Europe PMC )NA BioGRID SMAD2 Biochemical Activity physical 19914168 , (Europe PMC )NA BioGRID SMAD3 Biochemical Activity physical 19914168 , (Europe PMC )NA BioGRID SMAD4 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID SMARCB1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID SMC2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SMC4 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SNRPD2P1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID SNW1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 19818711 , 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT SQSTM1 Co-fractionation physical 9184228 , (Europe PMC )NA BioGRID SRCAP Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID STAT3 Affinity Capture-Western, Reconstituted Complex physical 15286705 , (Europe PMC )NA BioGRID STIP1 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct SUPT16H Affinity Capture-Western, anti bait coimmunoprecipitation, molecular sieving association, physical 20603019 , (Europe PMC )0.46 BioGRID, IntAct SUPT5H Biochemical Activity, Reconstituted Complex, protein kinase assay direct interaction, physical 10958691 , 15201869 , 16327805 , 23064645 , (Europe PMC )0.44 BioGRID, IntAct SYNCRIP Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID TAF7 Reconstituted Complex physical 18391197 , (Europe PMC )NA BioGRID TAL1 Affinity Capture-Western, anti bait coimmunoprecipitation, molecular sieving association, physical 20603019 , (Europe PMC )0.46 BioGRID, IntAct TCEA1 Affinity Capture-Western, Co-localization, Reconstituted Complex, pull down association, physical 20562857 , 21127351 , (Europe PMC )0.35 BioGRID, IntAct TERF1 Affinity Capture-MS physical 20811636 , (Europe PMC )NA BioGRID TERF2 Affinity Capture-MS physical 20811636 , (Europe PMC )NA BioGRID TP53 Affinity Capture-Western, Biochemical Activity, Phenotypic Suppression, Reconstituted Complex genetic, physical 10656684 , 16741955 , (Europe PMC )NA BioGRID TRAF2 Affinity Capture-Western physical 9827693 , (Europe PMC )NA BioGRID TRAP1 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct TRIM28 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID TRIM33 Affinity Capture-Western, anti bait coimmunoprecipitation, molecular sieving association, physical 20603019 , (Europe PMC )0.46 BioGRID, IntAct TRIP12 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID TUBB4B Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID UBE2A Affinity Capture-Western, Biochemical Activity physical 22592529 , (Europe PMC )NA BioGRID UBE2S Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID UBL4A Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID UBR5 Affinity Capture-Western, Biochemical Activity, Co-localization physical 21127351 , (Europe PMC )NA BioGRID XRCC3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct YBX1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID ZC3H13 Affinity Capture-MS physical 20133760 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AFF3 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , 23602568 , 26186194 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct AFF4 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 12065898 , 17643375 , 20153263 , 21729782 , 21873227 , 22483617 , 23455922 , 23602568 , 26186194 , 28514442 , (Europe PMC )0.78 BioGRID, IntAct AIP Affinity Capture-MS, tandem affinity purification association, physical 23455922 , 26186194 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct ATR Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 20930849 , (Europe PMC )0.56 BioGRID, IntAct, MINT ATRIP Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 20930849 , (Europe PMC )0.56 BioGRID, IntAct, MINT BCL10 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct BRD4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Synthetic Lethality, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, direct interaction, genetic, physical, physical association 16109376 , 16109377 , 16980611 , 17643375 , 17690245 , 18039861 , 19766566 , 21555454 , 24360279 , 24367103 , 26659056 , 27453043 , (Europe PMC )0.35, 0.66 BioGRID, IntAct CASK Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct CCNT1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-fractionation, Co-localization, Co-purification, Phenotypic Suppression, Protein-RNA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, ion exchange chromatography, protein kinase assay, pull down, tandem affinity purification, x-ray crystallography association, direct interaction, genetic, phosphorylation reaction, physical, physical association 10465067 , 10574912 , 10656684 , 10958691 , 11282025 , 11689688 , 11713532 , 11713533 , 12115727 , 12588988 , 12832472 , 12894230 , 12944466 , 14580347 , 14627702 , 15107825 , 15328539 , 15528190 , 15546612 , 15713661 , 15713662 , 16109377 , 16980611 , 17643375 , 17700062 , 18483487 , 18566585 , 19387490 , 19818711 , 19914168 , 20153263 , 20305087 , 20535204 , 20562857 , 21697490 , 21729782 , 22483617 , 22939629 , 22959624 , 23064645 , 23455922 , 23602568 , 24367103 , 26186194 , 26344197 , 26659056 , 28514442 , 9491887 , 9499409 , 9872325 , (Europe PMC )0.97 BioGRID, IntAct, MINT CCNT2 anti tag coimmunoprecipitation, tandem affinity purification association 21729782 , 23455922 , 23602568 , (Europe PMC )0.64 IntAct CDC37 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 20305087 , 23455922 , 24189400 , 25036637 , 26186194 , 28514442 , (Europe PMC )0.67 BioGRID, IntAct CDC5L Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT CDC7 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct CDC73 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17643375 , 26659056 , (Europe PMC )0.35 BioGRID, IntAct CDK12 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , 23602568 , (Europe PMC )0.53 BioGRID, IntAct CDK15 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct CDK19 pull down association 23746844 , (Europe PMC )0.35 IntAct CDK8 anti bait coimmunoprecipitation, pull down association 20098423 , 23746844 , (Europe PMC )0.53 IntAct CENPA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLSPN Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 20930849 , (Europe PMC )0.56 BioGRID, IntAct, MINT CTR9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DDX21 anti bait coimmunoprecipitation physical association 25470060 , (Europe PMC )0.40 IntAct DLD Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct EAF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21729782 , (Europe PMC )0.35 BioGRID, IntAct EBI-2890930 anti tag coimmunoprecipitation association 22094252 , (Europe PMC )0.35 IntAct EBI-9077146 pull down association 24360279 , (Europe PMC )0.35 IntAct ELL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21729782 , (Europe PMC )0.35 BioGRID, IntAct ELL2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 21729782 , 21873227 , 22483617 , (Europe PMC )0.35 BioGRID, IntAct ELL3 anti tag coimmunoprecipitation association 21729782 , (Europe PMC )0.35 IntAct ENSG00000102145 chromatin immunoprecipitation assay association 20603019 , (Europe PMC )0.35 IntAct ENSG00000113739 chromatin immunoprecipitation assay association 23746844 , (Europe PMC )0.35 IntAct ENSG00000114251 chromatin immunoprecipitation assay association 24525235 , (Europe PMC )0.35 IntAct ENSG00000121966 chromatin immunoprecipitation assay association 23746844 , (Europe PMC )0.35 IntAct ENSG00000136997 chromatin immunoprecipitation assay association 21729782 , (Europe PMC )0.35 IntAct ENSG00000151276 chromatin immunoprecipitation assay association 23746844 , (Europe PMC )0.35 IntAct ENSG00000152332 chromatin immunoprecipitation assay association 23746844 , (Europe PMC )0.35 IntAct ENSG00000158578 chromatin immunoprecipitation assay association 20603019 , (Europe PMC )0.35 IntAct ENSG00000159216 chromatin immunoprecipitation assay association 20603019 , (Europe PMC )0.35 IntAct ENSG00000179348 chromatin immunoprecipitation assay association 20603019 , (Europe PMC )0.35 IntAct ENSG00000186352 chromatin immunoprecipitation assay association 23746844 , (Europe PMC )0.35 IntAct ENSG00000235941 chromatin immunoprecipitation assay association 21729782 , (Europe PMC )0.35 IntAct FGFR1 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct FGFR4 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct FKBP5 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 17643375 , 23455922 , 23602568 , 25036637 , 26186194 , 28363942 , 28514442 , (Europe PMC )0.71 BioGRID, IntAct HEXIM1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 12832472 , 14580347 , 15169877 , 15201869 , 15713661 , 15713662 , 16109377 , 16980611 , 17643375 , 18483487 , 20562857 , 22483617 , 22948151 , 23455922 , 24360279 , 24367103 , 25470060 , 26186194 , 28514442 , (Europe PMC )0.83 BioGRID, IntAct, MINT HEXIM2 Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 15713661 , 15713662 , 17643375 , 23455922 , 26186194 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct HLTF Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct HSP90AA1 Affinity Capture-Luminescence, Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 20305087 , 22939624 , 23455922 , 25036637 , 26186194 , 28514442 , (Europe PMC )0.56 BioGRID, IntAct HSP90AB1 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 17643375 , 22939624 , 23455922 , 26186194 , 28514442 , (Europe PMC )0.56 BioGRID, IntAct JMJD6 anti tag coimmunoprecipitation, pull down direct interaction, physical association 24360279 , (Europe PMC )0.54 IntAct KLC4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KMT2A Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 20153263 , 20854876 , 22094252 , (Europe PMC )0.35 BioGRID, IntAct LARP7 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 17643375 , 18281698 , 18483487 , 20562857 , 23455922 , 23602568 , 24367103 , 26186194 , 26659056 , 28514442 , (Europe PMC )0.88 BioGRID, IntAct, MINT MED26 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 21729782 , (Europe PMC )0.35 BioGRID, IntAct MEPCE Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 17643375 , 23455922 , 23602568 , 24367103 , 26186194 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct MLLT1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 19956800 , 20153263 , 20431927 , 21729782 , 21873227 , 22483617 , 23455922 , 23602568 , 25921070 , 26186194 , 28514442 , (Europe PMC )0.73 BioGRID, IntAct MLLT3 anti tag coimmunoprecipitation, tandem affinity purification association 21729782 , 23455922 , 23602568 , (Europe PMC )0.64 IntAct PAF1 Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation association, physical 21873227 , 24837678 , 26659056 , (Europe PMC )0.35 BioGRID, IntAct POLR2A Affinity Capture-Western, Biochemical Activity, Co-fractionation, anti bait coimmunoprecipitation association, physical 11278802 , 12036313 , 12052871 , 12591939 , 12861003 , 14580347 , 14627702 , 15009212 , 15169877 , 15328539 , 15713661 , 16735508 , 17234882 , 18391197 , 18566585 , 21030982 , 21873227 , 22379099 , 22592529 , 23064645 , 24837678 , 26659056 , (Europe PMC )0.35 BioGRID, IntAct PPM1A anti tag coimmunoprecipitation physical association 18829461 , (Europe PMC )0.40 IntAct, MINT PPP1CC genetic interference genetic interaction 21098020 , 21533037 , (Europe PMC )0.28 IntAct, MINT PPP5C anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical association 28330616 , (Europe PMC )0.56 IntAct PSMD2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct RMND5B Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SNW1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 19818711 , 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT STIP1 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct SUPT16H Affinity Capture-Western, anti bait coimmunoprecipitation, molecular sieving association, physical 20603019 , (Europe PMC )0.46 BioGRID, IntAct SUPT5H Biochemical Activity, Reconstituted Complex, protein kinase assay direct interaction, physical 10958691 , 15201869 , 16327805 , 23064645 , (Europe PMC )0.44 BioGRID, IntAct TAL1 Affinity Capture-Western, anti bait coimmunoprecipitation, molecular sieving association, physical 20603019 , (Europe PMC )0.46 BioGRID, IntAct TCEA1 Affinity Capture-Western, Co-localization, Reconstituted Complex, pull down association, physical 20562857 , 21127351 , (Europe PMC )0.35 BioGRID, IntAct TRAP1 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct TRIM33 Affinity Capture-Western, anti bait coimmunoprecipitation, molecular sieving association, physical 20603019 , (Europe PMC )0.46 BioGRID, IntAct TWIST1 anti tag coimmunoprecipitation association 24525235 , (Europe PMC )0.35 IntAct XRCC3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ATRIP Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 20930849 , (Europe PMC )0.56 BioGRID, IntAct, MINT CCNT1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-fractionation, Co-localization, Co-purification, Phenotypic Suppression, Protein-RNA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, ion exchange chromatography, protein kinase assay, pull down, tandem affinity purification, x-ray crystallography association, direct interaction, genetic, phosphorylation reaction, physical, physical association 10465067 , 10574912 , 10656684 , 10958691 , 11282025 , 11689688 , 11713532 , 11713533 , 12115727 , 12588988 , 12832472 , 12894230 , 12944466 , 14580347 , 14627702 , 15107825 , 15328539 , 15528190 , 15546612 , 15713661 , 15713662 , 16109377 , 16980611 , 17643375 , 17700062 , 18483487 , 18566585 , 19387490 , 19818711 , 19914168 , 20153263 , 20305087 , 20535204 , 20562857 , 21697490 , 21729782 , 22483617 , 22939629 , 22959624 , 23064645 , 23455922 , 23602568 , 24367103 , 26186194 , 26344197 , 26659056 , 28514442 , 9491887 , 9499409 , 9872325 , (Europe PMC )0.97 BioGRID, IntAct, MINT CDC5L Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT CLSPN Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 20930849 , (Europe PMC )0.56 BioGRID, IntAct, MINT HEXIM1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 12832472 , 14580347 , 15169877 , 15201869 , 15713661 , 15713662 , 16109377 , 16980611 , 17643375 , 18483487 , 20562857 , 22483617 , 22948151 , 23455922 , 24360279 , 24367103 , 25470060 , 26186194 , 28514442 , (Europe PMC )0.83 BioGRID, IntAct, MINT LARP7 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 17643375 , 18281698 , 18483487 , 20562857 , 23455922 , 23602568 , 24367103 , 26186194 , 26659056 , 28514442 , (Europe PMC )0.88 BioGRID, IntAct, MINT PPM1A anti tag coimmunoprecipitation physical association 18829461 , (Europe PMC )0.40 IntAct, MINT PPP1CC genetic interference genetic interaction 21098020 , 21533037 , (Europe PMC )0.28 IntAct, MINT SNW1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 19818711 , 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AFF1 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 20153263 , 21030982 , 21729782 , 23455922 , 23602568 , 24367103 , 26186194 , 28514442 , (Europe PMC )0.78 BioGRID, IntAct AFF3 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , 23602568 , 26186194 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct AFF4 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 12065898 , 17643375 , 20153263 , 21729782 , 21873227 , 22483617 , 23455922 , 23602568 , 26186194 , 28514442 , (Europe PMC )0.78 BioGRID, IntAct AIP Affinity Capture-MS, tandem affinity purification association, physical 23455922 , 26186194 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct ALK Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID ANXA2 Co-fractionation physical 9184228 , (Europe PMC )NA BioGRID APC Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID AR Affinity Capture-Western, Reconstituted Complex physical 11266437 , (Europe PMC )NA BioGRID ARID3B Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID ATM Co-localization physical 24957606 , (Europe PMC )NA BioGRID ATP1A1 Affinity Capture-MS physical 20305087 , (Europe PMC )NA BioGRID ATR Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 20930849 , (Europe PMC )0.56 BioGRID, IntAct, MINT ATRIP Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 20930849 , (Europe PMC )0.56 BioGRID, IntAct, MINT BARD1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID BCL10 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct BRCA1 Two-hybrid physical 22990118 , (Europe PMC )NA BioGRID BRCA2 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID BRD4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Synthetic Lethality, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, direct interaction, genetic, physical, physical association 16109376 , 16109377 , 16980611 , 17643375 , 17690245 , 18039861 , 19766566 , 21555454 , 24360279 , 24367103 , 26659056 , 27453043 , (Europe PMC )0.35, 0.66 BioGRID, IntAct BRDT Affinity Capture-Western physical 17690245 , (Europe PMC )NA BioGRID CASK Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct CASP8 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID CCAR2 Affinity Capture-MS, Co-fractionation physical 17643375 , 22863883 , (Europe PMC )NA BioGRID CCDC87 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CCNH Co-fractionation physical 9184228 , (Europe PMC )NA BioGRID CCNK Reconstituted Complex, Two-hybrid physical 10574912 , (Europe PMC )NA BioGRID CCNT1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-fractionation, Co-localization, Co-purification, Phenotypic Suppression, Protein-RNA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, ion exchange chromatography, protein kinase assay, pull down, tandem affinity purification, x-ray crystallography association, direct interaction, genetic, phosphorylation reaction, physical, physical association 10465067 , 10574912 , 10656684 , 10958691 , 11282025 , 11689688 , 11713532 , 11713533 , 12115727 , 12588988 , 12832472 , 12894230 , 12944466 , 14580347 , 14627702 , 15107825 , 15328539 , 15528190 , 15546612 , 15713661 , 15713662 , 16109377 , 16980611 , 17643375 , 17700062 , 18483487 , 18566585 , 19387490 , 19818711 , 19914168 , 20153263 , 20305087 , 20535204 , 20562857 , 21697490 , 21729782 , 22483617 , 22939629 , 22959624 , 23064645 , 23455922 , 23602568 , 24367103 , 26186194 , 26344197 , 26659056 , 28514442 , 9491887 , 9499409 , 9872325 , (Europe PMC )0.97 BioGRID, IntAct, MINT CCNT2 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Reconstituted Complex physical 10465067 , 11713533 , 16331689 , 17643375 , 18566585 , 21729782 , 23455922 , 23602568 , 26186194 , 26344197 , 28514442 , 9499409 , (Europe PMC )NA BioGRID CCNT2 anti tag coimmunoprecipitation, tandem affinity purification association 21729782 , 23455922 , 23602568 , (Europe PMC )0.64 IntAct CCT3 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CCT4 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CCT5 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CCT8 Affinity Capture-MS physical 17643375 , 20305087 , (Europe PMC )NA BioGRID CDC34 Affinity Capture-Western, Reconstituted Complex physical 11689688 , (Europe PMC )NA BioGRID CDC37 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 20305087 , 23455922 , 24189400 , 25036637 , 26186194 , 28514442 , (Europe PMC )0.67 BioGRID, IntAct CDC5L Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT CDC7 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct CDC73 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17643375 , 26659056 , (Europe PMC )0.35 BioGRID, IntAct CDK12 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , 23602568 , (Europe PMC )0.53 BioGRID, IntAct CDK15 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct CDK19 pull down association 23746844 , (Europe PMC )0.35 IntAct CDK5R1 Affinity Capture-Western physical 22654103 , (Europe PMC )NA BioGRID CDK7 Biochemical Activity, Co-fractionation physical 11145967 , 23064645 , 9184228 , (Europe PMC )NA BioGRID CDK8 anti bait coimmunoprecipitation, pull down association 20098423 , 23746844 , (Europe PMC )0.53 IntAct CDK9 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-fractionation physical 10958691 , 11572868 , 14580347 , 15328539 , 18566585 , 18971272 , 20603019 , 21729782 , 23602568 , 8870681 , 9491887 , 9557739 , (Europe PMC )NA BioGRID CENPA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHEK1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID CKAP5 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CLSPN Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 20930849 , (Europe PMC )0.56 BioGRID, IntAct, MINT CNOT9 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CSNK2A1 Affinity Capture-Western physical 16741955 , (Europe PMC )NA BioGRID CSNK2B Affinity Capture-MS, Affinity Capture-Western physical 16741955 , 17643375 , (Europe PMC )NA BioGRID CTDP1 Biochemical Activity physical 15201869 , 16109377 , 19914168 , (Europe PMC )NA BioGRID CTR9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CUL1 Affinity Capture-Western physical 11689688 , 12861003 , (Europe PMC )NA BioGRID DDX21 anti bait coimmunoprecipitation physical association 25470060 , (Europe PMC )0.40 IntAct DDX5 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID DLD Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DTYMK Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID EAF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21729782 , (Europe PMC )0.35 BioGRID, IntAct EBI-2890930 anti tag coimmunoprecipitation association 22094252 , (Europe PMC )0.35 IntAct EBI-9077146 pull down association 24360279 , (Europe PMC )0.35 IntAct ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID ELL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21729782 , (Europe PMC )0.35 BioGRID, IntAct ELL2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 21729782 , 21873227 , 22483617 , (Europe PMC )0.35 BioGRID, IntAct ELL3 anti tag coimmunoprecipitation association 21729782 , (Europe PMC )0.35 IntAct ENSG00000102145 chromatin immunoprecipitation assay association 20603019 , (Europe PMC )0.35 IntAct ENSG00000113739 chromatin immunoprecipitation assay association 23746844 , (Europe PMC )0.35 IntAct ENSG00000114251 chromatin immunoprecipitation assay association 24525235 , (Europe PMC )0.35 IntAct ENSG00000121966 chromatin immunoprecipitation assay association 23746844 , (Europe PMC )0.35 IntAct ENSG00000136997 chromatin immunoprecipitation assay association 21729782 , (Europe PMC )0.35 IntAct ENSG00000151276 chromatin immunoprecipitation assay association 23746844 , (Europe PMC )0.35 IntAct ENSG00000152332 chromatin immunoprecipitation assay association 23746844 , (Europe PMC )0.35 IntAct ENSG00000158578 chromatin immunoprecipitation assay association 20603019 , (Europe PMC )0.35 IntAct ENSG00000159216 chromatin immunoprecipitation assay association 20603019 , (Europe PMC )0.35 IntAct ENSG00000179348 chromatin immunoprecipitation assay association 20603019 , (Europe PMC )0.35 IntAct ENSG00000186352 chromatin immunoprecipitation assay association 23746844 , (Europe PMC )0.35 IntAct ENSG00000235941 chromatin immunoprecipitation assay association 21729782 , (Europe PMC )0.35 IntAct EXOSC5 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID FBXL19 Affinity Capture-Western physical 28453857 , (Europe PMC )NA BioGRID FBXO25 Biochemical Activity physical 23940030 , (Europe PMC )NA BioGRID FGFR1 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct FGFR4 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct FGR Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID FKBP5 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 17643375 , 23455922 , 23602568 , 25036637 , 26186194 , 28363942 , 28514442 , (Europe PMC )0.71 BioGRID, IntAct GATA6 Affinity Capture-Western physical 20081228 , (Europe PMC )NA BioGRID GRN Affinity Capture-Western physical 12588988 , (Europe PMC )NA BioGRID GSS Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID GTF2F1 Biochemical Activity, Co-fractionation physical 12591939 , 22939629 , (Europe PMC )NA BioGRID HEXIM1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 12832472 , 14580347 , 15169877 , 15201869 , 15713661 , 15713662 , 16109377 , 16980611 , 17643375 , 18483487 , 20562857 , 22483617 , 22948151 , 23455922 , 24360279 , 24367103 , 25470060 , 26186194 , 28514442 , (Europe PMC )0.83 BioGRID, IntAct, MINT HEXIM2 Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 15713661 , 15713662 , 17643375 , 23455922 , 26186194 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct HINT1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HIST2H2BE Co-fractionation, Reconstituted Complex physical 24837678 , (Europe PMC )NA BioGRID HLTF Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct HNRNPA0 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPA1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPA2B1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPD Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPH1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPK Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPR Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HNRNPU Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HSP90AA1 Affinity Capture-Luminescence, Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 20305087 , 22939624 , 23455922 , 25036637 , 26186194 , 28514442 , (Europe PMC )0.56 BioGRID, IntAct HSP90AA4P Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HSP90AA5P Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HSP90AB1 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 17643375 , 22939624 , 23455922 , 26186194 , 28514442 , (Europe PMC )0.56 BioGRID, IntAct HSP90AB3P Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HSP90AB4P Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HSPA1A Affinity Capture-Western physical 10617616 , (Europe PMC )NA BioGRID HSPA2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HSPA5 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HSPA6 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID HSPD1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID IGF2BP1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID IGF2BP2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID IL6ST Reconstituted Complex physical 12386808 , (Europe PMC )NA BioGRID ILF2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID ILKAP Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID IMMT Co-fractionation physical 9184228 , (Europe PMC )NA BioGRID ING5 Synthetic Lethality genetic 27453043 , (Europe PMC )NA BioGRID JMJD6 anti tag coimmunoprecipitation, pull down direct interaction, physical association 24360279 , (Europe PMC )0.54 IntAct KLC4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KMT2A Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 20153263 , 20854876 , 22094252 , (Europe PMC )0.35 BioGRID, IntAct KPNA2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID LANCL2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID LARP7 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 17643375 , 18281698 , 18483487 , 20562857 , 23455922 , 23602568 , 24367103 , 26186194 , 26659056 , 28514442 , (Europe PMC )0.88 BioGRID, IntAct, MINT MARS Affinity Capture-MS physical 20305087 , (Europe PMC )NA BioGRID MATR3 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID MBP Biochemical Activity physical 15328539 , 8170997 , (Europe PMC )NA BioGRID MDFIC Affinity Capture-Western, Reconstituted Complex physical 12944466 , (Europe PMC )NA BioGRID MDM2 Affinity Capture-Western physical 19617712 , (Europe PMC )NA BioGRID MED1 Affinity Capture-MS physical 20133760 , (Europe PMC )NA BioGRID MED12 Affinity Capture-MS physical 20133760 , (Europe PMC )NA BioGRID MED26 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 21729782 , (Europe PMC )0.35 BioGRID, IntAct MED28 Affinity Capture-MS physical 20133760 , (Europe PMC )NA BioGRID MEPCE Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 17643375 , 23455922 , 23602568 , 24367103 , 26186194 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct MLLT1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 19956800 , 20153263 , 20431927 , 21729782 , 21873227 , 22483617 , 23455922 , 23602568 , 25921070 , 26186194 , 28514442 , (Europe PMC )0.73 BioGRID, IntAct MLLT3 Affinity Capture-MS, Affinity Capture-Western physical 20431927 , 20854876 , 21729782 , 21873227 , 23455922 , 23602568 , 25417107 , 26186194 , 28514442 , (Europe PMC )NA BioGRID MLLT3 anti tag coimmunoprecipitation, tandem affinity purification association 21729782 , 23455922 , 23602568 , (Europe PMC )0.64 IntAct MRPS27 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID MSH2 Affinity Capture-MS physical 20305087 , (Europe PMC )NA BioGRID MSL1 Co-fractionation physical 24837678 , (Europe PMC )NA BioGRID MSL2 Co-fractionation physical 24837678 , (Europe PMC )NA BioGRID MYBL2 Affinity Capture-Western, Biochemical Activity, Phenotypic Suppression, Reconstituted Complex genetic, physical 10656684 , (Europe PMC )NA BioGRID MYC Affinity Capture-Western, Reconstituted Complex physical 11673469 , 12944920 , 17700062 , 19818711 , 26687678 , (Europe PMC )NA BioGRID NUFIP1 Affinity Capture-Western physical 15107825 , (Europe PMC )NA BioGRID OXSR1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID P4HA1 Affinity Capture-MS physical 20305087 , (Europe PMC )NA BioGRID PAF1 Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation association, physical 21873227 , 24837678 , 26659056 , (Europe PMC )0.35 BioGRID, IntAct PAXIP1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PCBP2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID PDGFRA Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID PGC Affinity Capture-Western physical 18200011 , (Europe PMC )NA BioGRID PIK3CA Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID PLEC Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PMS1 Affinity Capture-Western physical 17148452 , (Europe PMC )NA BioGRID POLR2A Affinity Capture-Western, Biochemical Activity, Co-fractionation, anti bait coimmunoprecipitation association, physical 11278802 , 12036313 , 12052871 , 12591939 , 12861003 , 14580347 , 14627702 , 15009212 , 15169877 , 15328539 , 15713661 , 16735508 , 17234882 , 18391197 , 18566585 , 21030982 , 21873227 , 22379099 , 22592529 , 23064645 , 24837678 , 26659056 , (Europe PMC )0.35 BioGRID, IntAct PPM1A anti tag coimmunoprecipitation physical association 18829461 , (Europe PMC )0.40 IntAct, MINT PPP1CC genetic interference genetic interaction 21098020 , 21533037 , (Europe PMC )0.28 IntAct, MINT PPP5C anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical association 28330616 , (Europe PMC )0.56 IntAct PRKDC Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID PSMD2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct RAD21 Affinity Capture-Western physical 22145905 , (Europe PMC )NA BioGRID RB1 Affinity Capture-Western, Biochemical Activity, Co-fractionation, Reconstituted Complex physical 12037672 , 8170997 , 8870681 , 9258347 , (Europe PMC )NA BioGRID RBM39 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RCHY1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 23603988 , (Europe PMC )NA BioGRID RELA Affinity Capture-Western, Reconstituted Complex physical 12173051 , (Europe PMC )NA BioGRID RFC4 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RMND5B Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct RN7SK Affinity Capture-RNA, Affinity Capture-Western, Protein-RNA physical 11713532 , 11713533 , 14580347 , 15713661 , 16109377 , 18483487 , (Europe PMC )NA BioGRID RNF20 Co-fractionation physical 24837678 , (Europe PMC )NA BioGRID RNF40 Co-fractionation physical 24837678 , (Europe PMC )NA BioGRID ROR1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID RPN1 Affinity Capture-MS physical 20305087 , (Europe PMC )NA BioGRID RPS11 Synthetic Lethality genetic 27453043 , (Europe PMC )NA BioGRID RPS4X Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RRM2 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID RUNX1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID RUVBL1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RUVBL2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID SART3 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID SEC31A Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SETD1B Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 28655758 , (Europe PMC )NA BioGRID SKIV2L Affinity Capture-Western physical 12861003 , (Europe PMC )NA BioGRID SKP1 Affinity Capture-Western, Reconstituted Complex physical 11689688 , (Europe PMC )NA BioGRID SKP2 Affinity Capture-Western physical 11689688 , (Europe PMC )NA BioGRID SMAD1 Biochemical Activity physical 19914168 , (Europe PMC )NA BioGRID SMAD2 Biochemical Activity physical 19914168 , (Europe PMC )NA BioGRID SMAD3 Biochemical Activity physical 19914168 , (Europe PMC )NA BioGRID SMAD4 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID SMARCB1 Negative Genetic genetic 28319113 , (Europe PMC )NA BioGRID SMC2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SMC4 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SNRPD2P1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID SNW1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 19818711 , 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT SQSTM1 Co-fractionation physical 9184228 , (Europe PMC )NA BioGRID SRCAP Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID STAT3 Affinity Capture-Western, Reconstituted Complex physical 15286705 , (Europe PMC )NA BioGRID STIP1 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct SUPT16H Affinity Capture-Western, anti bait coimmunoprecipitation, molecular sieving association, physical 20603019 , (Europe PMC )0.46 BioGRID, IntAct SUPT5H Biochemical Activity, Reconstituted Complex, protein kinase assay direct interaction, physical 10958691 , 15201869 , 16327805 , 23064645 , (Europe PMC )0.44 BioGRID, IntAct SYNCRIP Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID TAF7 Reconstituted Complex physical 18391197 , (Europe PMC )NA BioGRID TAL1 Affinity Capture-Western, anti bait coimmunoprecipitation, molecular sieving association, physical 20603019 , (Europe PMC )0.46 BioGRID, IntAct TCEA1 Affinity Capture-Western, Co-localization, Reconstituted Complex, pull down association, physical 20562857 , 21127351 , (Europe PMC )0.35 BioGRID, IntAct TERF1 Affinity Capture-MS physical 20811636 , (Europe PMC )NA BioGRID TERF2 Affinity Capture-MS physical 20811636 , (Europe PMC )NA BioGRID TP53 Affinity Capture-Western, Biochemical Activity, Phenotypic Suppression, Reconstituted Complex genetic, physical 10656684 , 16741955 , (Europe PMC )NA BioGRID TRAF2 Affinity Capture-Western physical 9827693 , (Europe PMC )NA BioGRID TRAP1 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct TRIM28 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID TRIM33 Affinity Capture-Western, anti bait coimmunoprecipitation, molecular sieving association, physical 20603019 , (Europe PMC )0.46 BioGRID, IntAct TRIP12 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID TUBB4B Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID TWIST1 anti tag coimmunoprecipitation association 24525235 , (Europe PMC )0.35 IntAct UBE2A Affinity Capture-Western, Biochemical Activity physical 22592529 , (Europe PMC )NA BioGRID UBE2S Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID UBL4A Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID UBR5 Affinity Capture-Western, Biochemical Activity, Co-localization physical 21127351 , (Europe PMC )NA BioGRID XRCC3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct YBX1 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID ZC3H13 Affinity Capture-MS physical 20133760 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
CDK2 S90_EICRTKAsPYNRCKG , NA NA PhosphoSitePlus , CDK9 S347_APPRRKGsQITQQST , S353_GSQITQQsTNQSRNP , T186_NSQPNRYtNRVVTLW , T354_SQITQQStNQSRNPA , T362_NQSRNPAtTNQTEFE , T363_QSRNPATtNQTEFER , NA NA PhosphoSitePlus , Unknown S175_FGLARAFsLAKNSQP , S180_AFSLAKNsQPNRYTN , S334_MLSTHLTsMFEYLAP , S347_APPRRKGsQITQQST , S353_GSQITQQsTNQSRNP , T186_NSQPNRYtNRVVTLW , T330_DLKGMLStHLTSMFE , T333_GMLSTHLtSMFEYLA , HTP, LTP, in vivo 16048649 , 16109377 , 17081983 , 17192257 , 18691976 , 19651622 , 20068231 ,(Europe PMC )HPRD, PhosphoELM ,