DEPOD - human DEPhOsphorylation Database

Basic Information
Phosphatases
Pathway
Interacting Proteins
Phosphorylating Kinases

Gene Name	CTNNB1 (QuickGO)	Interactive visualization of CTNNB1 structures (A quick tutorial to explore the interctive visulaization) Representative structure: 2GL7
Synonyms	CTNNB1, CTNNB, OK/SW-cl.35, PRO2286
Protein Name	CTNNB1
Alternative Name(s)	Catenin beta-1;Beta-catenin;
Protein Family	Belongs to the beta-catenin family
EntrezGene ID	1499 (Comparitive Toxicogenomics)
UniProt AC (Human)	P35222 (protein sequence)
Enzyme Class	N/A
Molecular Weight	85497 Dalton
Protein Length	781 amino acids (AA)
Genome Browsers	NCBI \| ENSG00000168036 (Ensembl) \| UCSC
Crosslinking annotations	Query our ID-mapping table
Orthologues	Quest For Orthologues (QFO) \| GeneTree \| eggNOG - KOG4203 \| eggNOG - COG0035
Phosphorylation Network	Visualize

Domain organization, Expression, Diseases

(show / hide)

Localization, Function, Catalytic activity and Sequence

(show / hide)

Localization (UniProt annotation)
Cytoplasm Nucleus Cytoplasm, cytoskeleton Celljunction, adherens junction Celljunction Cell membrane Cytoplasm, cytoskeleton,microtubule organizing center, centrosome Cytoplasm,cytoskeleton, spindle pole Cell junction, synapse Cytoplasm, cytoskeleton, ciliumbasal body Note=Colocalized withRAPGEF2 and TJP1 at cell-cell contacts (By similarity)Cytoplasmic when it is unstabilized (high level ofphosphorylation) or bound to CDH1 Translocates to the nucleuswhen it is stabilized (low level of phosphorylation) Interactionwith GLIS2 and MUC1 promotes nuclear translocation Interactionwith EMD inhibits nuclear localization The majority of beta-catenin is localized to the cell membrane In interphase,colocalizes with CROCC between CEP250 puncta at the proximal endof centrioles, and this localization is dependent on CROCC andCEP250 In mitosis, when NEK2 activity increases, it localizes tocentrosomes at spindle poles independent of CROCC Colocalizeswith CDK5 in the cell-cell contacts and plasma membrane ofundifferentiated and differentiated neuroblastoma cellsInteraction with FAM53B promotes translocation to the nucleus(PubMed:25183871)
Function (UniProt annotation)
Key downstream component of the canonical Wnt signalingpathway In the absence of Wnt, forms a complex with AXIN1, AXIN2,APC, CSNK1A1 and GSK3B that promotes phosphorylation on N-terminalSer and Thr residues and ubiquitination of CTNNB1 via BTRC and itssubsequent degradation by the proteasome In the presence of Wntligand, CTNNB1 is not ubiquitinated and accumulates in thenucleus, where it acts as a coactivator for transcription factorsof the TCF/LEF family, leading to activate Wnt responsive genesInvolved in the regulation of cell adhesion, as component of an E-cadherin:catenin adhesion complex Acts as a negative regulator ofcentrosome cohesion Involved in the CDK2/PTPN6/CTNNB1/CEACAM1pathway of insulin internalization Blocks anoikis of malignantkidney and intestinal epithelial cells and promotes theiranchorage-independent growth by down-regulating DAPK2 DisruptsPML function and PML-NB formation by inhibiting RANBP2-mediatedsumoylation of PML (PubMed:17524503, PubMed:18077326,PubMed:18086858, PubMed:18957423, PubMed:21262353,PubMed:22647378, PubMed:22699938, PubMed:22155184) Promotesneurogenesis by maintaining sympathetic neuroblasts within thecell cycle (By similarity)
Catalytic Activity (UniProt annotation)
N/A
Protein Sequence
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVA DIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLL NDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGG PQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEG LLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQF VEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPL TELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL

Motif information from Eukaryotic Linear Motif atlas (ELM)

(show / hide)

Gene Ontology (P: Process; F: Function and C: Component terms)

(show / hide)

GO:0000922	C:spindle pole
GO:0001085	F:RNA polymerase II transcription factor binding
GO:0001102	F:RNA polymerase II activating transcription factor binding
GO:0001569	P:branching involved in blood vessel morphogenesis
GO:0001837	P:epithelial to mesenchymal transition
GO:0002052	P:positive regulation of neuroblast proliferation
GO:0003682	F:chromatin binding
GO:0003713	F:transcription coactivator activity
GO:0005622	C:intracellular
GO:0005634	C:nucleus
GO:0005654	C:nucleoplasm
GO:0005667	C:transcription factor complex
GO:0005719	C:nuclear euchromatin
GO:0005737	C:cytoplasm
GO:0005813	C:centrosome
GO:0005829	C:cytosol
GO:0005886	C:plasma membrane
GO:0005911	C:cell-cell junction
GO:0005912	C:adherens junction
GO:0005913	C:cell-cell adherens junction
GO:0005925	C:focal adhesion
GO:0005938	C:cell cortex
GO:0006351	P:transcription
GO:0007155	DNA-templated
GO:0007223	P:cell adhesion
GO:0008022	P:Wnt signaling pathway
GO:0008134	calcium modulating pathway
GO:0008285	F:protein C-terminus binding
GO:0010718	F:transcription factor binding
GO:0010909	P:negative regulation of cell proliferation
GO:0016020	P:positive regulation of epithelial to mesenchymal transition
GO:0016032	P:positive regulation of heparan sulfate proteoglycan biosynthetic process
GO:0016055	C:membrane
GO:0016323	P:viral process
GO:0016328	P:Wnt signaling pathway
GO:0016342	C:basolateral plasma membrane
GO:0016525	C:lateral plasma membrane
GO:0019827	C:catenin complex
GO:0019899	P:negative regulation of angiogenesis
GO:0019900	P:stem cell population maintenance
GO:0019903	F:enzyme binding
GO:0030054	F:kinase binding
GO:0030331	F:protein phosphatase binding
GO:0030521	C:cell junction
GO:0030877	F:estrogen receptor binding
GO:0030997	P:androgen receptor signaling pathway
GO:0032355	C:beta-catenin destruction complex
GO:0032481	P:regulation of centriole-centriole cohesion
GO:0032991	P:response to estradiol
GO:0032993	P:positive regulation of type I interferon production
GO:0033234	C:protein-containing complex
GO:0034333	C:protein-DNA complex
GO:0034394	P:negative regulation of protein sumoylation
GO:0035257	P:adherens junction assembly
GO:0035315	P:protein localization to cell surface
GO:0035635	F:nuclear hormone receptor binding
GO:0036023	P:hair cell differentiation
GO:0042493	P:entry of bacterium into host cell
GO:0042995	P:embryonic skeletal limb joint morphogenesis
GO:0043065	P:response to drug
GO:0043066	C:cell projection
GO:0043525	P:positive regulation of apoptotic process
GO:0044325	P:negative regulation of apoptotic process
GO:0044334	P:positive regulation of neuron apoptotic process
GO:0044336	F:ion channel binding
GO:0045202	P:canonical Wnt signaling pathway involved in positive regulation of epithelial to mesenchymal transition
GO:0045294	P:canonical Wnt signaling pathway involved in negative regulation of apoptotic process
GO:0045296	C:synapse
GO:0045765	F:alpha-catenin binding
GO:0045892	F:cadherin binding
GO:0045893	P:regulation of angiogenesis
GO:0045944	P:negative regulation of transcription
GO:0045976	DNA-templated
GO:0046332	P:positive regulation of transcription
GO:0048145	DNA-templated
GO:0048471	P:positive regulation of transcription by RNA polymerase II
GO:0048660	P:negative regulation of mitotic cell cycle
GO:0050681	embryonic
GO:0050767	F:SMAD binding
GO:0051091	P:regulation of fibroblast proliferation
GO:0051149	C:perinuclear region of cytoplasm
GO:0051571	P:regulation of smooth muscle cell proliferation
GO:0060070	F:androgen receptor binding
GO:0060828	P:regulation of neurogenesis
GO:0061154	P:positive regulation of DNA-binding transcription factor activity
GO:0061324	P:positive regulation of muscle cell differentiation
GO:0061549	P:positive regulation of histone H3-K4 methylation
GO:0070062	P:canonical Wnt signaling pathway
GO:0070369	P:regulation of canonical Wnt signaling pathway
GO:0070411	P:endothelial tube morphogenesis
GO:0070602	P:canonical Wnt signaling pathway involved in positive regulation of cardiac outflow tract cell proliferation
GO:0071363	P:sympathetic ganglion development
GO:0071681	C:extracellular exosome
GO:0071944	C:beta-catenin-TCF7L2 complex
GO:0072182	F:I-SMAD binding
GO:0090279	P:regulation of centromeric sister chromatid cohesion
GO:0098609	P:cellular response to growth factor stimulus
GO:1904798	P:cellular response to indole-3-methanol
GO:1904837	C:cell periphery
GO:1904886	P:regulation of nephron tubule epithelial cell differentiation
GO:1904948	P:regulation of calcium ion import
GO:1904954	P:cell-cell adhesion
GO:1990138	P:positive regulation of core promoter binding
GO:1990907	P:beta-catenin-TCF complex assembly
GO:1990909	P:beta-catenin destruction complex disassembly
GO:2000008	P:midbrain dopaminergic neuron differentiation
GO:2000144	P:canonical Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation

KEGG Pathway
Reactome Pathway

Pathway ID	Pathway Name	Pathway Description (KEGG)
hsa04015	Rap1 signaling pathway	Rap1 is a small GTPase that controls diverse processes, such as cell adhesion, cell-cell junction formation and cell polarity. Like all G proteins, Rap1 cycles between an inactive GDP-bound and an active GTP-bound conformation. A variety of extracellular signals control this cycle through the regulation of several unique guanine nucleotide exchange factors (GEFs) and GTPase activating proteins (GAPs). Rap1 plays a dominant role in the control of cell-cell and cell-matrix interactions by regulating the function of integrins and other adhesion molecules in various cell types. Rap1 also regulates MAP kinase (MAPK) activity in a manner highly dependent on the context of cell types.
hsa04310	Wnt signaling pathway	Wnt proteins are secreted morphogens that are required for basic developmental processes, such as cell-fate specification, progenitor-cell proliferation and the control of asymmetric cell division, in many different species and organs. There are at least three different Wnt pathways: the canonical pathway, the planar cell polarity (PCP) pathway and the Wnt/Ca2+ pathway. In the canonical Wnt pathway, the major effect of Wnt ligand binding to its receptor is the stabilization of cytoplasmic beta-catenin through inhibition of the bea-catenin degradation complex. Beta-catenin is then free to enter the nucleus and activate Wnt-regulated genes through its interaction with TCF (T-cell factor) family transcription factors and concomitant recruitment of coactivators. Planar cell polarity (PCP) signaling leads to the activation of the small GTPases RHOA (RAS homologue gene-family member A) and RAC1, which activate the stress kinase JNK (Jun N-terminal kinase) and ROCK (RHO-associated coiled-coil-containing protein kinase 1) and leads to remodelling of the cytoskeleton and changes in cell adhesion and motility. WNT-Ca2+ signalling is mediated through G proteins and phospholipases and leads to transient increases in cytoplasmic free calcium that subsequently activate the kinase PKC (protein kinase C) and CAMKII (calcium calmodulin mediated kinase II) and the phosphatase calcineurin.
hsa04390	Hippo signaling pathway	Hippo signaling is an evolutionarily conserved signaling pathway that controls organ size from flies to humans. In humans and mice, the pathway consists of the MST1 and MST2 kinases, their cofactor Salvador and LATS1 and LATS2. In response to high cell densities, activated LATS1/2 phosphorylates the transcriptional coactivators YAP and TAZ, promoting its cytoplasmic localization, leading to cell apoptosis and restricting organ size overgrowth. When the Hippo pathway is inactivated at low cell density, YAP/TAZ translocates into the nucleus to bind to the transcription enhancer factor (TEAD/TEF) family of transcriptional factors to promote cell growth and proliferation. YAP/TAZ also interacts with other transcriptional factors or signaling molecules, by which Hippo pathway-mediated processes are interconnected with those of other key signaling cascades, such as those mediated by TGF-beta and Wnt growth factors.
hsa04510	Focal adhesion	Cell-matrix adhesions play essential roles in important biological processes including cell motility, cell proliferation, cell differentiation, regulation of gene expression and cell survival. At the cell-extracellular matrix contact points, specialized structures are formed and termed focal adhesions, where bundles of actin filaments are anchored to transmembrane receptors of the integrin family through a multi-molecular complex of junctional plaque proteins. Some of the constituents of focal adhesions participate in the structural link between membrane receptors and the actin cytoskeleton, while others are signalling molecules, including different protein kinases and phosphatases, their substrates, and various adapter proteins. Integrin signaling is dependent upon the non-receptor tyrosine kinase activities of the FAK and src proteins as well as the adaptor protein functions of FAK, src and Shc to initiate downstream signaling events. These signalling events culminate in reorganization of the actin cytoskeleton; a prerequisite for changes in cell shape and motility, and gene expression. Similar morphological alterations and modulation of gene expression are initiated by the binding of growth factors to their respective receptors, emphasizing the considerable crosstalk between adhesion- and growth factor-mediated signalling.
hsa04520	Adherens junction	Cell-cell adherens junctions (AJs), the most common type of intercellular adhesions, are important for maintaining tissue architecture and cell polarity and can limit cell movement and proliferation. At AJs, E-cadherin serves as an essential cell adhesion molecules (CAMs). The cytoplasmic tail binds beta-catenin, which in turn binds alpha-catenin. Alpha-catenin is associated with F-actin bundles directly and indirectly. The integrity of the cadherin-catenin complex is negatively regulated by phosphorylation of beta-catenin by receptor tyrosine kinases (RTKs) and cytoplasmic tyrosine kinases (Fer, Fyn, Yes, and Src), which leads to dissociation of the cadherin-catenin complex. Integrity of this complex is positively regulated by beta -catenin phosphorylation by casein kinase II, and dephosphorylation by protein tyrosine phosphatases. Changes in the phosphorylation state of beta-catenin affect cell-cell adhesion, cell migration and the level of signaling beta-catenin. Wnt signaling acts as a positive regulator of beta-catenin by inhibiting beta-catenin degradation, which stabilizes beta-catenin, and causes its accumulation. Cadherin may acts as a negative regulator of signaling beta-catenin as it binds beta-catenin at the cell surface and thereby sequesters it from the nucleus. Nectins also function as CAMs at AJs, but are more highly concentrated at AJs than E-cadherin. Nectins transduce signals through Cdc42 and Rac, which reorganize the actin cytoskeleton, regulate the formation of AJs, and strengthen cell-cell adhesion.
hsa04550	Signaling pathways regulating pluripotency of stem cells	Pluripotent stem cells (PSCs) are basic cells with an indefinite self-renewal capacity and the potential to generate all the cell types of the three germinal layers. The types of PSCs known to date include embryonic stem (ES) and induced pluripotent stem (iPS) cells. ES cells are derived from the inner cell mass (ICM) of blastocyst-stage embryos. iPS cells are generated by reprogramming somatic cells back to pluripotent state with defined reprogramming factors, Oct4, Sox2, Klf4 and c-Myc (also known as Yamanaka factors). PSCs including ES cells and iPS cells are categorized into two groups by their morphology, gene expression profile and external signal dependence. Conventional mouse-type ES/iPS cells are called 'naive state' cells. They are mainly maintained under the control of LIF and BMP signaling. On the other hand, human-type ES/iPS cells, which are in need of Activin and FGF signaling, are termed 'primed state'. However, these signaling pathways converge towards the activation of a core transcriptional network that is similar in both groups and involves OCt4, Nanog and Sox2. The three transcription factors and their downstream target genes coordinately promote self-renewal and pluripotency.
hsa04670	Leukocyte transendothelial migration	Leukocyte migaration from the blood into tissues is vital for immune surveillance and inflammation. During this diapedesis of leukocytes, the leukocytes bind to endothelial cell adhesion molecules (CAM) and then migrate across the vascular endothelium. A leukocyte adherent to CAMs on the endothelial cells moves forward by leading-edge protrusion and retraction of its tail. In this process, alphaL /beta2 integrin activates through Vav1, RhoA, which subsequently activates the kinase p160ROCK. ROCK activation leads to MLC phosphorylation, resulting in retraction of the actin cytoskeleton. Moreover, Leukocytes activate endothelial cell signals that stimulate endothelial cell retraction during localized dissociation of the endothelial cell junctions. ICAM-1-mediated signals activate an endothelial cell calcium flux and PKC, which are required for ICAM-1 dependent leukocyte migration. VCAM-1 is involved in the opening of the endothelial passagethrough which leukocytes can extravasate. In this regard, VCAM-1 ligation induces NADPH oxidase activation and the production of reactive oxygen species (ROS) in a Rac-mediated manner, with subsequent activation of matrix metallopoteinases and loss of VE-cadherin-mediated adhesion.
hsa04916	Melanogenesis	Cutaneous melanin pigment plays a critical role in camouflage, mimicry, social communication, and protection against harmful effects of solar radiation. Melanogenesis is under complex regulatory control by multiple agents. The most important positive regulator of melanogenesis is the MC1 receptor with its ligands melanocortic peptides. MC1R activates the cyclic AMP (cAMP) response-element binding protein (CREB). Increased expression of MITF and its activation by phosphorylation (P) stimulate the transcription of tyrosinase (TYR), tyrosinase-related protein 1 (TYRP1), and dopachrome tautomerase (DCT), which produce melanin. Melanin synthesis takes place within specialized intracellular organelles named melanosomes. Melanin-containing melanosomes then move from the perinuclear region to the dendrite tips and are transferred to keratinocytes by a still not well-characterized mechanism.
hsa04919	Thyroid hormone signaling pathway	The thyroid hormones (THs) are important regulators of growth, development and metabolism. The action of TH is mainly mediated by T3 (3,5,3'-triiodo-L-thyronine). Thyroid hormones, L-thyroxine (T4) and T3 enter the cell through transporter proteins. Although the major form of TH in the blood is T4, it is converted to the more active hormone T3 within cells. T3 binds to nuclear thyroid hormone receptors (TRs), which functions as a ligand-dependent transcription factor and controls the expression of target genes (genomic action). Nongenomic mechanisms of action is initiated at the integrin receptor. The plasma membrane alpha(v)beta(3)-integrin has distinct binding sites for T3 and T4. One binding site binds only T3 and activates the phosphatidylinositol 3-kinase (PI3K) pathway. The other binding site binds both T3 and T4 and activates the ERK1/2 MAP kinase pathway.
hsa04934	Cushing syndrome	Cushing syndrome (CS) is a rare disorder resulting from prolonged exposure to excess glucocorticoids via exogenous and endogenous sources. The typical clinical features of CS are related to hypercortisolism and include accumulation of central fat, moon facies, neuromuscular weakness, osteoporosis or bone fractures, metabolic complications, and mood changes. Traditionally, endogenous CS is classified as adrenocorticotropic hormone (ACTH)-dependent (about 80%) or ACTH- independent (about 20%). Among ACTH-dependent forms, pituitary corticotroph adenoma (Cushing's disease) is most common. Most pituitary tumors are sporadic, resulting from monoclonal expansion of a single mutated cell. Recently recurrent activating somatic driver mutations in the ubiquitin-specific protease 8 gene (USP8) were identified in almost half of corticotroph adenoma. Germline mutations in MEN1 (encoding menin), AIP (encoding aryl-hydrocarbon receptor-interacting protein), PRKAR1A (encoding cAMP-dependent protein kinase type I alpha regulatory subunit) and CDKN1B (encoding cyclin-dependent kinase inhibitor 1B; also known as p27 Kip1) have been identified in familial forms of pituitary adenomas. However, the frequency of familial pituitary adenomas is less than 5% in patients with pituitary adenomas. Among ACTH-independent CS, adrenal adenoma is most common. Rare adrenal causes of CS include primary bilateral macronodular adrenal hyperplasia (BMAH) or primary pigmented nodular adrenocortical disease (PPNAD).
hsa05100	Bacterial invasion of epithelial cells	Many pathogenic bacteria can invade phagocytic and non-phagocytic cells and colonize them intracellularly, then become disseminated to other cells. Invasive bacteria induce their own uptake by non-phagocytic host cells (e.g. epithelial cells) using two mechanisms referred to as zipper model and trigger model. Listeria, Staphylococcus, Streptococcus, and Yersinia are examples of bacteria that enter using the zipper model. These bacteria express proteins on their surfaces that interact with cellular receptors, initiating signalling cascades that result in close apposition of the cellular membrane around the entering bacteria. Shigella and Salmonella are the examples of bacteria entering cells using the trigger model. These bacteria use type III secretion systems to inject protein effectors that interact with the actin cytoskeleton.
hsa05130	Pathogenic Escherichia coli infection	Enteropathogenic E. coli (EPEC) and enterohemorrhagic E. coli (EHEC) are closely related pathogenic strains of Escherichia coli. The hallmark of EPEC/EHEC infections [DS:H00278 H00277] is induction of attaching and effacing (A/E) lesions that damage intestinal epithelial cells. The capacity to form A/E lesions is encoded mainly by the locus of enterocyte effacement (LEE) pathogenicity island. Tir, Map, EspF, EspG are known LEE-encoded effector proteins secreted via the type III secretion system, which is also LEE-encoded, into the host cell. EPEC and EHEC Tir's link the extracellular bacterium to the cell cytoskeleton. Map and EspF are involved in mitochondrion membrane permeabilization. EspG interacts with tubulins and stimulates microtubule destabilization. LEE-encoded adhesin or intimin (Eae) is exported via the general secretory pathway to the periplasm, where it is inserted into the outer membrane. In addition to Tir, two potential host cell-carried intimin receptors, beta1 integrin (ITGB1) and nucleolin (NCL), have so far been identified. The distinguishing feature of EHEC is the elaboration of Shiga-like toxin (Stx). Stx cleaves ribosomal RNA, thereby disrupting protein synthesis and killing the intoxicated epithelial or endothelial cells.
hsa05163	Human cytomegalovirus infection	Human cytomegalovirus (HCMV) is an enveloped, double-stranded DNA virus that is a member of beta-herpesvirus family. HCMV is best known for causing significant morbidity and mortality in immunocompromised populations. As with other herpesviruses, HCMV gB and gH/gL envelope glycoproteins are essential for virus entry. HCMV gB could activate the PDGFRA, and induce activation of the oncogenic PI3-K/AKT pathway. Though it is unlikely that HCMV by itself can act as an oncogenic factor, HCMV may have an oncomodulatory role, to catalyze an oncogenic process that has already been initiated. US28, one of the four HCMV-encoded vGPCRs (US27, US28, UL33 and UL78), also has a specific role in the oncomodulatory properties. In addition, HCMV has developed numerous mechanisms for manipulating the host immune system. The virally encoded US2, US3, US6 and US11 gene products all interfere with major histocompatibility complex (MHC) class I antigen presentation. HCMV encodes several immediate early (IE) antiapoptotic proteins (IE1, IE2, vMIA and vICA). These proteins might avoid immune clearance of infected tumor cells by cytotoxic lymphocytes and NK cells.
hsa05165	Human papillomavirus infection	Human papillomavirus (HPV) is a non-enveloped, double-stranded DNA virus. HPV infect mucoal and cutaneous epithelium resulting in several types of pathologies, most notably, cervical cancer. All types of HPV share a common genomic structure and encode eight proteins: E1, E2, E4, E5, E6, and E7 (early) and L1 and L2 (late). It has been demonstrated that E1 and E2 are involved in viral transcription and replication. The functions of the E4 protein is not yet fully understood. E5, E6, and E7 act as oncoproteins. E5 inhibits the V-ATPase, prolonging EGFR signaling and thereby promoting cell proliferation. The expression of E6 and E7 not only inhibits the tumor suppressors p53 and Rb, but also alters additional signalling pathways. Among these pathways, PI3K/Akt signalling cascade plays a very important role in HPV-induced carcinogenesis. The L1 and L2 proteins form icosahedral capsids for progeny virion generation.
hsa05166	Human T-cell leukemia virus 1 infection	Human T-cell leukemia virus type 1 (HTLV-1) is a pathogenic retrovirus that is associated with adult T-cell leukemia/lymphoma (ATL). It is also strongly implicated in non-neoplastic chronic inflammatory diseases such as HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP). Expression of Tax, a viral regulatory protein is critical to the pathogenesis. Tax is a transcriptional co-factor that interfere several signaling pathways related to anti-apoptosis or cell proliferation. The modulation of the signaling by Tax involve its binding to transcription factors like CREB/ATF, NF-kappa B, SRF, and NFAT.
hsa05167	Kaposi sarcoma-associated herpesvirus infection	Kaposi sarcoma-associated herpesvirus (KSHV), also known as human herpesvirus 8 (HHV-8), is the most recently identified human tumor virus, and is associated with the pathogenesis of Kaposi's sarcoma (KS), primary effusion lymphoma (PEL), and Multicentric Castleman's disease (MCD). Like all other herpesviruses, KSHV displays two modes of life cycle, latency and lytic replication, which are characterized by the patterns of viral gene expression. Genes expressed in latency (LANA, v-cyclin, v-FLIP, Kaposins A, B and C and viral miRNAs) are mainly thought to facilitate the establishment of life long latency in its host and survival against the host innate, and adaptive immune surveillance mechanisms. Among the viral proteins shown to be expressed during lytic replication are potent signaling molecules such as vGPCR, vIL6, vIRFs, vCCLs, K1 and K15, which have been implicated experimentally in the angiogenic and inflammatory phenotype observed in KS lesions. Several of these latent viral and lytic proteins are known to transform host cells, linking KSHV with the development of severe human malignancies.
hsa05200	Pathways in cancer
hsa05205	Proteoglycans in cancer	Many proteoglycans (PGs) in the tumor microenvironment have been shown to be key macromolecules that contribute to biology of various types of cancer including proliferation, adhesion, angiogenesis and metastasis, affecting tumor progress. The four main types of proteoglycans include hyaluronan (HA), which does not occur as a PG but in free form, heparan sulfate proteoglycans (HSPGs), chondroitin sulfate proteoglycans (CSPGs), dematan sulfate proteoglycans (DSPG) and keratan sulfate proteoglycans (KSPGs) [BR:00535]. Among these proteoglycans such as HA, acting with CD44, promotes tumor cell growth and migration, whereas other proteoglycans such as syndecans (-1~-4), glypican (-1, -3) and perlecan may interact with growth factors, cytokines, morphogens and enzymes through HS chains [BR: 00536], also leading to tumor growth and invasion. In contrast, some of the small leucine-rich proteolgycans, such as decorin and lumican, can function as tumor repressors, and modulate the signaling pathways by the interaction of their core proteins and multiple receptors.
hsa05210	Colorectal cancer	Colorectal cancer (CRC) is the second largest cause of cancer-related deaths in Western countries. CRC arises from the colorectal epithelium as a result of the accumulation of genetic alterations in defined oncogenes and tumour suppressor genes (TSG). Two major mechanisms of genomic instability have been identified in sporadic CRC progression. The first, known as chromosomal instability (CIN), results from a series of genetic changes that involve the activation of oncogenes such as K-ras and inactivation of TSG such as p53, DCC/Smad4, and APC. The second, known as microsatellite instability (MSI), results from inactivation of the DNA mismatch repair genes MLH1 and/or MSH2 by hypermethylation of their promoter, and secondary mutation of genes with coding microsatellites, such as transforming growth factor receptor II (TGF-RII) and BAX. Hereditary syndromes have germline mutations in specific genes (mutation in the tumour suppressor gene APC on chromosome 5q in FAP, mutated DNA mismatch repair genes in HNPCC).
hsa05213	Endometrial cancer	Endometrial cancer (EC) is the most common gynaecological malignancy and the fourth most common malignancy in women in the developed world after breast, colorectal and lung cancer. Two types of endometrial carcinoma are distinguished with respect to biology and clinical course. Type-I carcinoma is related to hyperestrogenism by association with endometrial hyperplasia, frequent expression of estrogen and progesterone receptors and younger age, whereas type-II carcinoma is unrelated to estrogen, associated with atrophic endometrium, frequent lack of estrogen and progesterone receptors and older age. The morphologic differences in these cancers are mirrored in their molecular genetic profile with type I showing defects in DNA-mismatch repair and mutations in PTEN, K-ras, and beta-catenin, and type II showing aneuploidy, p53 mutations, and her2/neu amplification.
hsa05215	Prostate cancer	Prostate cancer constitutes a major health problem in Western countries. It is the most frequently diagnosed cancer among men and the second leading cause of male cancer deaths. The identification of key molecular alterations in prostate-cancer cells implicates carcinogen defenses (GSTP1), growth-factor-signaling pathways (NKX3.1, PTEN, and p27), and androgens (AR) as critical determinants of the phenotype of prostate-cancer cells. Glutathione S-transferases (GSTP1) are detoxifying enzymes. Cells of prostatic intraepithelial neoplasia, devoid of GSTP1, undergo genomic damage mediated by carcinogens. NKX3.1, PTEN, and p27 regulate the growth and survival of prostate cells in the normal prostate. Inadequate levels of PTEN and NKX3.1 lead to a reduction in p27 levels and to increased proliferation and decreased apoptosis. Androgen receptor (AR) is a transcription factor that is normally activated by its androgen ligand. During androgen withdrawal therapy, the AR signal transduction pathway also could be activated by amplification of the AR gene, by AR gene mutations, or by altered activity of AR coactivators. Through these mechanisms, tumor cells lead to the emergence of androgen-independent prostate cancer.
hsa05216	Thyroid cancer	Thyroid cancer is the most common endocrine malignancy and accounts for the majority of endocrine cancer- related deaths each year. More than 95% of thyroid carcinomas are derived from follicular cells. Their behavior varies from the indolent growing, well-differentiated papillary and follicular carcinomas (PTC and FTC, respectively) to the extremely aggressive undifferentiated carcinoma (UC). Somatic rearrangements of RET and TRK are almost exclusively found in PTC and may be found in early stages. The most distinctive molecular features of FTC are the prominence of aneuploidy and the high prevalence of RAS mutations and PAX8-PPAR{gamma} rearrangements. p53 seems to play a crucial role in the dedifferentiation process of thyroid carcinoma.
hsa05217	Basal cell carcinoma	Cancer of the skin is the most common cancer in Caucasians and basal cell carcinomas (BCC) account for 90% of all skin cancers. The vast majority of BCC cases are sporadic, though there is a rare familial syndrome basal cell nevus syndrome (BCNS, or Gorlin syndrome) that predisposes to development of BCC. In addition, there is strong epidemiological and genetic evidence that demonstrates UV exposure as a risk factor of prime importance. The development of basal cell carcinoma is associated with constitutive activation of sonic hedgehog signaling. The mutations in SMOH, PTCH1, and SHH in BCCs result in continuous activation of target genes. At a cellular level, sonic hedgehog signaling promotes cell proliferation. Mutations in TP53 are also found with high frequency (>50%) in sporadic BCC.
hsa05224	Breast cancer	Breast cancer is the leading cause of cancer death among women worldwide. The vast majority of breast cancers are carcinomas that originate from cells lining the milk-forming ducts of the mammary gland. The molecular subtypes of breast cancer, which are based on the presence or absence of hormone receptors (estrogen and progesterone subtypes) and human epidermal growth factor receptor-2 (HER2), include: hormone receptor positive and HER2 negative (luminal A subtype), hormone receptor positive and HER2 positive (luminal B subtype), hormone receptor negative and HER2 positive (HER2 positive), and hormone receptor negative and HER2 negative (basal-like or triple-negative breast cancers (TNBCs)). Hormone receptor positive breast cancers are largely driven by the estrogen/ER pathway. In HER2 positive breast tumours, HER2 activates the PI3K/AKT and the RAS/RAF/MAPK pathways, and stimulate cell growth, survival and differentiation. In patients suffering from TNBC, the deregulation of various signalling pathways (Notch and Wnt/beta-catenin), EGFR protein have been confirmed. In the case of breast cancer only 8% of all cancers are hereditary, a phenomenon linked to genetic changes in BRCA1 or BRCA2. Somatic mutations in only three genes (TP53, PIK3CA and GATA3) occurred at >10% incidence across all breast cancers.
hsa05225	Hepatocellular carcinoma	Hepatocellular carcinoma (HCC) is a major type of primary liver cancer and one of the rare human neoplasms etiologically linked to viral factors. It has been shown that, after HBV/HCV infection and alcohol or aflatoxin B1 exposure, genetic and epigenetic changes occur. The recurrent mutated genes were found to be highly enriched in multiple key driver signaling processes, including telomere maintenance, TP53, cell cycle regulation, the Wnt/beta-catenin pathway (CTNNB1 and AXIN1), the phosphatidylinositol-3 kinase (PI3K)/AKT/mammalian target of rapamycin (mTOR) pathway. Recent studies using whole-exome sequencing have revealed recurrent mutations in new driver genes involved in the chromatin remodelling (ARID1A and ARID2) and the oxidative stress (NFE2L2) pathways.
hsa05226	Gastric cancer	Gastric cancer (GC) is one of the world's most common cancers. According to Lauren's histological classification gastric cancer is divided into two distinct histological groups - the intestinal and diffuse types. Several genetic changes have been identified in intestinal-type GC. The intestinal metaplasia is characterized by mutations in p53 gene, reduced expression of retinoic acid receptor beta (RAR-beta) and hTERT expression. Gastric adenomas furthermore display mutations in the APC gene, reduced p27 expression and cyclin E amplification. In addition, amplification and overexpression of c-ErbB2, reduced TGF-beta receptor type I (TGFBRI) expression and complete loss of p27 expression are commonly observed in more advanced GC. The main molecular changes observed in diffuse-type GCs include loss of E-cadherin function by mutations in CDH1 and amplification of MET and FGFR2F.
hsa05412	Arrhythmogenic right ventricular cardiomyopathy (ARVC)	Arrhythmogenic right ventricular cardiomyopathy (ARVC) is an inherited heart muscle disease that may result in arrhythmia, heart failure, and sudden death. The hallmark pathological findings are progressive myocyte loss and fibrofatty replacement, with a predilection for the right ventricle. A number of genetic studies have identified mutations in various components of the cardiac desmosome that have important roles in the pathogenesis of ARVC. Disruption of desmosomal function by defective proteins might lead to death of myocytes under mechanical stress. The myocardial injury may be accompanied by inflammation. Since regeneration of cardiac myocytes is limited, repair by fibrofatty replacement occurs. Several studies have implicated that desmosome dysfunction results in the delocalization and nuclear translocation of plakoglobin. As a result, competition between plakoglobin and beta-catenin will lead to the inhibition of Wnt/beta-catenin signaling, resulting in a shift from a myocyte fate towards an adipocyte fate of cells. The ryanodine receptor plays a crucial part in electromechanical coupling by control of release of calcium from the sarcoplasmic reticulum into the cytosol. Therefore, defects in this receptor could result in an imbalance of calcium homeostasis that might trigger cell death.
hsa05418	Fluid shear stress and atherosclerosis	Shear stress represents the frictional force that the flow of blood exerts at the endothelial surface of the vessel wall and plays a central role in vascular biology and contributes to the progress of atherosclerosis. Sustained laminar flow with high shear stress upregulates expressions of endothelial cell (EC) genes and proteins that are protective against atherosclerosis. The key shear stress-induced transcription factors that govern the expression of these genes are Kruppel-like factor 2 (KLF2) and nuclear factor erythroid 2-like 2 (Nrf2). On the other hand, disturbed flow with associated reciprocating, low shear stress generally upregulates the EC genes and proteins that promote oxidative and inflammatory states in the artery wall, resulting in atherogenesis. Important transcriptional events that reflect this condition of ECs in disturbed flow include the activation of activator protein 1 (AP-1) and nuclear factor kappaB (NF-kappaB).

Pathway ID	Pathway Name	Pathway Description (KEGG)
R-HSA-195253	Degradation of beta-catenin by the destruction complex.	The beta-catenin destruction complex plays a key role in the canonical Wnt signaling pathway. In the absence of Wnt signaling, this complex controls the levels of cytoplamic beta-catenin. Beta-catenin associates with and is phosphorylated by the destruction complex. Phosphorylated beta-catenin is recognized and ubiquitinated by the SCF-beta TrCP ubiquitin ligase complex and is subsequently degraded by the proteasome (reviewed in Kimelman and Xu, 2006)
R-HSA-196299	Beta-catenin phosphorylation cascade.	Degradation of beta-catenin is initiated following amino-terminal serine/threonine phosphorylation. Phosphorylation of B-catenin at S45 by CK1 alpha primes the subsequent sequential GSK-3-mediated phosphorylation at Thr41, Ser37 and Ser33 (Amit et al., 2002 ; Lui et al., 2002)
R-HSA-201681	TCF dependent signaling in response to WNT.	19 WNT ligands and 10 FZD receptors have been identified in human cells; interactions amongst these ligands and receptors vary in a developmental and tissue-specific manner and lead to activation of so-called 'canonical' and 'non-canonical' WNT signaling. In the canonical WNT signaling pathway, binding of a WNT ligand to the Frizzled (FZD) and lipoprotein receptor-related protein (LRP) receptors results in the inactivation of the destruction complex, the stabilization and nuclear translocation of beta-catenin and subsequent activation of T-cell factor/lymphoid enhancing factor (TCF/LEF)-dependent transcription. Transcriptional activation in response to canonical WNT signaling controls processes such as cell fate, proliferation and self renewal of stem cells, as well as contributing to oncogenesis (reviewed in MacDonald et al, 2009; Saito-Diaz et al, 2013; Kim et al, 2013)
R-HSA-201722	Formation of the beta-catenin:TCF transactivating complex.	Once in the nucleus, beta-catenin is recruited to WNT target genes through interaction with TCF/LEF transcription factors. This family, which consists of TCF7 (also known as TCF1), TCF7L1 (also known as TCF3), TCF7L2 (also known as TCF4) and TCF7L3 (also known as LEF1), are HMG-containing transcription factors that bind to the WNT responsive elements in target gene promoters (reviewed in Brantjes et al, 2002). In the absence of WNT signal, TCF/LEF proteins recruit Groucho/TLE repressors to inhibit transcription; upon WNT stimulation, beta-catenin can displace Groucho/TLE from TCF/LEF proteins to initiate transcriptional activation (reviewed in Chen and Courey, 2000). Although this model for WNT-dependent activation of target genes is widely accepted, it is important to note that TCF/LEF proteins are not redundant and can contribute to WNT target gene expression in a number of different ways (reviewed in Brantjes et al, 2002; MacDonald et al, 2009). In particular, TCF7L1 (TCF3) is thought to have a more pronounced repressor function than other TCF/LEF family members. A couple of recent studies in Xenopus and mammalian cells show that WNT- and beta-catenin-dependent phosphorylation of TCF7L1(TCF3) promotes its dissociation from the promoter of target genes and allows gene expression through relief of this repression activity (Hikasa et al, 2010; Hikasa et al, 2011).The role of beta-catenin at WNT promoters hinges upon its ability to act as a scaffold for the recruitment of other proteins. The structure of beta-catenin consists of 12 imperfect ARM repeats (R1-12) flanked by an N-terminal and C-terminal extension (NTD and CTD respectively), with a conserved Helix C located between R12 and the CTD. Nuclear beta-catenin interacts with TCF/LEF at WNT target genes through ARM domains 3-9 (Graham et al, 2000; Poy et al, 2001; Xing et al, 2008). The N and the C terminal regions are important for the recruitment of transcriptional activator and repressors that contribute to WNT target gene expression (reviewed in Mosimann et al, 2009; Valenta et al, 2012). The N-terminal ARM domains 1-4 recruit the WNT-pathway specific activators BCL9:PYGO while the C-terminal region (R11-CTD) interacts with a wide range of general transcriptional activators that are involved in chromatin remodelling and transcription initiation. These include HATs such as P300, CBP and TIP60, histone methyltransferases such as MLL1 and 2, SWI/SNF factors BRG1 and ISWI and components of the PAF complex (reviewed in Mosimann et al, 2009; Valenta et al, 2012). Although many binding partners have been identified for the C-terminal region of beta-catenin, in many cases the timing and relationship of these interactions and indeed, the exact complex composition remains to be elucidated. Moreover, because many of the interacting partners appear to bind to overlapping regions of beta-catenin, it is unlikely that they all bind simultaneously. For simplicity, the interactions have been depicted as though they occur independently of one another; more accurately they are likely to cycle successively on and off beta-catenin to promote an active chromatin structure (reviewed in Willert and Jones, 2006; Valenta et al, 2012)
R-HSA-3134973	LRR FLII-interacting protein 1 (LRRFIP1) activates type I IFN production.	Leucine-rich repeat flightless-interacting protein 1 (LRRFIP1) can bind exogenous double-stranded RNA and double-stranded DNA (Wilson SA et al. 1998; Yang P et al. 2010). LRRFIP1 was shown to mediate Listeria monocytogenes- and vesicular stomatitis virus (VSV)-induced IFN-beta production in mouse primary macrophages by regulating beta-catenin activity. Beta-catenin possibly functions as a transcriptional cofactor of IRF3 to initiate Ifnb1 transcription (Yang P et al. 2010)
R-HSA-351906	Apoptotic cleavage of cell adhesion proteins.	Apoptotic cells show dramatic rearrangements of tight junctions, adherens junctions, and desmosomes (Abreu et al., 2000). Desmosome-specific members of the cadherin superfamily of cell adhesion molecules including desmoglein-3, plakophilin-1 and desmoplakin are cleaved by caspases after onset of apoptosis (Weiske et al., 2001). Cleavage results in the disruption of the desmosome structure and thus contributes to cell rounding and disintegration of the intermediate filament system (Weiske et al., 2001)
R-HSA-375170	CDO in myogenesis.	CDO/Cdon (cell-adhesion-molecule-related/downregulated by oncogenes) is a type I transmembrane multifunctional co-receptor consisting of five immunoglobulin and three fibronectin type III (FNIII) repeats in the extracellular domain, and an intracellular domain with no identifiable motifs. It has been implicated in enhancing muscle differentiation in promyogenic cells. CDO exert its promyogenic effects as a component of multiprotein complexes that include the closely related factor Boc, the Ig superfamily receptor neogenin and its ligand netrin-3, and the adhesion molecules N- and M-cadherin. CDO modulates the Cdc42 and p38 mitogen-activated protein kinase (MAPK) pathways via a direct association with two scaffold-type proteins, JLP and Bnip-2, to regulate activities of myogenic bHLH factors and myogenic differentiation. CDO activates myogenic bHLH factors via enhanced heterodimer formation, most likely by inducing hyper-phosphorylation of E proteins. Myogenic basic helix-loop-helix (bHLH) proteins are master regulatory proteins that activate the transcription of many muscle-specific genes during myogenesis. These myogenic bHLH proteins also referred to as MyoD family includes four members, MyoD, myogenin, myf5 and MRF4. These myogenic factors dimerize with E-proteins such as E12/E47, ITF-2 and HEB to form heterodimeric complexes that bind to a conserved DNA sequence known as the E box, which is present in the promoters and enhancers of most muscle-specific genes. Myocyte enhancer binding factor 2 (MEF2), which is a member of the MADS box family, also plays an important role in muscle differentiation. MEF2 activates transcription by binding to the consensus sequence, called the MEF2-binding site, which is also found in the control regions of numerous muscle-specific genes. MEF2 and myogenic bHLH proteins synergistically activate expression of muscle-specific genes via protein-protein interactions between DNA-binding domains of these heterologous classes of transcription factors. Members of the MyoD and MEF2 family of transcription factors associate combinatorially to control myoblast specification, differentiation and proliferation
R-HSA-3769402	Deactivation of the beta-catenin transactivating complex.	The mechanisms involved in downregulation of TCF-dependent transcription are not yet very well understood. beta-catenin is known to recruit a number of transcriptional repressors, including Reptin, SMRT and NCoR, to the TCF/LEF complex, allowing the transition from activation to repression (Bauer et al, 2000; Weiske et al, 2007; Song and Gelmann, 2008). CTNNBIP1 (also known as ICAT) and Chibby are inhibitors of TCF-dependent signaling that function by binding directly to beta-catenin and preventing interactions with critical components of the transactivation machinery (Takemaru et al, 2003; Li et al, 2008; Tago et al, 2000; Graham et al, 2002; Daniels and Weiss, 2002). Chibby additionally promotes the nuclear export of beta-catenin in conjunction with 14-3-3/YWHAZ proteins (Takemura et al, 2003; Li et al, 2008). A couple of recent studies have also suggested a role for nuclear APC in the disassembly of the beta-catenin activation complex (Hamada and Bienz, 2004; Sierra et al, 2006). It is worth noting that while some of the players involved in the disassembly of the beta-catenin transactivating complex are beginning to be worked out in vitro, the significance of their role in vivo is not yet fully understood, and some can be knocked out with little effect on endogenous WNT signaling (see for instance Voronina et al, 2009)
R-HSA-381771	Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1).	In L cells of the intestine the transcription factors TCF-4 (TCF7L2) and Beta-catenin form a heterodimer and bind the G2 enhancer of the Proglucagon gene GCG,activating its transcription to yield Proglucagon mRNA and, following translation, Proglucagon protein. The prohormone convertase PC1 present in the secretory granules of L cells cleaves Proglucagon at two sites to yield mostly Glucagon-like Peptide-1 (7-36) with a small amount of Glucagon-like Peptide-1 (7-37). Glucagon-like Peptide-1 (7-36 and 7-37) (GLP-1) is secreted into the bloodstream in response to glucose, fatty acids, insulin, leptin, gastrin-releasing peptide, cholinergic transmitters, beta-adrenergic transmitters, and peptidergic transmitters. The half-life of GLP-1 in the bloodstream is determined by Dipeptidyl Peptidase IV, which cleaves 2 amino acids at the amino terminus of GLP-1, rendering it biologically inactive
R-HSA-4086398	Ca2+ pathway.	A number of so called non-canonical WNT ligands have been shown to promote intracellular calcium release upon FZD binding. This beta-catenin-independent WNT pathway acts through heterotrimeric G proteins and promotes calcium release through phophoinositol signaling and activation of phosphodiesterase (PDE). Downstream effectors include the calcium/calmodulin-dependent kinase II (CaMK2) and PKC (reviewed in De, 2011). The WNT Ca2+ pathway is important in dorsoventral polarity, convergent extension and organ formation in vertebrates and also has roles in negatively regulating 'canonical' beta-catenin-dependent transcription. Non-canonical WNT Ca2+ signaling is also implicated in inflammatory response and cancer (reviewed in Kohn and Moon, 2005; Sugimura and Li, 2010)
R-HSA-418990	Adherens junctions interactions.	The adherens junctions (AJ) are multiprotein complexes that promote homotypic cell adhesion in nearly all types of tissue by linking membrane and cytoskeletal components at discrete contact regions (reviewed in Hartsock & Nelson 2008; Gumbiner 2005; Ebnet, 2008). The molecular constituents of adherens junctions form adhesive units which are organized into higher order junctional adhesions that create a zipper-like seal between adjacent cells. Junctional adhesions function in epithelial cell polarization and in the coupling of cytoskeletons in adjacent cells that allow coordinated movements. During embryonic development, AJs function in specifying adhesion between cells and contribute in the sorting of different cell types. AJs also regulate cell polarity and shape, promote cell-cell communication and help mediate contact inhibition of cell growth. This module covers transdimerization events involving AJ transmembrane proteins (cadherins and nectins) (Gumbiner 2005; Ebnet 2008; Hartsock & Nelson 2008)
R-HSA-4411364	Binding of TCF/LEF:CTNNB1 to target gene promoters.	The genes regulated by beta-catenin and TCF/LEF are involved in a diverse range of functions in cellular proliferation, differentiation, embryogenesis and tissue homeostasis, and include transcription factors, cell cycle regulators, growth factors, proteinases and inflammatory cytokines, among others (reviewed in Vlad et al, 2008). A number of WNT signaling components are themselves positively or negatively regulated targets of TCF/LEF-dependent transcription, establishing feedback loops to enhance or restrict signaling (see for instance, Khan et al 2007; Chamorro et al, 2005; Roose et al, 1999; Lustig et al, 2002). Other than a few of these general feedback targets (e.g. Axin2), most target genes are cell- and/or tissue-specific. A list of WNT/beta-catenin-dependent target genes is maintained at http://www.standford.edu/group/nusselab/cgi-bin/wnt/target_genes
R-HSA-4641262	Disassembly of the destruction complex and recruitment of AXIN to the membrane.	Upon stimulation with WNT ligand, AXIN and GSK3beta are recruited to the plasma membrane through interaction with DVL (Tamai et al, 2004; Mao et al, 2001; reviewed in He et al, 2004). Polymerization of membrane-associated DVL and GSK3beta- and CSNK1-mediated phosphorylation of LRP5/6 establish a feed-forward mechanism for enhanced membrane recruitment of AXIN upon WNT signaling (Tamai et al, 2004; Cong et al, 2004; Zeng et al, 2005; Bilic et al, 2007). In Xenopus oocytes, but not necessarily all sytems, AXIN is present in limiting concentrations and is considered rate limiting for the assembly of the destruction complex (Lee et al, 2003; Benchabane et al, 2008; Tan et al, 2012; reviewed in MacDonald et al, 2009). The recruitment of AXIN away from the destruction complex upon WNT stimulation effectively destabilizes the destruction complex and contributes to the accumulation of free beta-catenin (Kikuchi, 1999; Lee et al, 2003). AXIN association with the destruction complex is also regulated by phosphorylation. In the active destruction complex, AXIN is phosphorylated by GSK3beta; dephosphorylation by protein phosphatase 1 (PP1) or protein phosphatase 2A (PP2A) destabilizes the interaction of AXIN with the other components of the destruction complex and promotes its disassembly (Luo et al, 2007; Willert et al, 1999; Jho et al, 1999). Free AXIN is also subject to degradation by the 26S proteasome in a manner that depends on the poly-ADP-ribosylating enzymes tankyrase 1 and 2 (Huang et al, 2009)
R-HSA-5218920	VEGFR2 mediated vascular permeability.	The free radical nitric oxide (NO), produced by endothelial NO synthase (eNOS), is an important vasoactive substance in normal vascular biology and pathophysiology. It plays an important role in vascular functions such as vascular dilation and angiogenesis (Murohara et al. 1998, Ziche at al. 1997). NO has been reported to be a downstream mediator in the angiogenic response mediated by VEGF, but the mechanism by which NO promotes neovessel formation is not clear (Babaei & Stewart 2002). Persistent vasodilation and increase in vascular permeability in the existing vasculature is observed during the early steps of angiogenesis, suggesting that these hemodynamic changes are indispensable during an angiogenic processes. NO production by VEGF can occur either through the activation of PI3K or through a PLC-gamma dependent manner. Once activated both pathways converge on AKT phosphorylation of eNOS, releasing NO (Lin & Sessa 2006). VEGF also regulates vascular permeability by promoting VE-cadherin endocytosis at the cell surface through a VEGFR-2-Src-Vav2-Rac-PAK signalling axis
R-HSA-5339716	Misspliced GSK3beta mutants stabilize beta-catenin.	GSK3beta is subject to in-frame missplicing in CML stem cells resulting in the production of mutant protein that lacks the AXIN and FRAT binding domains. Cells containing this mutant GSK3beta show elevated levels of nuclear beta-catenin and enhanced TCF-dependent reporter activity (Jamieson et al, 2008; Abrahamsson et al, 2009)
R-HSA-5358747	S33 mutants of beta-catenin aren't phosphorylated.	S33 mutations of beta-catenin interfere with GSK3 phosphorylation and result in stabilization and nuclear localization of the protein and enhanced WNT signaling (Groen et al, 2008; Nhieu et al, 1999; Clements et al, 2002; reviewed in Polakis, 2000). S33 mutations have been identified in cancers of the central nervous system, liver, endometrium and stomach, among others (reviewed in Polakis, 2000)
R-HSA-5358749	S37 mutants of beta-catenin aren't phosphorylated.	S37 mutations of beta-catenin interfere with GSK3 phosphorylation and stabilize the protein, resulting in enhanced WNT pathway signaling (Nhieu et al, 1999; Clements et al, 2002; reviewed in Polakis, 2000). S37 mutations have been identified in cancers of the brain, liver, ovary and large intestine, among others (reviewed in Polakis, 2000)
R-HSA-5358751	S45 mutants of beta-catenin aren't phosphorylated.	S45 mutants of beta-catenin have been identified in colorectal and hepatocellular carcinomas, soft tissue cancer and Wilms Tumors, among others (reviewed in Polakis, 2000). These mutations abolish the CK1alpha phosphorylation site of beta-catenin which acts as a critical priming site for GSK3 phosphorylation of T41( and subsequently S37 and S33) thus preventing its ubiquitin-mediated degradation (Morin et al, 1997; Amit et al, 2002)
R-HSA-5358752	T41 mutants of beta-catenin aren't phosphorylated.	T41 mutations of beta-catenin interfere with GSK3 phosphorylation and result in stabilization and nuclear accumulation of the protein (Moreno-Bueno et al, 2002; Taniguchi et al, 2002; reviewed in Polakis, 2012). T41 mutations have been identified in cancers of the liver and brain, as well as in the pituitary, endometrium, large intestine and skin, among others (reviewed in Polakis, 2000; Saito-Diaz et al, 2013)
R-HSA-5626467	RHO GTPases activate IQGAPs.	IQGAPs constitute a family of scaffolding proteins characterized by a calponin homology (CH) domain, a polyproline binding region (WW domain), a tandem of four IQ (isoleucine and glutamine-rich) repeats and a RAS GTPase-activating protein-related domain (GRD). Three IQGAPs have been identified in human, IQGAP1, IQGAP2 and IQGAP3. The best characterized is IQGAP1 and over 90 proteins have been reported to bind to it. IQGAPs integrate multiple signaling pathways and coordinate a large variety of cellular activities (White et al. 2012). IQGAP proteins IQGAP1, IQGAP2 and IQGAP3, bind activated RHO GTPases RAC1 and CDC42 via their GRD and stabilize them in their GTP-bound state (Kuroda et al. 1996, Swart-Mataraza et al. 2002, Wang et al. 2007). IQGAPs bind F-actin filaments via the CH domain and modulate cell shape and motility through regulation of G-actin/F-actin equilibrium (Brill et al. 1996, Fukata et al. 1997, Bashour et al. 1997, Wang et al. 2007, Pelikan-Conchaudron et al. 2011). Binding of IQGAPs to F-actin is inhibited by calmodulin binding to the IQ repeats (Bashour et al. 1997, Pelikan-Conchaudron et al. 2011). Based on IQGAP1 studies, IQGAPs presumably function as homodimers (Bashour et al. 1997). IQGAP1 is involved in the regulation of adherens junctions through its interaction with E-cadherin (CDH1) and catenins (CTTNB1 and CTTNA1) (Kuroda et al. 1998, Hage et al. 2009). IQGAP1 contributes to cell polarity and lamellipodia formation through its interaction with microtubules (Fukata et al. 2002, Suzuki and Takahashi 2008)
R-HSA-8876493	InlA-mediated entry of Listeria monocytogenes into host cells.	The pathogenic bacteria Listeria monocytogenes can enter host cells through endocytosis triggered by binding of the bacterial cell wall protein internalin (InlA) to the E-cadherin (CDH1) complex at the host cell plasma membrane (Mengaud et al. 1996, Lecuit et al. 1999). Binding of InlA to CDH1, similar to CDH1 engagement during normal cell-to-cell adhesion, triggers activation of the SRC protein tyrosine kinase and phosphorylation of CDH1 and CDH1-bound beta-catenin (CTNNB1) (Fujita et al. 2002, McLachlan et al. 2007, Sousa et al. 2007, Bonazzi et al. 2008). Integrins likely contribute to CDH1-triggered SRC activation, and ERKs (MAPK1 and MAPK3), ROCKs and MLCK may also be involved (Avizienyte et al. 2002, Avizienyte et al. 2004, Martinez-Rico et al. 2010). FAK1 (PTK2), a SRC-regulated protein tyrosine kinase, may contribute to SRC-mediated regulation of CDH1 (Avizienyte et al. 2002).Phosphorylation of CDH1 and CTNNB1 by SRC creates docking sites for a CBL-like ubiquitin protein ligase Hakai (CBLL1). CBLL1 ubiquitinates SRC-phosphorylated CDH1 and CTNNB1 upon InlA binding, as well as in the context of CDH1-mediated cell-to-cell adhesion, thus triggering CDH1 endocytosis (Fujita et al. 2002, Bonazzi et al. 2008, Mukherjee et al. 2012).CBLL1 may also undergo SRC-mediated phosphorylation and subsequent autoubiquitination (Fujita et al. 2002).Both clathrin-mediated and caveolin-mediated endocytosis are implicated in the InlA-mediated entry of Listeria monocytogenes to host cells (Veiga et al. 2007). SRC-mediated phosphorylation of cortactin and the ARP2/3 complex involved in actin polymerization is implicated in CDH1 endocytosis and Listeria monocytogenes internalization (Sousa et al. 2007, Ren et al. 2009)
R-HSA-8951430	RUNX3 regulates WNT signaling.	RUNX3 binds to complexes of beta-catenin (CTNNB1) and TCF/LEF family members. Binding of RUNX3 to CTNNB1:TCF/LEF complexes prevents their loading onto cyclin D1 (CCND1) and MYC gene promoters and interferes with WNT signaling-mediated activation of CCND1 and MYC1 transcription. RUNX3 therefore inhibits WNT-induced cellular proliferation (Ito et al. 2008)

BioGRID
IntAct
MINT
ALL

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
ACP1	Co-localization	physical	12438242, (Europe PMC)	NA	BioGRID
ACTB	Affinity Capture-Western	physical	22720799, (Europe PMC)	NA	BioGRID
ACTN4	Co-localization	physical	25241761, (Europe PMC)	NA	BioGRID
AHR	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	19651607, 23174221, (Europe PMC)	0.40	BioGRID, IntAct
AJAP1	Affinity Capture-Western	physical	14595118, (Europe PMC)	NA	BioGRID
AKT1	Biochemical Activity	physical	15492215, 17287208, (Europe PMC)	NA	BioGRID
AMER1	Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation, pull down, tandem affinity purification	association, direct interaction, physical, physical association	17510365, 26496610, (Europe PMC)	0.71	BioGRID, IntAct
AMOT	Proximity Label-MS, proximity-dependent biotin identification	colocalization, physical	24255178, (Europe PMC)	0.35	BioGRID, IntAct
AP2M1	Affinity Capture-MS, tandem affinity purification	association, physical	24189400, (Europe PMC)	0.35	BioGRID, IntAct
APC	Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-localization, Far Western, Protein-peptide, Reconstituted Complex	physical	10545404, 11251183, 11533658, 11707392, 11712088, 11972058, 12628243, 15327769, 15355978, 15525529, 16510874, 19576224, 21664290, 23840886, 25241761, 26496610, 27902311, 29045831, 8259519, 9286858, (Europe PMC)	NA	BioGRID
APC2	Affinity Capture-Western, Reconstituted Complex, Two-hybrid	physical	10074433, 16510875, 23840886, 9823329, (Europe PMC)	NA	BioGRID
APP	Reconstituted Complex	physical	21832049, (Europe PMC)	NA	BioGRID
AR	Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, confocal microscopy, pull down, two hybrid	association, colocalization, direct interaction, physical, physical association	10987273, 11792709, 11916967, 12588987, 12799378, 12944908, 14593076, 15060161, 15256534, 21741601, 21885566, 22187462, (Europe PMC)	0.89	BioGRID, IntAct, MINT
ARMC8	Affinity Capture-Western	physical	18215130, (Europe PMC)	NA	BioGRID
ASH2L	Reconstituted Complex	physical	16510874, 16510875, (Europe PMC)	NA	BioGRID
ATF2	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	22304920, (Europe PMC)	0.35	BioGRID, IntAct
AURKA	Affinity Capture-MS	physical	26496610, (Europe PMC)	NA	BioGRID
AXIN1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	10228155, 12421363, 12805222, 16199882, 16890161, 17318191, 17510365, 18593713, 18632848, 19131971, 19166851, 20128690, 20531388, 21242974, 22509369, 22682247, 22773187, 23892894, 23959799, 24976009, 26496610, 27902311, 29045831, 9734785, (Europe PMC)	0.40, 0.94	BioGRID, IntAct, MINT
AXIN2	Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	10966653, 17510365, 22056988, (Europe PMC)	0.56	BioGRID, IntAct
BCL3	Affinity Capture-Western	physical	15829968, (Europe PMC)	NA	BioGRID
BCL6	Reconstituted Complex, pull down	physical, physical association	25402006, (Europe PMC)	0.40	BioGRID, IntAct
BCL9	Affinity Capture-Western, pull down, two hybrid	physical, physical association	11955446, 24360964, (Europe PMC)	0.51	BioGRID, IntAct
BCL9L	Affinity Capture-Western	physical	24360964, (Europe PMC)	NA	BioGRID
BOC	Affinity Capture-Western	physical	12634428, (Europe PMC)	NA	BioGRID
BRCA1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex	physical	20215423, 26831064, (Europe PMC)	NA	BioGRID
BTF3	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
BTRC	Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, PCA, Protein-peptide, Proximity Label-MS, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, enzymatic study, x-ray crystallography	association, physical, physical association, ubiquitination reaction	10023660, 10074433, 10228155, 12820959, 14516475, 14706645, 16376880, 16798748, 17053147, 18354482, 18650423, 18805092, 18851830, 19053519, 19061640, 19150432, 19956254, 19966869, 20531388, 20851351, 21466614, 21829575, 22017875, 22682247, 22730322, 22912335, 23514615, 24451375, 24464578, 24469040, 24501426, 24561623, 24912152, 25149538, 25515538, 25873176, 25900982, 26091241, 26506240, 27001857, 27316454, 28018973, 9990852, (Europe PMC)	0.93	BioGRID, IntAct, MINT
CA9	Affinity Capture-Western	physical	14567991, (Europe PMC)	NA	BioGRID
CACYBP	Affinity Capture-Western, Co-localization, proximity ligation assay	physical, physical association	11389839, 21466614, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
CALCOCO1	Phenotypic Enhancement	genetic	16931570, (Europe PMC)	NA	BioGRID
CARM1	Reconstituted Complex	physical	11983685, (Europe PMC)	NA	BioGRID
CASP3	Co-localization, proximity ligation assay	physical, physical association	25241761, (Europe PMC)	0.40	BioGRID, IntAct
CAV1	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	18356165, 19244345, (Europe PMC)	0.40	BioGRID, IntAct
CBL	Affinity Capture-Western, Biochemical Activity	physical	23744067, 25784557, (Europe PMC)	NA	BioGRID
CBY1	Affinity Capture-Western, Reconstituted Complex, pull down	direct interaction, physical	12712206, 18334222, 20096688, (Europe PMC)	0.44	BioGRID, IntAct
CCDC8	Affinity Capture-MS	physical	24711643, (Europe PMC)	NA	BioGRID
CCNA1	Affinity Capture-Western	physical	14985333, (Europe PMC)	NA	BioGRID
CCNA2	Affinity Capture-Western, Reconstituted Complex	physical	14985333, (Europe PMC)	NA	BioGRID
CCNE1	Affinity Capture-Western, Reconstituted Complex	physical	14985333, (Europe PMC)	NA	BioGRID
CDC27	Reconstituted Complex	physical	16510875, (Europe PMC)	NA	BioGRID
CDC73	Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid	association, physical, physical association	16630820, 21726809, (Europe PMC)	0.62	BioGRID, IntAct
CDH1	Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-localization, FRET, Proximity Label-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, proximity ligation assay, pull down, surface plasmon resonance	association, colocalization, physical, physical association	10381631, 10772923, 11113628, 11245482, 11254878, 11348595, 11401320, 11712088, 11960376, 12061792, 12169098, 12640114, 12830000, 15023525, 16125672, 16212417, 16574648, 16983094, 17220478, 17909039, 18593713, 18593907, 19016843, 22056988, 22158051, 22375065, 22715382, 22752307, 22850631, 23180380, 24424122, 24798214, 25344754, 25468996, 7542250, 7876318, 7954478, 8227214, 9233779, 9405455, 9535896, 9819408, (Europe PMC)	0.95	BioGRID, IntAct, MINT
CDH10	Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation	association, physical	10861224, 26496610, (Europe PMC)	0.35	BioGRID, IntAct
CDH11	Affinity Capture-Western	physical	10029089, (Europe PMC)	NA	BioGRID
CDH18	Affinity Capture-Western	physical	10207020, (Europe PMC)	NA	BioGRID
CDH2	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, tandem affinity purification	association, physical, physical association	11835406, 12077367, 12604612, 14625392, 17057644, 17098867, 17510365, 17679699, 18948590, 21357690, 25143387, (Europe PMC)	0.89	BioGRID, IntAct, MINT
CDH3	Affinity Capture-Western, Co-purification	physical	10381631, 10910767, 23180380, (Europe PMC)	NA	BioGRID
CDH5	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, competition binding, imaging technique, pull down	association, colocalization, direct interaction, physical, physical association	12003790, 17057644, 18287330, 18662404, 20123964, 20224040, 22720799, 23243000, 28514442, 9434630, (Europe PMC)	0.81	BioGRID, IntAct, MINT
CDH6	Affinity Capture-Western	physical	10207020, (Europe PMC)	NA	BioGRID
CDH7	Affinity Capture-Western	physical	10861224, (Europe PMC)	NA	BioGRID
CDH8	Affinity Capture-MS, Affinity Capture-Western	physical	28514442, 9521872, (Europe PMC)	NA	BioGRID
CDH9	Affinity Capture-Western	physical	10861224, (Europe PMC)	NA	BioGRID
CDK2	Affinity Capture-Western, Reconstituted Complex	physical	14985333, (Europe PMC)	NA	BioGRID
CDK5R1	Affinity Capture-Western, Reconstituted Complex	physical	11168528, (Europe PMC)	NA	BioGRID
CDK6	Co-localization, proximity ligation assay	physical, physical association	25241761, (Europe PMC)	0.40	BioGRID, IntAct
CDON	Affinity Capture-Western	physical	12634428, (Europe PMC)	NA	BioGRID
CEP128	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
CFAP298	Affinity Capture-MS	physical	26472760, (Europe PMC)	NA	BioGRID
CFTR	Affinity Capture-MS	physical	26618866, (Europe PMC)	NA	BioGRID
CHD8	Affinity Capture-Western, Reconstituted Complex	physical	18378692, 22083958, (Europe PMC)	NA	BioGRID
CHUK	Affinity Capture-Western, Biochemical Activity, Reconstituted Complex	physical	11527961, 12589056, (Europe PMC)	NA	BioGRID
CITED1	Affinity Capture-Western	physical	15843474, (Europe PMC)	NA	BioGRID
COPS3	Affinity Capture-Western	physical	19576224, (Europe PMC)	NA	BioGRID
COPS5	Affinity Capture-Western	physical	19576224, 24882689, (Europe PMC)	NA	BioGRID
COPS8	Affinity Capture-Western	physical	19576224, (Europe PMC)	NA	BioGRID
CREB1	Affinity Capture-Western	physical	17962194, (Europe PMC)	NA	BioGRID
CREBBP	Affinity Capture-Western, Phenotypic Enhancement, anti bait coimmunoprecipitation, two hybrid	genetic, physical, physical association	15782138, 16476742, 18347063, 21751375, 23273993, 26657156, 28648376, (Europe PMC)	0.57	BioGRID, IntAct
CRYAB	Affinity Capture-Western, Protein-peptide, anti bait coimmunoprecipitation, pull down	physical, physical association	17487982, 22158051, (Europe PMC)	0.52	BioGRID, IntAct
CTBP1	Affinity Capture-Western	physical	15525529, 24469828, (Europe PMC)	NA	BioGRID
CTNNA1	Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical, physical association	12640114, 15492215, 17072306, 17098867, 19941816, 24509793, 26344197, 26496610, 7706414, 7954478, 9512503, 9762469, (Europe PMC)	0.76	BioGRID, IntAct, MINT
CTNNA2	Co-fractionation, anti tag coimmunoprecipitation	physical, physical association	17679699, 26344197, (Europe PMC)	0.40	BioGRID, IntAct
CTNNA3	Affinity Capture-MS, Affinity Capture-Western, Co-localization	physical	11590244, 23718855, 25241761, 28514442, (Europe PMC)	NA	BioGRID
CTNNBIP1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, competition binding, pull down, tandem affinity purification, x-ray crystallography	association, direct interaction, physical, physical association	10898789, 12408824, 12408825, 15893313, 17072306, 17353931, 17510365, 18287330, 21885566, 26912724, 28514442, (Europe PMC)	0.92	BioGRID, IntAct, MINT
CTNND1	Affinity Capture-Western	physical	11712088, 9535896, (Europe PMC)	NA	BioGRID
CUL1	Affinity Capture-Western, enzymatic study	physical, ubiquitination reaction	10713156, 18805092, (Europe PMC)	0.44	BioGRID, IntAct
CUL3	Affinity Capture-MS	physical	21145461, (Europe PMC)	NA	BioGRID
CUL4A	Affinity Capture-Western	physical	17954973, (Europe PMC)	NA	BioGRID
DAZAP2	Affinity Capture-Western	physical	19304756, (Europe PMC)	NA	BioGRID
DDB1	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical	19651607, (Europe PMC)	0.35	BioGRID, IntAct
DDX1	Affinity Capture-MS	physical	16230076, (Europe PMC)	NA	BioGRID
DDX5	Affinity Capture-MS, Affinity Capture-Western	physical	16230076, (Europe PMC)	NA	BioGRID
DHX9	Affinity Capture-MS	physical	16230076, (Europe PMC)	NA	BioGRID
DKK1	Co-localization, proximity ligation assay	physical, physical association	25241761, (Europe PMC)	0.40	BioGRID, IntAct
DLG5	Affinity Capture-Western	physical	12657639, (Europe PMC)	NA	BioGRID
DLGAP1	Affinity Capture-Western	physical	9286858, (Europe PMC)	NA	BioGRID
DSC3	Affinity Capture-Western	physical	10769211, (Europe PMC)	NA	BioGRID
DVL1	Affinity Capture-Western, Co-localization, proximity ligation assay	physical, physical association	10806215, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
DVL2	Affinity Capture-Western	physical	10806215, (Europe PMC)	NA	BioGRID
DVL3	Affinity Capture-Western	physical	10806215, (Europe PMC)	NA	BioGRID
EGFR	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, tandem affinity purification	association, physical	11950845, 24189400, 9233779, 9535896, (Europe PMC)	0.35	BioGRID, IntAct
EGR1	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical, physical association	21743491, (Europe PMC)	0.50	BioGRID, IntAct
ELAVL1	Reconstituted Complex	physical	22544606, (Europe PMC)	NA	BioGRID
EMD	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, filter binding	physical, physical association	16858403, (Europe PMC)	0.59	BioGRID, IntAct, MINT
EP300	Affinity Capture-Luminescence, Affinity Capture-Western, Biochemical Activity, Phenotypic Enhancement, Reconstituted Complex	genetic, physical	11050151, 12408825, 12861022, 15060161, 15572674, 15806138, 16990252, 26657156, (Europe PMC)	NA	BioGRID
EP400	Affinity Capture-MS	physical	16510874, 16510875, (Europe PMC)	NA	BioGRID
EPAS1	Affinity Capture-MS	physical	23275444, (Europe PMC)	NA	BioGRID
ERBB2	Affinity Capture-Western, Co-localization, Far Western, Reconstituted Complex	physical	11245482, 11950845, 7702605, (Europe PMC)	NA	BioGRID
ERBIN	Protein-peptide	physical	15123239, (Europe PMC)	NA	BioGRID
ESR1	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	15304487, (Europe PMC)	0.40	BioGRID, IntAct
EZH2	Affinity Capture-Western, Reconstituted Complex	physical	17502350, 19661437, (Europe PMC)	NA	BioGRID
EZR	Affinity Capture-Western	physical	10462524, (Europe PMC)	NA	BioGRID
FAF1	Affinity Capture-Western	physical	21411632, 22730322, 26456834, (Europe PMC)	NA	BioGRID
FANCA	Affinity Capture-Western	physical	22653977, 24469828, (Europe PMC)	NA	BioGRID
FANCC	Affinity Capture-Western, Co-localization	physical	22653977, 24469828, (Europe PMC)	NA	BioGRID
FANCE	Affinity Capture-Western	physical	24469828, (Europe PMC)	NA	BioGRID
FANCF	Affinity Capture-Western	physical	24469828, (Europe PMC)	NA	BioGRID
FANCG	Affinity Capture-Western	physical	22653977, (Europe PMC)	NA	BioGRID
FAS	Co-localization, proximity ligation assay	physical, physical association	25241761, (Europe PMC)	0.40	BioGRID, IntAct
FBXO45	Affinity Capture-MS, Affinity Capture-Western	physical	25143387, (Europe PMC)	NA	BioGRID
FBXW11	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	10321728, 16085715, 17510365, 22017875, 22682247, 24500709, 25332235, 25515538, 25609649, 25900982, (Europe PMC)	0.72	BioGRID, IntAct, MINT
FBXW7	Affinity Capture-Western	physical	27485116, (Europe PMC)	NA	BioGRID
FER	Biochemical Activity	physical	12640114, (Europe PMC)	NA	BioGRID
FGFR1	Co-localization, anti bait coimmunoprecipitation, proximity ligation assay	physical, physical association	11401320, 25241761, (Europe PMC)	0.59	BioGRID, IntAct
FHIT	Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down	direct interaction, physical, physical association	18077326, (Europe PMC)	0.60	BioGRID, IntAct
FHL2	Affinity Capture-Western, Reconstituted Complex, Two-hybrid	physical	12466281, (Europe PMC)	NA	BioGRID
FOXB1	Affinity Capture-MS, tandem affinity purification	association, physical	25609649, (Europe PMC)	0.35	BioGRID, IntAct, MINT
FOXM1	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, chromatin immunoprecipitation assay, confocal microscopy, pull down	association, colocalization, direct interaction, physical, physical association	22014570, 26912724, (Europe PMC)	0.40, 0.67	BioGRID, IntAct
FOXO3	Affinity Capture-Western	physical	15905404, (Europe PMC)	NA	BioGRID
FOXO4	Affinity Capture-Western	physical	15905404, 20874444, (Europe PMC)	NA	BioGRID
FUS	Affinity Capture-MS, Affinity Capture-Western, Two-hybrid	physical	16230076, (Europe PMC)	NA	BioGRID
FYN	Biochemical Activity, Co-localization, proximity ligation assay	physical, physical association	12640114, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
GEMIN5	Affinity Capture-MS	physical	16230076, (Europe PMC)	NA	BioGRID
GLIS2	Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, pull down, two hybrid pooling approach	physical, physical association	17289029, (Europe PMC)	0.58	BioGRID, IntAct, MINT
GRIP1	Phenotypic Enhancement	genetic	16990252, (Europe PMC)	NA	BioGRID
GSK3A	Affinity Capture-MS, Biochemical Activity, tandem affinity purification	association, physical	17510365, 25897075, 26496610, (Europe PMC)	0.35	BioGRID, IntAct
GSK3B	Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-localization, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, protein kinase assay, proximity ligation assay, proximity-dependent biotin identification, tandem affinity purification	association, phosphorylation reaction, physical, physical association	10074433, 10228155, 10330181, 11251183, 11835406, 16039586, 17318191, 17510365, 19061640, 19107203, 19303846, 19576224, 21743491, 22699938, 23602568, 24451375, 25241761, 25897075, 26359353, 27902311, 29045831, 29568061, 8638126, (Europe PMC)	0.94	BioGRID, IntAct, MINT
HDAC1	Affinity Capture-Western, anti tag coimmunoprecipitation	physical, physical association	10958684, 16204248, 17412698, 19166851, (Europe PMC)	0.40	BioGRID, IntAct, MINT
HDAC4	Affinity Capture-Western	physical	16204248, (Europe PMC)	NA	BioGRID
HDAC6	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	18356165, (Europe PMC)	0.40	BioGRID, IntAct
HDAC7	Affinity Capture-MS, Affinity Capture-Western, Co-localization	physical	20224040, 21836063, (Europe PMC)	NA	BioGRID
HERC2	Affinity Capture-MS	physical	25476789, (Europe PMC)	NA	BioGRID
HERC5	Affinity Capture-Western	physical	20581239, 28744352, (Europe PMC)	NA	BioGRID
HIF1A	Affinity Capture-Western	physical	24650032, (Europe PMC)	NA	BioGRID
HINT1	Affinity Capture-Western, Two-hybrid	physical	16014379, 22647378, (Europe PMC)	NA	BioGRID
HIST1H1C	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex	physical	18258596, (Europe PMC)	NA	BioGRID
HNF4A	Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay	physical, physical association	12944908, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
HNRNPA1	Affinity Capture-MS, Affinity Capture-Western	physical	15492215, 16230076, (Europe PMC)	NA	BioGRID
HNRNPA2B1	Affinity Capture-MS, Affinity Capture-Western	physical	16230076, (Europe PMC)	NA	BioGRID
HNRNPK	Affinity Capture-Western	physical	16230076, (Europe PMC)	NA	BioGRID
HNRNPM	Affinity Capture-MS	physical	16230076, (Europe PMC)	NA	BioGRID
HSP90AB1	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
HSPA1B	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
HSPA8	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
HTT	Affinity Capture-Western, two hybrid	physical, physical association	17500595, 20531388, (Europe PMC)	0.37	BioGRID, IntAct
HUWE1	Affinity Capture-MS	physical	25147182, (Europe PMC)	NA	BioGRID
IFRD1	Affinity Capture-Western	physical	16204248, (Europe PMC)	NA	BioGRID
IKBKB	Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay	physical, physical association	11527961, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
ILK	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	25852190, (Europe PMC)	0.35	BioGRID, IntAct
IQGAP1	Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy	colocalization, physical, physical association	11734550, 22662192, (Europe PMC)	0.46	BioGRID, IntAct
ISG15	Affinity Capture-Western	physical	20581239, (Europe PMC)	NA	BioGRID
JADE1	Affinity Capture-Western, Biochemical Activity	physical	18806787, (Europe PMC)	NA	BioGRID
JUP	Affinity Capture-MS, Affinity Capture-Western, Co-localization, anti tag coimmunoprecipitation, proximity ligation assay, tandem affinity purification	association, physical, physical association	11712088, 17510365, 25241761, 26496610, 9535896, (Europe PMC)	0.67	BioGRID, IntAct
KAT2A	Affinity Capture-Western, Reconstituted Complex	physical	16510874, 20937768, (Europe PMC)	NA	BioGRID
KAT2B	Affinity Capture-Western, Biochemical Activity, Reconstituted Complex	physical	18987336, (Europe PMC)	NA	BioGRID
KCTD1	Affinity Capture-Western, Phenotypic Suppression, Reconstituted Complex	genetic, physical	24736394, (Europe PMC)	NA	BioGRID
KLF5	Affinity Capture-Western	physical	19435907, (Europe PMC)	NA	BioGRID
KMT2A	Affinity Capture-MS, Reconstituted Complex	physical	16510874, 16510875, (Europe PMC)	NA	BioGRID
KMT2D	Reconstituted Complex	physical	16510874, 16510875, (Europe PMC)	NA	BioGRID
LATS2	Affinity Capture-Western, Proximity Label-MS, Reconstituted Complex	physical	24255178, 24360964, (Europe PMC)	NA	BioGRID
LDHB	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
LEF1	Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, tandem affinity purification	association, direct interaction, physical, physical association	10890911, 10958684, 11751639, 11835406, 12077367, 12748295, 15525529, 15684397, 15728254, 15768032, 16204248, 16510874, 16510875, 17510365, 17517646, 18077326, 18296023, 20123964, 21743491, 8757136, 9419974, (Europe PMC)	0.86	BioGRID, IntAct
LEO1	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	16630820, (Europe PMC)	0.40	BioGRID, IntAct
LGALS9	Affinity Capture-MS	physical	17353931, (Europe PMC)	NA	BioGRID
LINC01194	Affinity Capture-Western	physical	14612521, (Europe PMC)	NA	BioGRID
LMNA	Affinity Capture-Western	physical	15355978, (Europe PMC)	NA	BioGRID
LMNB1	Affinity Capture-Western	physical	26912724, (Europe PMC)	NA	BioGRID
LRP6	Affinity Capture-Western, anti tag coimmunoprecipitation	physical, physical association	16890161, (Europe PMC)	0.40	BioGRID, IntAct
MAGI1	Affinity Capture-Western, Reconstituted Complex, Two-hybrid	physical	10772923, (Europe PMC)	NA	BioGRID
MAGI2	Affinity Capture-Western	physical	11526121, (Europe PMC)	NA	BioGRID
MAP3K2	Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex	physical	26884171, (Europe PMC)	NA	BioGRID
MAPK8	Affinity Capture-Western, Biochemical Activity	physical	19667122, (Europe PMC)	NA	BioGRID
MAPK9	Affinity Capture-Western, Biochemical Activity	physical	19667122, (Europe PMC)	NA	BioGRID
MAPRE1	Affinity Capture-MS	physical	26496610, (Europe PMC)	NA	BioGRID
MCM2	Affinity Capture-MS	physical	25963833, (Europe PMC)	NA	BioGRID
MEN1	Affinity Capture-Western, Reconstituted Complex	physical	16510874, 16510875, 19074834, (Europe PMC)	NA	BioGRID
MET	Affinity Capture-Western	physical	11254878, (Europe PMC)	NA	BioGRID
MOV10	Affinity Capture-RNA	physical	22658674, (Europe PMC)	NA	BioGRID
MSN	Co-fractionation	physical	26344197, (Europe PMC)	NA	BioGRID
MUC1	Affinity Capture-Western, Reconstituted Complex	physical	11152665, 11483589, 11877440, 12618757, 12750561, 9139698, 9819408, (Europe PMC)	NA	BioGRID
MYO7A	Affinity Capture-Western	physical	11080149, (Europe PMC)	NA	BioGRID
NDRG1	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical, physical association	17220478, (Europe PMC)	0.50	BioGRID, IntAct
NEK2	Affinity Capture-Western, Biochemical Activity, Reconstituted Complex	physical	24501426, (Europe PMC)	NA	BioGRID
NFKB1	Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, proximity ligation assay, pull down	direct interaction, physical, physical association	15829968, 19358846, 25241761, (Europe PMC)	0.67	BioGRID, IntAct, MINT
NLK	Affinity Capture-Western	physical	12556497, (Europe PMC)	NA	BioGRID
NONO	Affinity Capture-MS, Affinity Capture-Western	physical	16230076, (Europe PMC)	NA	BioGRID
NOTCH1	Affinity Capture-Western, Reconstituted Complex	physical	19000719, (Europe PMC)	NA	BioGRID
NR4A1	Affinity Capture-Western	physical	21986938, 26359353, (Europe PMC)	NA	BioGRID
NR5A1	Reconstituted Complex, Two-hybrid	physical	12554773, (Europe PMC)	NA	BioGRID
NSD2	Affinity Capture-Western	physical	22028615, (Europe PMC)	NA	BioGRID
NTRK1	Affinity Capture-MS	physical	25921289, (Europe PMC)	NA	BioGRID
NUDT5	Affinity Capture-MS, inference by socio-affinity scoring	physical, physical association	27173435, (Europe PMC)	0.27	BioGRID, IntAct
NUP153	Affinity Capture-Western	physical	22110128, (Europe PMC)	NA	BioGRID
NUP62	Affinity Capture-Western	physical	22110128, (Europe PMC)	NA	BioGRID
NUP98	Affinity Capture-Western	physical	22110128, (Europe PMC)	NA	BioGRID
NXF1	Affinity Capture-RNA	physical	22658674, (Europe PMC)	NA	BioGRID
OBSL1	Affinity Capture-MS	physical	24711643, (Europe PMC)	NA	BioGRID
PARD3	Co-localization	physical	25241761, (Europe PMC)	NA	BioGRID
PARP1	Affinity Capture-MS	physical	16230076, (Europe PMC)	NA	BioGRID
PECAM1	Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, proximity ligation assay	association, physical, physical association	10801826, 25241761, (Europe PMC)	0.56	BioGRID, IntAct
PHB2	Affinity Capture-MS	physical	17353931, (Europe PMC)	NA	BioGRID
PIK3R1	Co-localization, Reconstituted Complex, proximity ligation assay	physical, physical association	10477752, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
PIN1	Reconstituted Complex	physical	11533658, (Europe PMC)	NA	BioGRID
PITX2	Affinity Capture-Western, Co-localization, anti tag coimmunoprecipitation, proximity ligation assay	association, physical, physical association	12464179, 19174163, 25241761, (Europe PMC)	0.56	BioGRID, IntAct, MINT
PKD1	Affinity Capture-Western	physical	11113628, (Europe PMC)	NA	BioGRID
PKM	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down	physical, physical association	22056988, 27485204, (Europe PMC)	0.52	BioGRID, IntAct
PLK1	Affinity Capture-MS, Affinity Capture-Western	physical	21610149, (Europe PMC)	NA	BioGRID
PML	Affinity Capture-Western, Reconstituted Complex	physical	12384561, 22155184, (Europe PMC)	NA	BioGRID
POU5F1	Affinity Capture-Western	physical	23539445, (Europe PMC)	NA	BioGRID
PPARG	Affinity Capture-Western	physical	15665104, 19495794, 24735796, (Europe PMC)	NA	BioGRID
PRKCA	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	21949397, 21952047, (Europe PMC)	0.40	BioGRID, IntAct, MINT
PRKCG	Biochemical Activity	physical	25639486, (Europe PMC)	NA	BioGRID
PRKN	Affinity Capture-Western	physical	25877876, (Europe PMC)	NA	BioGRID
PROP1	Affinity Capture-Western, Reconstituted Complex	physical	16678101, (Europe PMC)	NA	BioGRID
PRPF6	Affinity Capture-MS	physical	16230076, (Europe PMC)	NA	BioGRID
PSEN1	Affinity Capture-Western, Reconstituted Complex	physical	10341227, 16126725, 16306047, 17360711, 9738936, 9852041, (Europe PMC)	NA	BioGRID
PTEN	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	20123964, 20372837, (Europe PMC)	0.40	BioGRID, IntAct
PTGS2	Affinity Capture-RNA, Protein-RNA	physical	22544606, (Europe PMC)	NA	BioGRID
PTN	Affinity Capture-Western	physical	10706604, (Europe PMC)	NA	BioGRID
PTPN1	Reconstituted Complex	physical	12377785, (Europe PMC)	NA	BioGRID
PTPN11	Affinity Capture-Western	physical	10681592, (Europe PMC)	NA	BioGRID
PTPN13	Biochemical Activity	physical	10951583, (Europe PMC)	NA	BioGRID
PTPN14	Affinity Capture-MS, Affinity Capture-Western	physical	12808048, (Europe PMC)	NA	BioGRID
PTPRF	Affinity Capture-Western, Reconstituted Complex	physical	11245482, 9245795, (Europe PMC)	NA	BioGRID
PTPRJ	Affinity Capture-Western, phosphatase assay, pull down	dephosphorylation reaction, physical, physical association	12370829, 19167335, (Europe PMC)	0.61	BioGRID, IntAct, MINT
PTPRK	Affinity Capture-Western, Reconstituted Complex	physical	8663237, (Europe PMC)	NA	BioGRID
PTPRU	Affinity Capture-Western	physical	12501215, 16574648, 9054423, (Europe PMC)	NA	BioGRID
PTPRZ1	Affinity Capture-Western	physical	10706604, (Europe PMC)	NA	BioGRID
PYGO2	Affinity Capture-Western	physical	24360964, (Europe PMC)	NA	BioGRID
RAB8B	Affinity Capture-Western	physical	12639940, (Europe PMC)	NA	BioGRID
RANBP2	Affinity Capture-Western	physical	22110128, (Europe PMC)	NA	BioGRID
RB1CC1	Affinity Capture-Western, Two-hybrid	physical	22751121, (Europe PMC)	NA	BioGRID
RBBP5	Affinity Capture-Western, Reconstituted Complex	physical	16510874, 16510875, 20937768, (Europe PMC)	NA	BioGRID
RBMX	Affinity Capture-MS	physical	16230076, (Europe PMC)	NA	BioGRID
RNF14	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical	23449499, (Europe PMC)	0.35	BioGRID, IntAct, MINT
RNF220	Affinity Capture-Western	physical	25266658, (Europe PMC)	NA	BioGRID
RNF4	Reconstituted Complex	physical	27653698, (Europe PMC)	NA	BioGRID
RPLP2	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
RPSA	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
RUVBL1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation	association, physical, physical association	16510874, 16510875, 18087039, 9843967, (Europe PMC)	0.50	BioGRID, IntAct
RUVBL2	Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex	physical	11080158, 15829968, 16699503, 20603076, (Europe PMC)	NA	BioGRID
RXRA	Affinity Capture-Western, Co-localization, proximity ligation assay	physical, physical association	12771132, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
RYK	Affinity Capture-MS	physical	21875946, (Europe PMC)	NA	BioGRID
SAPCD1	Affinity Capture-MS	physical	26186194, 28514442, (Europe PMC)	NA	BioGRID
SATB1	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid	direct interaction, physical, physical association	20126258, (Europe PMC)	0.66	BioGRID, IntAct
SERBP1	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
SFN	Affinity Capture-Western	physical	26147002, (Europe PMC)	NA	BioGRID
SIAH1	Affinity Capture-Western, Biochemical Activity	physical	20181957, 24882689, 27871173, (Europe PMC)	NA	BioGRID
SIRT1	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	20439735, (Europe PMC)	0.40	BioGRID, IntAct
SKP1	Affinity Capture-Western, Co-localization, Protein-peptide, enzymatic study, proximity ligation assay, x-ray crystallography	physical, physical association, ubiquitination reaction	11389839, 12820959, 18805092, 21466614, 25241761, 9990852, (Europe PMC)	0.71	BioGRID, IntAct
SLAMF7	Affinity Capture-MS	physical	28514442, (Europe PMC)	NA	BioGRID
SLC9A3R1	Affinity Capture-Western, Reconstituted Complex	physical	12830000, (Europe PMC)	NA	BioGRID
SLC9A3R2	Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification	association, physical, physical association	27173435, (Europe PMC)	0.51	BioGRID, IntAct
SMAD2	Affinity Capture-Western	physical	12000714, 20571128, (Europe PMC)	NA	BioGRID
SMAD3	Affinity Capture-Western	physical	12000714, 20571128, 21965288, 22241478, (Europe PMC)	NA	BioGRID
SMAD4	Affinity Capture-Western	physical	12000714, (Europe PMC)	NA	BioGRID
SMAD7	Affinity Capture-Western, Co-localization	physical	15684397, 18593713, (Europe PMC)	NA	BioGRID
SMARCA4	Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation	association, physical	11532957, 19571879, (Europe PMC)	0.35	BioGRID, IntAct
SMARCA5	Affinity Capture-MS, Reconstituted Complex	physical	16510874, 16510875, (Europe PMC)	NA	BioGRID
SMURF1	Affinity Capture-Western, Reconstituted Complex	physical	26015066, (Europe PMC)	NA	BioGRID
SNRPD1	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
SOX1	Affinity Capture-Western	physical	22767186, (Europe PMC)	NA	BioGRID
SOX2	Affinity Capture-MS, Affinity Capture-Western	physical	23539445, 23667531, (Europe PMC)	NA	BioGRID
SOX6	Affinity Capture-Western, Co-localization, Reconstituted Complex	physical	17412698, (Europe PMC)	NA	BioGRID
SP1	Affinity Capture-Western	physical	24798214, (Europe PMC)	NA	BioGRID
STRN3	Proximity Label-MS, proximity-dependent biotin identification	colocalization, physical	24255178, (Europe PMC)	0.35	BioGRID, IntAct
SUV39H1	Affinity Capture-Western	physical	21726809, (Europe PMC)	NA	BioGRID
TADA2A	Affinity Capture-Western	physical	18059173, (Europe PMC)	NA	BioGRID
TADA3	Affinity Capture-Western	physical	18059173, (Europe PMC)	NA	BioGRID
TAX1BP3	Co-crystal Structure	physical	18835279, (Europe PMC)	NA	BioGRID
TBL1X	Affinity Capture-Western, Co-localization, proximity ligation assay	physical, physical association	11389839, 18193033, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
TBL1XR1	Affinity Capture-Western	physical	18193033, (Europe PMC)	NA	BioGRID
TCF4	Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down	association, physical, physical association	11713476, 12657632, 12727872, 15060161, 15331612, 15525529, 15665104, 17072306, 17318191, 17412698, 17875931, 17909039, 17962194, 17983804, 18281465, 20126258, 21103407, 21743491, 22080605, 22699938, 23449499, 24532795, 24798214, 24876153, 25402006, 29361949, (Europe PMC)	0.94	BioGRID, IntAct, MINT
TCF7L1	Co-crystal Structure, Protein-peptide	physical	11136974, 15327769, (Europe PMC)	NA	BioGRID
TCF7L2	Affinity Capture-Western, Co-crystal Structure, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, x-ray crystallography	association, direct interaction, physical, physical association	11713475, 11713476, 16230076, 16442529, 16569639, 16630820, 16724116, 17050667, 17283121, 17914096, 18772112, 19202075, 19304756, 19443654, 19816403, 20126258, 21670201, 22014570, 22056988, 22155184, 22304967, 26350900, 27902311, (Europe PMC)	0.97	BioGRID, IntAct, MINT
TES	Affinity Capture-MS	physical	28378594, (Europe PMC)	NA	BioGRID
TFAP2A	Affinity Capture-Western	physical	15331612, (Europe PMC)	NA	BioGRID
TGFBR2	Affinity Capture-Western	physical	12000714, (Europe PMC)	NA	BioGRID
TLE1	Reconstituted Complex	physical	9751710, (Europe PMC)	NA	BioGRID
TOB1	Affinity Capture-Western	physical	16890162, (Europe PMC)	NA	BioGRID
TOP2A	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, fluorescence microscopy, two hybrid	association, colocalization, physical, physical association	16230076, 17983804, (Europe PMC)	0.57	BioGRID, IntAct
TRAF4	Affinity Capture-Western	physical	24990246, (Europe PMC)	NA	BioGRID
TRIM25	Affinity Capture-RNA	physical	29117863, (Europe PMC)	NA	BioGRID
TRIM33	Affinity Capture-Western, Biochemical Activity	physical	25639486, (Europe PMC)	NA	BioGRID
TRIM37	Affinity Capture-Western	physical	26395261, (Europe PMC)	NA	BioGRID
TRRAP	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex	physical	16510874, 16510875, 18347063, (Europe PMC)	NA	BioGRID
TUBA1A	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
UBE2B	Affinity Capture-Western, Biochemical Activity, Reconstituted Complex	physical	18339854, 22705350, (Europe PMC)	NA	BioGRID
UBE2D1	Reconstituted Complex	physical	18851830, (Europe PMC)	NA	BioGRID
UBE2R2	Biochemical Activity	physical	27044868, (Europe PMC)	NA	BioGRID
UBE3A	Affinity Capture-Western, Biochemical Activity	physical	27902311, (Europe PMC)	NA	BioGRID
UBR5	Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy	colocalization, physical, physical association	21118991, 28689657, (Europe PMC)	0.46	BioGRID, IntAct
UCHL1	Affinity Capture-Western	physical	19536331, (Europe PMC)	NA	BioGRID
UHRF2	Far Western, antibody array	physical, physical association	21952639, (Europe PMC)	0.40	BioGRID, IntAct
UNK	Affinity Capture-RNA	physical	25737280, (Europe PMC)	NA	BioGRID
USP15	Affinity Capture-Western	physical	26884171, (Europe PMC)	NA	BioGRID
USP4	Affinity Capture-Western	physical	26189775, (Europe PMC)	NA	BioGRID
USP7	Affinity Capture-Western, Biochemical Activity, Protein-peptide	physical	29045831, (Europe PMC)	NA	BioGRID
USP9X	Affinity Capture-Western, Co-fractionation, Reconstituted Complex	physical	10620020, 14742711, 27783990, (Europe PMC)	NA	BioGRID
VCL	Affinity Capture-Western	physical	22720799, 9405455, (Europe PMC)	NA	BioGRID
VEZT	Affinity Capture-Western	physical	11080149, (Europe PMC)	NA	BioGRID
WBP2	Affinity Capture-Western	physical	27578003, (Europe PMC)	NA	BioGRID
XPO1	Affinity Capture-MS	physical	26673895, (Europe PMC)	NA	BioGRID
YAP1	Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, inference by socio-affinity scoring, pull down	association, direct interaction, physical, physical association	21376238, 22234184, 23245941, 24976009, 27173435, (Europe PMC)	0.40, 0.88	BioGRID, IntAct, MINT
YWHAZ	Affinity Capture-MS, Affinity Capture-Western, coimmunoprecipitation	association, physical	15492215, 17287208, 22912335, (Europe PMC)	0.35	BioGRID, IntAct, MINT
ZBTB33	Affinity Capture-Western, Reconstituted Complex	physical	21670201, (Europe PMC)	NA	BioGRID
ZFYVE9	Two-hybrid, two hybrid	physical, physical association	15231748, (Europe PMC)	0.37	BioGRID, IntAct, MINT
ZIC3	Reconstituted Complex, pull down	physical, physical association	25402006, (Europe PMC)	0.40	BioGRID, IntAct
ZMIZ1	Affinity Capture-MS	physical	26522984, (Europe PMC)	NA	BioGRID

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
ACTN4	anti bait coimmunoprecipitation, confocal microscopy, proximity ligation assay, two hybrid	association, colocalization, physical association	16204054, 25241761, (Europe PMC)	0.70	IntAct
AHCTF1	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
AHR	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	19651607, 23174221, (Europe PMC)	0.40	BioGRID, IntAct
AKAP12	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
AMER1	Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation, pull down, tandem affinity purification	association, direct interaction, physical, physical association	17510365, 26496610, (Europe PMC)	0.71	BioGRID, IntAct
AMOT	Proximity Label-MS, proximity-dependent biotin identification	colocalization, physical	24255178, (Europe PMC)	0.35	BioGRID, IntAct
ANP32A	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
AP2M1	Affinity Capture-MS, tandem affinity purification	association, physical	24189400, (Europe PMC)	0.35	BioGRID, IntAct
AP3D1	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
APC	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity ligation assay, pull down, tandem affinity purification, x-ray crystallography	association, direct interaction, physical association	15327768, 15327769, 16212417, 17318191, 17510365, 22056988, 22682247, 25241761, 26496610, 8638126, 9707618, (Europe PMC)	0.95	IntAct, MINT
APPL1	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
AR	Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, confocal microscopy, pull down, two hybrid	association, colocalization, direct interaction, physical, physical association	10987273, 11792709, 11916967, 12588987, 12799378, 12944908, 14593076, 15060161, 15256534, 21741601, 21885566, 22187462, (Europe PMC)	0.89	BioGRID, IntAct, MINT
ARHGAP21	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
ARID4B	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
ATF2	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	22304920, (Europe PMC)	0.35	BioGRID, IntAct
AXIN1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	10228155, 12421363, 12805222, 16199882, 16890161, 17318191, 17510365, 18593713, 18632848, 19131971, 19166851, 20128690, 20531388, 21242974, 22509369, 22682247, 22773187, 23892894, 23959799, 24976009, 26496610, 27902311, 29045831, 9734785, (Europe PMC)	0.40, 0.94	BioGRID, IntAct, MINT
AXIN2	Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	10966653, 17510365, 22056988, (Europe PMC)	0.56	BioGRID, IntAct
BCCIP	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
BCL6	Reconstituted Complex, pull down	physical, physical association	25402006, (Europe PMC)	0.40	BioGRID, IntAct
BCL9	Affinity Capture-Western, pull down, two hybrid	physical, physical association	11955446, 24360964, (Europe PMC)	0.51	BioGRID, IntAct
BRIX1	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
BTRC	Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, PCA, Protein-peptide, Proximity Label-MS, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, enzymatic study, x-ray crystallography	association, physical, physical association, ubiquitination reaction	10023660, 10074433, 10228155, 12820959, 14516475, 14706645, 16376880, 16798748, 17053147, 18354482, 18650423, 18805092, 18851830, 19053519, 19061640, 19150432, 19956254, 19966869, 20531388, 20851351, 21466614, 21829575, 22017875, 22682247, 22730322, 22912335, 23514615, 24451375, 24464578, 24469040, 24501426, 24561623, 24912152, 25149538, 25515538, 25873176, 25900982, 26091241, 26506240, 27001857, 27316454, 28018973, 9990852, (Europe PMC)	0.93	BioGRID, IntAct, MINT
CACYBP	Affinity Capture-Western, Co-localization, proximity ligation assay	physical, physical association	11389839, 21466614, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
CASP3	Co-localization, proximity ligation assay	physical, physical association	25241761, (Europe PMC)	0.40	BioGRID, IntAct
CAV1	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	18356165, 19244345, (Europe PMC)	0.40	BioGRID, IntAct
CBY1	Affinity Capture-Western, Reconstituted Complex, pull down	direct interaction, physical	12712206, 18334222, 20096688, (Europe PMC)	0.44	BioGRID, IntAct
CDC73	Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid	association, physical, physical association	16630820, 21726809, (Europe PMC)	0.62	BioGRID, IntAct
CDH1	Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-localization, FRET, Proximity Label-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, proximity ligation assay, pull down, surface plasmon resonance	association, colocalization, physical, physical association	10381631, 10772923, 11113628, 11245482, 11254878, 11348595, 11401320, 11712088, 11960376, 12061792, 12169098, 12640114, 12830000, 15023525, 16125672, 16212417, 16574648, 16983094, 17220478, 17909039, 18593713, 18593907, 19016843, 22056988, 22158051, 22375065, 22715382, 22752307, 22850631, 23180380, 24424122, 24798214, 25344754, 25468996, 7542250, 7876318, 7954478, 8227214, 9233779, 9405455, 9535896, 9819408, (Europe PMC)	0.95	BioGRID, IntAct, MINT
CDH10	Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation	association, physical	10861224, 26496610, (Europe PMC)	0.35	BioGRID, IntAct
CDH2	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, tandem affinity purification	association, physical, physical association	11835406, 12077367, 12604612, 14625392, 17057644, 17098867, 17510365, 17679699, 18948590, 21357690, 25143387, (Europe PMC)	0.89	BioGRID, IntAct, MINT
CDH5	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, competition binding, imaging technique, pull down	association, colocalization, direct interaction, physical, physical association	12003790, 17057644, 18287330, 18662404, 20123964, 20224040, 22720799, 23243000, 28514442, 9434630, (Europe PMC)	0.81	BioGRID, IntAct, MINT
CDK6	Co-localization, proximity ligation assay	physical, physical association	25241761, (Europe PMC)	0.40	BioGRID, IntAct
CEP128	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
CKAP5	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
CLTA	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
CREBBP	Affinity Capture-Western, Phenotypic Enhancement, anti bait coimmunoprecipitation, two hybrid	genetic, physical, physical association	15782138, 16476742, 18347063, 21751375, 23273993, 26657156, 28648376, (Europe PMC)	0.57	BioGRID, IntAct
CRYAB	Affinity Capture-Western, Protein-peptide, anti bait coimmunoprecipitation, pull down	physical, physical association	17487982, 22158051, (Europe PMC)	0.52	BioGRID, IntAct
CSNK1A1	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
CSNK1E	protein kinase assay	phosphorylation reaction	11425858, (Europe PMC)	0.44	IntAct
CTNNA1	Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical, physical association	12640114, 15492215, 17072306, 17098867, 19941816, 24509793, 26344197, 26496610, 7706414, 7954478, 9512503, 9762469, (Europe PMC)	0.76	BioGRID, IntAct, MINT
CTNNA2	Co-fractionation, anti tag coimmunoprecipitation	physical, physical association	17679699, 26344197, (Europe PMC)	0.40	BioGRID, IntAct
CTNNA3	proximity ligation assay	physical association	25241761, (Europe PMC)	0.40	IntAct
CTNNBIP1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, competition binding, pull down, tandem affinity purification, x-ray crystallography	association, direct interaction, physical, physical association	10898789, 12408824, 12408825, 15893313, 17072306, 17353931, 17510365, 18287330, 21885566, 26912724, 28514442, (Europe PMC)	0.92	BioGRID, IntAct, MINT
CUL1	Affinity Capture-Western, enzymatic study	physical, ubiquitination reaction	10713156, 18805092, (Europe PMC)	0.44	BioGRID, IntAct
DACT1	anti bait coimmunoprecipitation, confocal microscopy	association, colocalization, physical association	22470507, (Europe PMC)	0.54	IntAct
DDB1	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical	19651607, (Europe PMC)	0.35	BioGRID, IntAct
DKK1	Co-localization, proximity ligation assay	physical, physical association	25241761, (Europe PMC)	0.40	BioGRID, IntAct
DNAJC8	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
DNMT1	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy	association, colocalization, physical association	25753001, (Europe PMC)	0.63	IntAct
DOT1L	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical association	20203130, 21103407, (Europe PMC)	0.56	IntAct
DVL1	Affinity Capture-Western, Co-localization, proximity ligation assay	physical, physical association	10806215, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
E2F3	pull down	association	22157815, (Europe PMC)	0.35	IntAct, MINT
EBI-10056674	electrophoretic mobility supershift assay	physical association	22022540, (Europe PMC)	0.40	IntAct
EBI-10056677	electrophoretic mobility supershift assay	physical association	22022540, (Europe PMC)	0.40	IntAct
EBI-1058500	anti bait coimmunoprecipitation	physical association	17353931, (Europe PMC)	0.40	IntAct
EBI-4399559	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical association	24561623, (Europe PMC)	0.58	IntAct
EGFR	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, tandem affinity purification	association, physical	11950845, 24189400, 9233779, 9535896, (Europe PMC)	0.35	BioGRID, IntAct
EGR1	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical, physical association	21743491, (Europe PMC)	0.50	BioGRID, IntAct
EMD	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, filter binding	physical, physical association	16858403, (Europe PMC)	0.59	BioGRID, IntAct, MINT
ENSG00000065361	chromatin immunoprecipitation assay	association	21741601, (Europe PMC)	0.35	IntAct
ENSG00000089685	chromatin immunoprecipitation assay	association	23245941, (Europe PMC)	0.35	IntAct
ENSG00000110092	chromatin immunoprecipitation assay	association	18772112, (Europe PMC)	0.35	IntAct
ENSG00000117560	chromatin immunoprecipitation assay	association	22022540, (Europe PMC)	0.35	IntAct
ENSG00000135245	chromatin immunoprecipitation assay	association	15930302, (Europe PMC)	0.35	IntAct
ENSG00000136997	chromatin immunoprecipitation assay	association	18772112, (Europe PMC)	0.35	IntAct
ENSG00000138795	chromatin immunoprecipitation assay	association	22014570, (Europe PMC)	0.35	IntAct
ENSG00000160182	chromatin immunoprecipitation assay	association	15304487, (Europe PMC)	0.35	IntAct
ENSG00000168646	chromatin immunoprecipitation assay	association	15304487, 22014570, (Europe PMC)	0.53	IntAct
ENSG00000171552	chromatin immunoprecipitation assay	association	23245941, (Europe PMC)	0.35	IntAct
ENSG00000177426	chromatin immunoprecipitation assay	association	25873176, (Europe PMC)	0.35	IntAct
EPHA2	anti bait coimmunoprecipitation	physical association	18948590, (Europe PMC)	0.40	IntAct
ERBIN	fluorescence microscopy	colocalization	12047349, (Europe PMC)	0.27	IntAct, MINT
ERMN	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
ESR1	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	15304487, (Europe PMC)	0.40	BioGRID, IntAct
ESR2	affinity chromatography technology	association	21182203, (Europe PMC)	0.35	IntAct
ETS1	anti bait coimmunoprecipitation	association	24562386, (Europe PMC)	0.35	IntAct, MINT
FAS	Co-localization, proximity ligation assay	physical, physical association	25241761, (Europe PMC)	0.40	BioGRID, IntAct
FBXW11	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	10321728, 16085715, 17510365, 22017875, 22682247, 24500709, 25332235, 25515538, 25609649, 25900982, (Europe PMC)	0.72	BioGRID, IntAct, MINT
FERMT2	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, pull down	association, colocalization, direct interaction, physical association	22699938, (Europe PMC)	0.68	IntAct, MINT
FGFR1	Co-localization, anti bait coimmunoprecipitation, proximity ligation assay	physical, physical association	11401320, 25241761, (Europe PMC)	0.59	BioGRID, IntAct
FHIT	Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down	direct interaction, physical, physical association	18077326, (Europe PMC)	0.60	BioGRID, IntAct
FLT1	proximity ligation assay	physical association	23397142, (Europe PMC)	0.40	IntAct
FOXB1	Affinity Capture-MS, tandem affinity purification	association, physical	25609649, (Europe PMC)	0.35	BioGRID, IntAct, MINT
FOXM1	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, chromatin immunoprecipitation assay, confocal microscopy, pull down	association, colocalization, direct interaction, physical, physical association	22014570, 26912724, (Europe PMC)	0.40, 0.67	BioGRID, IntAct
FOXO3	anti bait coimmunoprecipitation	physical association	29361949, (Europe PMC)	0.40	IntAct
FRMD5	fluorescence microscopy	colocalization	22846708, (Europe PMC)	0.27	IntAct, MINT
FYN	Biochemical Activity, Co-localization, proximity ligation assay	physical, physical association	12640114, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
GLIS2	Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, pull down, two hybrid pooling approach	physical, physical association	17289029, (Europe PMC)	0.58	BioGRID, IntAct, MINT
GSK3A	Affinity Capture-MS, Biochemical Activity, tandem affinity purification	association, physical	17510365, 25897075, 26496610, (Europe PMC)	0.35	BioGRID, IntAct
GSK3B	Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-localization, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, protein kinase assay, proximity ligation assay, proximity-dependent biotin identification, tandem affinity purification	association, phosphorylation reaction, physical, physical association	10074433, 10228155, 10330181, 11251183, 11835406, 16039586, 17318191, 17510365, 19061640, 19107203, 19303846, 19576224, 21743491, 22699938, 23602568, 24451375, 25241761, 25897075, 26359353, 27902311, 29045831, 29568061, 8638126, (Europe PMC)	0.94	BioGRID, IntAct, MINT
HDAC1	Affinity Capture-Western, anti tag coimmunoprecipitation	physical, physical association	10958684, 16204248, 17412698, 19166851, (Europe PMC)	0.40	BioGRID, IntAct, MINT
HDAC6	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	18356165, (Europe PMC)	0.40	BioGRID, IntAct
HIC1	anti tag coimmunoprecipitation, imaging technique	colocalization, physical association	16724116, (Europe PMC)	0.46	IntAct, MINT
HIF1A	anti bait coimmunoprecipitation	physical association	24650032, (Europe PMC)	0.40	IntAct
HNF4A	Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay	physical, physical association	12944908, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
HTT	Affinity Capture-Western, two hybrid	physical, physical association	17500595, 20531388, (Europe PMC)	0.37	BioGRID, IntAct
IGF1R	anti bait coimmunoprecipitation	association, physical association	22261717, (Europe PMC)	0.50	IntAct, MINT
IKBKB	Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay	physical, physical association	11527961, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
ILK	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	25852190, (Europe PMC)	0.35	BioGRID, IntAct
IQGAP1	Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy	colocalization, physical, physical association	11734550, 22662192, (Europe PMC)	0.46	BioGRID, IntAct
JRK	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down	association, physical association	21399610, (Europe PMC)	0.58	IntAct, MINT
JUP	Affinity Capture-MS, Affinity Capture-Western, Co-localization, anti tag coimmunoprecipitation, proximity ligation assay, tandem affinity purification	association, physical, physical association	11712088, 17510365, 25241761, 26496610, 9535896, (Europe PMC)	0.67	BioGRID, IntAct
KANK1	anti bait coimmunoprecipitation	physical association	16968744, (Europe PMC)	0.40	IntAct
KDM1A	anti bait coimmunoprecipitation	association	25753001, (Europe PMC)	0.35	IntAct
KIAA1109	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
KSR2	anti tag coimmunoprecipitation	association	27086506, (Europe PMC)	0.35	IntAct
L3MBTL3	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
LAMP1	proximity-dependent biotin identification, pull down	association	29568061, (Europe PMC)	0.46	IntAct
LEF1	Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, tandem affinity purification	association, direct interaction, physical, physical association	10890911, 10958684, 11751639, 11835406, 12077367, 12748295, 15525529, 15684397, 15728254, 15768032, 16204248, 16510874, 16510875, 17510365, 17517646, 18077326, 18296023, 20123964, 21743491, 8757136, 9419974, (Europe PMC)	0.86	BioGRID, IntAct
LEO1	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	16630820, (Europe PMC)	0.40	BioGRID, IntAct
LRP2	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
LRP6	Affinity Capture-Western, anti tag coimmunoprecipitation	physical, physical association	16890161, (Europe PMC)	0.40	BioGRID, IntAct
MAP1LC3B	anti bait coimmunoprecipitation, pull down	direct interaction, physical association	23736261, (Europe PMC)	0.60	IntAct, MINT
MAPK6	anti tag coimmunoprecipitation	association	26972000, (Europe PMC)	0.35	IntAct
MCM7	anti bait coimmunoprecipitation	association	23764002, (Europe PMC)	0.35	IntAct
MLLT10	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down	association, direct interaction, physical association	20203130, 21103407, (Europe PMC)	0.66	IntAct
NCOA2	anti bait coimmunoprecipitation	physical association	12588987, (Europe PMC)	0.40	IntAct, MINT
NDRG1	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical, physical association	17220478, (Europe PMC)	0.50	BioGRID, IntAct
NDRG2	cosedimentation	colocalization	23068607, (Europe PMC)	0.35	IntAct, MINT
NFKB1	Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, proximity ligation assay, pull down	direct interaction, physical, physical association	15829968, 19358846, 25241761, (Europe PMC)	0.67	BioGRID, IntAct, MINT
NOS3	anti bait coimmunoprecipitation, proximity ligation assay	physical association	25062958, (Europe PMC)	0.52	IntAct
NR5A2	molecular sieving, pull down, x-ray crystallography	direct interaction, physical association	22187462, (Europe PMC)	0.65	IntAct
NUDT5	Affinity Capture-MS, inference by socio-affinity scoring	physical, physical association	27173435, (Europe PMC)	0.27	BioGRID, IntAct
NUMB	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical association	24561623, (Europe PMC)	0.40, 0.50	IntAct
PARD3	anti bait coimmunoprecipitation, proximity ligation assay	physical association	17057644, 25241761, (Europe PMC)	0.59	IntAct, MINT
PARP2	protein array	adp ribosylation reaction	21812934, (Europe PMC)	0.44	IntAct, MINT
PBDC1	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
PECAM1	Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, proximity ligation assay	association, physical, physical association	10801826, 25241761, (Europe PMC)	0.56	BioGRID, IntAct
PHB2	anti bait coimmunoprecipitation	physical association	17353931, (Europe PMC)	0.40	IntAct
PIK3R1	Co-localization, Reconstituted Complex, proximity ligation assay	physical, physical association	10477752, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
PITX2	Affinity Capture-Western, Co-localization, anti tag coimmunoprecipitation, proximity ligation assay	association, physical, physical association	12464179, 19174163, 25241761, (Europe PMC)	0.56	BioGRID, IntAct, MINT
PKM	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down	physical, physical association	22056988, 27485204, (Europe PMC)	0.52	BioGRID, IntAct
PKP4	fluorescence microscopy	colocalization	12047349, (Europe PMC)	0.27	IntAct, MINT
PLEKHA7	anti bait coimmunoprecipitation	association	28877994, (Europe PMC)	0.35	IntAct
PPM1A	anti bait coimmunoprecipitation	association	10644691, (Europe PMC)	0.35	IntAct, MINT
PRKCA	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	21949397, 21952047, (Europe PMC)	0.40	BioGRID, IntAct, MINT
PRPF38B	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
PTBP3	anti bait coimmunoprecipitation	association	22575643, (Europe PMC)	0.35	IntAct, MINT
PTEN	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	20123964, 20372837, (Europe PMC)	0.40	BioGRID, IntAct
PTH1R	fluorescence microscopy, proximity ligation assay, two hybrid	colocalization, physical association	23124878, (Europe PMC)	0.54	IntAct
PTK7	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid	physical association	21132015, (Europe PMC)	0.58	IntAct, MINT
PTPN12	phosphatase assay	dephosphorylation reaction	19167335, (Europe PMC)	0.44	IntAct
PTPRB	phosphatase assay	dephosphorylation reaction	19167335, (Europe PMC)	0.44	IntAct
PTPRC	phosphatase assay, pull down	dephosphorylation reaction, physical association	12370829, 19167335, (Europe PMC)	0.61	IntAct, MINT
PTPRG	phosphatase assay	dephosphorylation reaction, physical association	19167335, 21112398, (Europe PMC)	0.61	IntAct, MINT
PTPRJ	Affinity Capture-Western, phosphatase assay, pull down	dephosphorylation reaction, physical, physical association	12370829, 19167335, (Europe PMC)	0.61	BioGRID, IntAct, MINT
PTPRO	phosphatase assay	dephosphorylation reaction	19167335, (Europe PMC)	0.44	IntAct
PXN	anti bait coimmunoprecipitation, pull down	direct interaction, physical association	22728435, (Europe PMC)	0.60	IntAct, MINT
RABAC1	cosedimentation	colocalization	23068607, (Europe PMC)	0.35	IntAct, MINT
RBM39	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
RBX1	enzymatic study	ubiquitination reaction	18805092, (Europe PMC)	0.44	IntAct
RELA	anti bait coimmunoprecipitation	physical association	23273993, 24072822, (Europe PMC)	0.59	IntAct
RNF14	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical	23449499, (Europe PMC)	0.35	BioGRID, IntAct, MINT
RPL21	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
RPL41	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
RUNX3	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, chromatin immunoprecipitation assay, pull down	association, physical association	18772112, (Europe PMC)	0.66	IntAct
RUVBL1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation	association, physical, physical association	16510874, 16510875, 18087039, 9843967, (Europe PMC)	0.50	BioGRID, IntAct
RXRA	Affinity Capture-Western, Co-localization, proximity ligation assay	physical, physical association	12771132, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
SATB1	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid	direct interaction, physical, physical association	20126258, (Europe PMC)	0.66	BioGRID, IntAct
SCRIB	fluorescence microscopy, phage display	colocalization, physical association	24550280, (Europe PMC)	0.46	IntAct, MINT
SH3KBP1	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
SIRT1	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	20439735, (Europe PMC)	0.40	BioGRID, IntAct
SKP1	Affinity Capture-Western, Co-localization, Protein-peptide, enzymatic study, proximity ligation assay, x-ray crystallography	physical, physical association, ubiquitination reaction	11389839, 12820959, 18805092, 21466614, 25241761, 9990852, (Europe PMC)	0.71	BioGRID, IntAct
SLC9A3R2	Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification	association, physical, physical association	27173435, (Europe PMC)	0.51	BioGRID, IntAct
SMARCA4	Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation	association, physical	11532957, 19571879, (Europe PMC)	0.35	BioGRID, IntAct
SOX17	anti bait coimmunoprecipitation	association, physical association	17875931, (Europe PMC)	0.50	IntAct
SRC	anti bait coimmunoprecipitation, protein kinase assay	phosphorylation reaction, physical association	22056988, (Europe PMC)	0.54	IntAct
STK39	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
STK4	tandem affinity purification	association	23386615, (Europe PMC)	0.35	IntAct
STRN3	Proximity Label-MS, proximity-dependent biotin identification	colocalization, physical	24255178, (Europe PMC)	0.35	BioGRID, IntAct
TBL1X	Affinity Capture-Western, Co-localization, proximity ligation assay	physical, physical association	11389839, 18193033, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
TBX5	anti tag coimmunoprecipitation, chromatin immunoprecipitation assay	association	23245941, (Europe PMC)	0.46	IntAct
TCF4	Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down	association, physical, physical association	11713476, 12657632, 12727872, 15060161, 15331612, 15525529, 15665104, 17072306, 17318191, 17412698, 17875931, 17909039, 17962194, 17983804, 18281465, 20126258, 21103407, 21743491, 22080605, 22699938, 23449499, 24532795, 24798214, 24876153, 25402006, 29361949, (Europe PMC)	0.94	BioGRID, IntAct, MINT
TCF7	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, tandem affinity purification	association, direct interaction, physical association	16442529, 17510365, 19358846, 25678599, (Europe PMC)	0.78	IntAct, MINT
TCF7L2	Affinity Capture-Western, Co-crystal Structure, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, x-ray crystallography	association, direct interaction, physical, physical association	11713475, 11713476, 16230076, 16442529, 16569639, 16630820, 16724116, 17050667, 17283121, 17914096, 18772112, 19202075, 19304756, 19443654, 19816403, 20126258, 21670201, 22014570, 22056988, 22155184, 22304967, 26350900, 27902311, (Europe PMC)	0.97	BioGRID, IntAct, MINT
TERT	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	physical association	19571879, (Europe PMC)	0.52	IntAct
TGIF1	fluorescence microscopy	colocalization	25873176, (Europe PMC)	0.27	IntAct
TMPO	anti bait coimmunoprecipitation	physical association	16858403, (Europe PMC)	0.40	IntAct, MINT
TNIK	anti bait coimmunoprecipitation, pull down	association, direct interaction	19816403, (Europe PMC)	0.52	IntAct, MINT
TNRC6B	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
TOP2A	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, fluorescence microscopy, two hybrid	association, colocalization, physical, physical association	16230076, 17983804, (Europe PMC)	0.57	BioGRID, IntAct
TP53BP2	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical association	25344754, (Europe PMC)	0.58	IntAct
TRIB2	fluorescence microscopy	colocalization	25311538, (Europe PMC)	0.27	IntAct, MINT
UBA1	enzymatic study	ubiquitination reaction	18805092, (Europe PMC)	0.44	IntAct
UBE2D2	enzymatic study	ubiquitination reaction	18805092, (Europe PMC)	0.44	IntAct
UBR5	Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy	colocalization, physical, physical association	21118991, 28689657, (Europe PMC)	0.46	BioGRID, IntAct
UHRF2	Far Western, antibody array	physical, physical association	21952639, (Europe PMC)	0.40	BioGRID, IntAct
VHL	anti bait coimmunoprecipitation	physical association	16983094, (Europe PMC)	0.40	IntAct
WWTR1	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical association	22234184, 23245942, (Europe PMC)	0.64	IntAct, MINT
YAP1	Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, inference by socio-affinity scoring, pull down	association, direct interaction, physical, physical association	21376238, 22234184, 23245941, 24976009, 27173435, (Europe PMC)	0.40, 0.88	BioGRID, IntAct, MINT
YES1	anti bait coimmunoprecipitation	association	23245941, (Europe PMC)	0.35	IntAct
YWHAZ	Affinity Capture-MS, Affinity Capture-Western, coimmunoprecipitation	association, physical	15492215, 17287208, 22912335, (Europe PMC)	0.35	BioGRID, IntAct, MINT
ZFYVE9	Two-hybrid, two hybrid	physical, physical association	15231748, (Europe PMC)	0.37	BioGRID, IntAct, MINT
ZIC3	Reconstituted Complex, pull down	physical, physical association	25402006, (Europe PMC)	0.40	BioGRID, IntAct

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
ACP1	Co-localization	physical	12438242, (Europe PMC)	NA	BioGRID
ACTB	Affinity Capture-Western	physical	22720799, (Europe PMC)	NA	BioGRID
ACTN4	Co-localization	physical	25241761, (Europe PMC)	NA	BioGRID
ACTN4	anti bait coimmunoprecipitation, confocal microscopy, proximity ligation assay, two hybrid	association, colocalization, physical association	16204054, 25241761, (Europe PMC)	0.70	IntAct
AHCTF1	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
AHR	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	19651607, 23174221, (Europe PMC)	0.40	BioGRID, IntAct
AJAP1	Affinity Capture-Western	physical	14595118, (Europe PMC)	NA	BioGRID
AKAP12	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
AKT1	Biochemical Activity	physical	15492215, 17287208, (Europe PMC)	NA	BioGRID
AMER1	Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation, pull down, tandem affinity purification	association, direct interaction, physical, physical association	17510365, 26496610, (Europe PMC)	0.71	BioGRID, IntAct
AMOT	Proximity Label-MS, proximity-dependent biotin identification	colocalization, physical	24255178, (Europe PMC)	0.35	BioGRID, IntAct
ANP32A	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
AP2M1	Affinity Capture-MS, tandem affinity purification	association, physical	24189400, (Europe PMC)	0.35	BioGRID, IntAct
AP3D1	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
APC	Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-localization, Far Western, Protein-peptide, Reconstituted Complex	physical	10545404, 11251183, 11533658, 11707392, 11712088, 11972058, 12628243, 15327769, 15355978, 15525529, 16510874, 19576224, 21664290, 23840886, 25241761, 26496610, 27902311, 29045831, 8259519, 9286858, (Europe PMC)	NA	BioGRID
APC	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity ligation assay, pull down, tandem affinity purification, x-ray crystallography	association, direct interaction, physical association	15327768, 15327769, 16212417, 17318191, 17510365, 22056988, 22682247, 25241761, 26496610, 8638126, 9707618, (Europe PMC)	0.95	IntAct, MINT
APC2	Affinity Capture-Western, Reconstituted Complex, Two-hybrid	physical	10074433, 16510875, 23840886, 9823329, (Europe PMC)	NA	BioGRID
APP	Reconstituted Complex	physical	21832049, (Europe PMC)	NA	BioGRID
APPL1	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
AR	Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, confocal microscopy, pull down, two hybrid	association, colocalization, direct interaction, physical, physical association	10987273, 11792709, 11916967, 12588987, 12799378, 12944908, 14593076, 15060161, 15256534, 21741601, 21885566, 22187462, (Europe PMC)	0.89	BioGRID, IntAct, MINT
ARHGAP21	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
ARID4B	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
ARMC8	Affinity Capture-Western	physical	18215130, (Europe PMC)	NA	BioGRID
ASH2L	Reconstituted Complex	physical	16510874, 16510875, (Europe PMC)	NA	BioGRID
ATF2	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	22304920, (Europe PMC)	0.35	BioGRID, IntAct
AURKA	Affinity Capture-MS	physical	26496610, (Europe PMC)	NA	BioGRID
AXIN1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	10228155, 12421363, 12805222, 16199882, 16890161, 17318191, 17510365, 18593713, 18632848, 19131971, 19166851, 20128690, 20531388, 21242974, 22509369, 22682247, 22773187, 23892894, 23959799, 24976009, 26496610, 27902311, 29045831, 9734785, (Europe PMC)	0.40, 0.94	BioGRID, IntAct, MINT
AXIN2	Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	10966653, 17510365, 22056988, (Europe PMC)	0.56	BioGRID, IntAct
BCCIP	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
BCL3	Affinity Capture-Western	physical	15829968, (Europe PMC)	NA	BioGRID
BCL6	Reconstituted Complex, pull down	physical, physical association	25402006, (Europe PMC)	0.40	BioGRID, IntAct
BCL9	Affinity Capture-Western, pull down, two hybrid	physical, physical association	11955446, 24360964, (Europe PMC)	0.51	BioGRID, IntAct
BCL9L	Affinity Capture-Western	physical	24360964, (Europe PMC)	NA	BioGRID
BOC	Affinity Capture-Western	physical	12634428, (Europe PMC)	NA	BioGRID
BRCA1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex	physical	20215423, 26831064, (Europe PMC)	NA	BioGRID
BRIX1	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
BTF3	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
BTRC	Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, PCA, Protein-peptide, Proximity Label-MS, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, enzymatic study, x-ray crystallography	association, physical, physical association, ubiquitination reaction	10023660, 10074433, 10228155, 12820959, 14516475, 14706645, 16376880, 16798748, 17053147, 18354482, 18650423, 18805092, 18851830, 19053519, 19061640, 19150432, 19956254, 19966869, 20531388, 20851351, 21466614, 21829575, 22017875, 22682247, 22730322, 22912335, 23514615, 24451375, 24464578, 24469040, 24501426, 24561623, 24912152, 25149538, 25515538, 25873176, 25900982, 26091241, 26506240, 27001857, 27316454, 28018973, 9990852, (Europe PMC)	0.93	BioGRID, IntAct, MINT
CA9	Affinity Capture-Western	physical	14567991, (Europe PMC)	NA	BioGRID
CACYBP	Affinity Capture-Western, Co-localization, proximity ligation assay	physical, physical association	11389839, 21466614, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
CALCOCO1	Phenotypic Enhancement	genetic	16931570, (Europe PMC)	NA	BioGRID
CARM1	Reconstituted Complex	physical	11983685, (Europe PMC)	NA	BioGRID
CASP3	Co-localization, proximity ligation assay	physical, physical association	25241761, (Europe PMC)	0.40	BioGRID, IntAct
CAV1	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	18356165, 19244345, (Europe PMC)	0.40	BioGRID, IntAct
CBL	Affinity Capture-Western, Biochemical Activity	physical	23744067, 25784557, (Europe PMC)	NA	BioGRID
CBY1	Affinity Capture-Western, Reconstituted Complex, pull down	direct interaction, physical	12712206, 18334222, 20096688, (Europe PMC)	0.44	BioGRID, IntAct
CCDC8	Affinity Capture-MS	physical	24711643, (Europe PMC)	NA	BioGRID
CCNA1	Affinity Capture-Western	physical	14985333, (Europe PMC)	NA	BioGRID
CCNA2	Affinity Capture-Western, Reconstituted Complex	physical	14985333, (Europe PMC)	NA	BioGRID
CCNE1	Affinity Capture-Western, Reconstituted Complex	physical	14985333, (Europe PMC)	NA	BioGRID
CDC27	Reconstituted Complex	physical	16510875, (Europe PMC)	NA	BioGRID
CDC73	Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid	association, physical, physical association	16630820, 21726809, (Europe PMC)	0.62	BioGRID, IntAct
CDH1	Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-localization, FRET, Proximity Label-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, proximity ligation assay, pull down, surface plasmon resonance	association, colocalization, physical, physical association	10381631, 10772923, 11113628, 11245482, 11254878, 11348595, 11401320, 11712088, 11960376, 12061792, 12169098, 12640114, 12830000, 15023525, 16125672, 16212417, 16574648, 16983094, 17220478, 17909039, 18593713, 18593907, 19016843, 22056988, 22158051, 22375065, 22715382, 22752307, 22850631, 23180380, 24424122, 24798214, 25344754, 25468996, 7542250, 7876318, 7954478, 8227214, 9233779, 9405455, 9535896, 9819408, (Europe PMC)	0.95	BioGRID, IntAct, MINT
CDH10	Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation	association, physical	10861224, 26496610, (Europe PMC)	0.35	BioGRID, IntAct
CDH11	Affinity Capture-Western	physical	10029089, (Europe PMC)	NA	BioGRID
CDH18	Affinity Capture-Western	physical	10207020, (Europe PMC)	NA	BioGRID
CDH2	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, tandem affinity purification	association, physical, physical association	11835406, 12077367, 12604612, 14625392, 17057644, 17098867, 17510365, 17679699, 18948590, 21357690, 25143387, (Europe PMC)	0.89	BioGRID, IntAct, MINT
CDH3	Affinity Capture-Western, Co-purification	physical	10381631, 10910767, 23180380, (Europe PMC)	NA	BioGRID
CDH5	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, competition binding, imaging technique, pull down	association, colocalization, direct interaction, physical, physical association	12003790, 17057644, 18287330, 18662404, 20123964, 20224040, 22720799, 23243000, 28514442, 9434630, (Europe PMC)	0.81	BioGRID, IntAct, MINT
CDH6	Affinity Capture-Western	physical	10207020, (Europe PMC)	NA	BioGRID
CDH7	Affinity Capture-Western	physical	10861224, (Europe PMC)	NA	BioGRID
CDH8	Affinity Capture-MS, Affinity Capture-Western	physical	28514442, 9521872, (Europe PMC)	NA	BioGRID
CDH9	Affinity Capture-Western	physical	10861224, (Europe PMC)	NA	BioGRID
CDK2	Affinity Capture-Western, Reconstituted Complex	physical	14985333, (Europe PMC)	NA	BioGRID
CDK5R1	Affinity Capture-Western, Reconstituted Complex	physical	11168528, (Europe PMC)	NA	BioGRID
CDK6	Co-localization, proximity ligation assay	physical, physical association	25241761, (Europe PMC)	0.40	BioGRID, IntAct
CDON	Affinity Capture-Western	physical	12634428, (Europe PMC)	NA	BioGRID
CEP128	Proximity Label-MS, proximity-dependent biotin identification	association, physical	26638075, (Europe PMC)	0.35	BioGRID, IntAct
CFAP298	Affinity Capture-MS	physical	26472760, (Europe PMC)	NA	BioGRID
CFTR	Affinity Capture-MS	physical	26618866, (Europe PMC)	NA	BioGRID
CHD8	Affinity Capture-Western, Reconstituted Complex	physical	18378692, 22083958, (Europe PMC)	NA	BioGRID
CHUK	Affinity Capture-Western, Biochemical Activity, Reconstituted Complex	physical	11527961, 12589056, (Europe PMC)	NA	BioGRID
CITED1	Affinity Capture-Western	physical	15843474, (Europe PMC)	NA	BioGRID
CKAP5	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
CLTA	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
COPS3	Affinity Capture-Western	physical	19576224, (Europe PMC)	NA	BioGRID
COPS5	Affinity Capture-Western	physical	19576224, 24882689, (Europe PMC)	NA	BioGRID
COPS8	Affinity Capture-Western	physical	19576224, (Europe PMC)	NA	BioGRID
CREB1	Affinity Capture-Western	physical	17962194, (Europe PMC)	NA	BioGRID
CREBBP	Affinity Capture-Western, Phenotypic Enhancement, anti bait coimmunoprecipitation, two hybrid	genetic, physical, physical association	15782138, 16476742, 18347063, 21751375, 23273993, 26657156, 28648376, (Europe PMC)	0.57	BioGRID, IntAct
CRYAB	Affinity Capture-Western, Protein-peptide, anti bait coimmunoprecipitation, pull down	physical, physical association	17487982, 22158051, (Europe PMC)	0.52	BioGRID, IntAct
CSNK1A1	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
CSNK1E	protein kinase assay	phosphorylation reaction	11425858, (Europe PMC)	0.44	IntAct
CTBP1	Affinity Capture-Western	physical	15525529, 24469828, (Europe PMC)	NA	BioGRID
CTNNA1	Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical, physical association	12640114, 15492215, 17072306, 17098867, 19941816, 24509793, 26344197, 26496610, 7706414, 7954478, 9512503, 9762469, (Europe PMC)	0.76	BioGRID, IntAct, MINT
CTNNA2	Co-fractionation, anti tag coimmunoprecipitation	physical, physical association	17679699, 26344197, (Europe PMC)	0.40	BioGRID, IntAct
CTNNA3	Affinity Capture-MS, Affinity Capture-Western, Co-localization	physical	11590244, 23718855, 25241761, 28514442, (Europe PMC)	NA	BioGRID
CTNNA3	proximity ligation assay	physical association	25241761, (Europe PMC)	0.40	IntAct
CTNNBIP1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, competition binding, pull down, tandem affinity purification, x-ray crystallography	association, direct interaction, physical, physical association	10898789, 12408824, 12408825, 15893313, 17072306, 17353931, 17510365, 18287330, 21885566, 26912724, 28514442, (Europe PMC)	0.92	BioGRID, IntAct, MINT
CTNND1	Affinity Capture-Western	physical	11712088, 9535896, (Europe PMC)	NA	BioGRID
CUL1	Affinity Capture-Western, enzymatic study	physical, ubiquitination reaction	10713156, 18805092, (Europe PMC)	0.44	BioGRID, IntAct
CUL3	Affinity Capture-MS	physical	21145461, (Europe PMC)	NA	BioGRID
CUL4A	Affinity Capture-Western	physical	17954973, (Europe PMC)	NA	BioGRID
DACT1	anti bait coimmunoprecipitation, confocal microscopy	association, colocalization, physical association	22470507, (Europe PMC)	0.54	IntAct
DAZAP2	Affinity Capture-Western	physical	19304756, (Europe PMC)	NA	BioGRID
DDB1	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical	19651607, (Europe PMC)	0.35	BioGRID, IntAct
DDX1	Affinity Capture-MS	physical	16230076, (Europe PMC)	NA	BioGRID
DDX5	Affinity Capture-MS, Affinity Capture-Western	physical	16230076, (Europe PMC)	NA	BioGRID
DHX9	Affinity Capture-MS	physical	16230076, (Europe PMC)	NA	BioGRID
DKK1	Co-localization, proximity ligation assay	physical, physical association	25241761, (Europe PMC)	0.40	BioGRID, IntAct
DLG5	Affinity Capture-Western	physical	12657639, (Europe PMC)	NA	BioGRID
DLGAP1	Affinity Capture-Western	physical	9286858, (Europe PMC)	NA	BioGRID
DNAJC8	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
DNMT1	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy	association, colocalization, physical association	25753001, (Europe PMC)	0.63	IntAct
DOT1L	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical association	20203130, 21103407, (Europe PMC)	0.56	IntAct
DSC3	Affinity Capture-Western	physical	10769211, (Europe PMC)	NA	BioGRID
DVL1	Affinity Capture-Western, Co-localization, proximity ligation assay	physical, physical association	10806215, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
DVL2	Affinity Capture-Western	physical	10806215, (Europe PMC)	NA	BioGRID
DVL3	Affinity Capture-Western	physical	10806215, (Europe PMC)	NA	BioGRID
E2F3	pull down	association	22157815, (Europe PMC)	0.35	IntAct, MINT
EBI-10056674	electrophoretic mobility supershift assay	physical association	22022540, (Europe PMC)	0.40	IntAct
EBI-10056677	electrophoretic mobility supershift assay	physical association	22022540, (Europe PMC)	0.40	IntAct
EBI-1058500	anti bait coimmunoprecipitation	physical association	17353931, (Europe PMC)	0.40	IntAct
EBI-4399559	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical association	24561623, (Europe PMC)	0.58	IntAct
EGFR	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, tandem affinity purification	association, physical	11950845, 24189400, 9233779, 9535896, (Europe PMC)	0.35	BioGRID, IntAct
EGR1	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical, physical association	21743491, (Europe PMC)	0.50	BioGRID, IntAct
ELAVL1	Reconstituted Complex	physical	22544606, (Europe PMC)	NA	BioGRID
EMD	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, filter binding	physical, physical association	16858403, (Europe PMC)	0.59	BioGRID, IntAct, MINT
ENSG00000065361	chromatin immunoprecipitation assay	association	21741601, (Europe PMC)	0.35	IntAct
ENSG00000089685	chromatin immunoprecipitation assay	association	23245941, (Europe PMC)	0.35	IntAct
ENSG00000110092	chromatin immunoprecipitation assay	association	18772112, (Europe PMC)	0.35	IntAct
ENSG00000117560	chromatin immunoprecipitation assay	association	22022540, (Europe PMC)	0.35	IntAct
ENSG00000135245	chromatin immunoprecipitation assay	association	15930302, (Europe PMC)	0.35	IntAct
ENSG00000136997	chromatin immunoprecipitation assay	association	18772112, (Europe PMC)	0.35	IntAct
ENSG00000138795	chromatin immunoprecipitation assay	association	22014570, (Europe PMC)	0.35	IntAct
ENSG00000160182	chromatin immunoprecipitation assay	association	15304487, (Europe PMC)	0.35	IntAct
ENSG00000168646	chromatin immunoprecipitation assay	association	15304487, 22014570, (Europe PMC)	0.53	IntAct
ENSG00000171552	chromatin immunoprecipitation assay	association	23245941, (Europe PMC)	0.35	IntAct
ENSG00000177426	chromatin immunoprecipitation assay	association	25873176, (Europe PMC)	0.35	IntAct
EP300	Affinity Capture-Luminescence, Affinity Capture-Western, Biochemical Activity, Phenotypic Enhancement, Reconstituted Complex	genetic, physical	11050151, 12408825, 12861022, 15060161, 15572674, 15806138, 16990252, 26657156, (Europe PMC)	NA	BioGRID
EP400	Affinity Capture-MS	physical	16510874, 16510875, (Europe PMC)	NA	BioGRID
EPAS1	Affinity Capture-MS	physical	23275444, (Europe PMC)	NA	BioGRID
EPHA2	anti bait coimmunoprecipitation	physical association	18948590, (Europe PMC)	0.40	IntAct
ERBB2	Affinity Capture-Western, Co-localization, Far Western, Reconstituted Complex	physical	11245482, 11950845, 7702605, (Europe PMC)	NA	BioGRID
ERBIN	Protein-peptide	physical	15123239, (Europe PMC)	NA	BioGRID
ERBIN	fluorescence microscopy	colocalization	12047349, (Europe PMC)	0.27	IntAct, MINT
ERMN	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
ESR1	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	15304487, (Europe PMC)	0.40	BioGRID, IntAct
ESR2	affinity chromatography technology	association	21182203, (Europe PMC)	0.35	IntAct
ETS1	anti bait coimmunoprecipitation	association	24562386, (Europe PMC)	0.35	IntAct, MINT
EZH2	Affinity Capture-Western, Reconstituted Complex	physical	17502350, 19661437, (Europe PMC)	NA	BioGRID
EZR	Affinity Capture-Western	physical	10462524, (Europe PMC)	NA	BioGRID
FAF1	Affinity Capture-Western	physical	21411632, 22730322, 26456834, (Europe PMC)	NA	BioGRID
FANCA	Affinity Capture-Western	physical	22653977, 24469828, (Europe PMC)	NA	BioGRID
FANCC	Affinity Capture-Western, Co-localization	physical	22653977, 24469828, (Europe PMC)	NA	BioGRID
FANCE	Affinity Capture-Western	physical	24469828, (Europe PMC)	NA	BioGRID
FANCF	Affinity Capture-Western	physical	24469828, (Europe PMC)	NA	BioGRID
FANCG	Affinity Capture-Western	physical	22653977, (Europe PMC)	NA	BioGRID
FAS	Co-localization, proximity ligation assay	physical, physical association	25241761, (Europe PMC)	0.40	BioGRID, IntAct
FBXO45	Affinity Capture-MS, Affinity Capture-Western	physical	25143387, (Europe PMC)	NA	BioGRID
FBXW11	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	10321728, 16085715, 17510365, 22017875, 22682247, 24500709, 25332235, 25515538, 25609649, 25900982, (Europe PMC)	0.72	BioGRID, IntAct, MINT
FBXW7	Affinity Capture-Western	physical	27485116, (Europe PMC)	NA	BioGRID
FER	Biochemical Activity	physical	12640114, (Europe PMC)	NA	BioGRID
FERMT2	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, pull down	association, colocalization, direct interaction, physical association	22699938, (Europe PMC)	0.68	IntAct, MINT
FGFR1	Co-localization, anti bait coimmunoprecipitation, proximity ligation assay	physical, physical association	11401320, 25241761, (Europe PMC)	0.59	BioGRID, IntAct
FHIT	Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down	direct interaction, physical, physical association	18077326, (Europe PMC)	0.60	BioGRID, IntAct
FHL2	Affinity Capture-Western, Reconstituted Complex, Two-hybrid	physical	12466281, (Europe PMC)	NA	BioGRID
FLT1	proximity ligation assay	physical association	23397142, (Europe PMC)	0.40	IntAct
FOXB1	Affinity Capture-MS, tandem affinity purification	association, physical	25609649, (Europe PMC)	0.35	BioGRID, IntAct, MINT
FOXM1	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, chromatin immunoprecipitation assay, confocal microscopy, pull down	association, colocalization, direct interaction, physical, physical association	22014570, 26912724, (Europe PMC)	0.40, 0.67	BioGRID, IntAct
FOXO3	Affinity Capture-Western	physical	15905404, (Europe PMC)	NA	BioGRID
FOXO3	anti bait coimmunoprecipitation	physical association	29361949, (Europe PMC)	0.40	IntAct
FOXO4	Affinity Capture-Western	physical	15905404, 20874444, (Europe PMC)	NA	BioGRID
FRMD5	fluorescence microscopy	colocalization	22846708, (Europe PMC)	0.27	IntAct, MINT
FUS	Affinity Capture-MS, Affinity Capture-Western, Two-hybrid	physical	16230076, (Europe PMC)	NA	BioGRID
FYN	Biochemical Activity, Co-localization, proximity ligation assay	physical, physical association	12640114, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
GEMIN5	Affinity Capture-MS	physical	16230076, (Europe PMC)	NA	BioGRID
GLIS2	Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, pull down, two hybrid pooling approach	physical, physical association	17289029, (Europe PMC)	0.58	BioGRID, IntAct, MINT
GRIP1	Phenotypic Enhancement	genetic	16990252, (Europe PMC)	NA	BioGRID
GSK3A	Affinity Capture-MS, Biochemical Activity, tandem affinity purification	association, physical	17510365, 25897075, 26496610, (Europe PMC)	0.35	BioGRID, IntAct
GSK3B	Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-localization, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, protein kinase assay, proximity ligation assay, proximity-dependent biotin identification, tandem affinity purification	association, phosphorylation reaction, physical, physical association	10074433, 10228155, 10330181, 11251183, 11835406, 16039586, 17318191, 17510365, 19061640, 19107203, 19303846, 19576224, 21743491, 22699938, 23602568, 24451375, 25241761, 25897075, 26359353, 27902311, 29045831, 29568061, 8638126, (Europe PMC)	0.94	BioGRID, IntAct, MINT
HDAC1	Affinity Capture-Western, anti tag coimmunoprecipitation	physical, physical association	10958684, 16204248, 17412698, 19166851, (Europe PMC)	0.40	BioGRID, IntAct, MINT
HDAC4	Affinity Capture-Western	physical	16204248, (Europe PMC)	NA	BioGRID
HDAC6	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	18356165, (Europe PMC)	0.40	BioGRID, IntAct
HDAC7	Affinity Capture-MS, Affinity Capture-Western, Co-localization	physical	20224040, 21836063, (Europe PMC)	NA	BioGRID
HERC2	Affinity Capture-MS	physical	25476789, (Europe PMC)	NA	BioGRID
HERC5	Affinity Capture-Western	physical	20581239, 28744352, (Europe PMC)	NA	BioGRID
HIC1	anti tag coimmunoprecipitation, imaging technique	colocalization, physical association	16724116, (Europe PMC)	0.46	IntAct, MINT
HIF1A	Affinity Capture-Western	physical	24650032, (Europe PMC)	NA	BioGRID
HIF1A	anti bait coimmunoprecipitation	physical association	24650032, (Europe PMC)	0.40	IntAct
HINT1	Affinity Capture-Western, Two-hybrid	physical	16014379, 22647378, (Europe PMC)	NA	BioGRID
HIST1H1C	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex	physical	18258596, (Europe PMC)	NA	BioGRID
HNF4A	Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay	physical, physical association	12944908, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
HNRNPA1	Affinity Capture-MS, Affinity Capture-Western	physical	15492215, 16230076, (Europe PMC)	NA	BioGRID
HNRNPA2B1	Affinity Capture-MS, Affinity Capture-Western	physical	16230076, (Europe PMC)	NA	BioGRID
HNRNPK	Affinity Capture-Western	physical	16230076, (Europe PMC)	NA	BioGRID
HNRNPM	Affinity Capture-MS	physical	16230076, (Europe PMC)	NA	BioGRID
HSP90AB1	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
HSPA1B	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
HSPA8	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
HTT	Affinity Capture-Western, two hybrid	physical, physical association	17500595, 20531388, (Europe PMC)	0.37	BioGRID, IntAct
HUWE1	Affinity Capture-MS	physical	25147182, (Europe PMC)	NA	BioGRID
IFRD1	Affinity Capture-Western	physical	16204248, (Europe PMC)	NA	BioGRID
IGF1R	anti bait coimmunoprecipitation	association, physical association	22261717, (Europe PMC)	0.50	IntAct, MINT
IKBKB	Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay	physical, physical association	11527961, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
ILK	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	25852190, (Europe PMC)	0.35	BioGRID, IntAct
IQGAP1	Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy	colocalization, physical, physical association	11734550, 22662192, (Europe PMC)	0.46	BioGRID, IntAct
ISG15	Affinity Capture-Western	physical	20581239, (Europe PMC)	NA	BioGRID
JADE1	Affinity Capture-Western, Biochemical Activity	physical	18806787, (Europe PMC)	NA	BioGRID
JRK	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down	association, physical association	21399610, (Europe PMC)	0.58	IntAct, MINT
JUP	Affinity Capture-MS, Affinity Capture-Western, Co-localization, anti tag coimmunoprecipitation, proximity ligation assay, tandem affinity purification	association, physical, physical association	11712088, 17510365, 25241761, 26496610, 9535896, (Europe PMC)	0.67	BioGRID, IntAct
KANK1	anti bait coimmunoprecipitation	physical association	16968744, (Europe PMC)	0.40	IntAct
KAT2A	Affinity Capture-Western, Reconstituted Complex	physical	16510874, 20937768, (Europe PMC)	NA	BioGRID
KAT2B	Affinity Capture-Western, Biochemical Activity, Reconstituted Complex	physical	18987336, (Europe PMC)	NA	BioGRID
KCTD1	Affinity Capture-Western, Phenotypic Suppression, Reconstituted Complex	genetic, physical	24736394, (Europe PMC)	NA	BioGRID
KDM1A	anti bait coimmunoprecipitation	association	25753001, (Europe PMC)	0.35	IntAct
KIAA1109	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
KLF5	Affinity Capture-Western	physical	19435907, (Europe PMC)	NA	BioGRID
KMT2A	Affinity Capture-MS, Reconstituted Complex	physical	16510874, 16510875, (Europe PMC)	NA	BioGRID
KMT2D	Reconstituted Complex	physical	16510874, 16510875, (Europe PMC)	NA	BioGRID
KSR2	anti tag coimmunoprecipitation	association	27086506, (Europe PMC)	0.35	IntAct
L3MBTL3	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
LAMP1	proximity-dependent biotin identification, pull down	association	29568061, (Europe PMC)	0.46	IntAct
LATS2	Affinity Capture-Western, Proximity Label-MS, Reconstituted Complex	physical	24255178, 24360964, (Europe PMC)	NA	BioGRID
LDHB	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
LEF1	Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, tandem affinity purification	association, direct interaction, physical, physical association	10890911, 10958684, 11751639, 11835406, 12077367, 12748295, 15525529, 15684397, 15728254, 15768032, 16204248, 16510874, 16510875, 17510365, 17517646, 18077326, 18296023, 20123964, 21743491, 8757136, 9419974, (Europe PMC)	0.86	BioGRID, IntAct
LEO1	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	16630820, (Europe PMC)	0.40	BioGRID, IntAct
LGALS9	Affinity Capture-MS	physical	17353931, (Europe PMC)	NA	BioGRID
LINC01194	Affinity Capture-Western	physical	14612521, (Europe PMC)	NA	BioGRID
LMNA	Affinity Capture-Western	physical	15355978, (Europe PMC)	NA	BioGRID
LMNB1	Affinity Capture-Western	physical	26912724, (Europe PMC)	NA	BioGRID
LRP2	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
LRP6	Affinity Capture-Western, anti tag coimmunoprecipitation	physical, physical association	16890161, (Europe PMC)	0.40	BioGRID, IntAct
MAGI1	Affinity Capture-Western, Reconstituted Complex, Two-hybrid	physical	10772923, (Europe PMC)	NA	BioGRID
MAGI2	Affinity Capture-Western	physical	11526121, (Europe PMC)	NA	BioGRID
MAP1LC3B	anti bait coimmunoprecipitation, pull down	direct interaction, physical association	23736261, (Europe PMC)	0.60	IntAct, MINT
MAP3K2	Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex	physical	26884171, (Europe PMC)	NA	BioGRID
MAPK6	anti tag coimmunoprecipitation	association	26972000, (Europe PMC)	0.35	IntAct
MAPK8	Affinity Capture-Western, Biochemical Activity	physical	19667122, (Europe PMC)	NA	BioGRID
MAPK9	Affinity Capture-Western, Biochemical Activity	physical	19667122, (Europe PMC)	NA	BioGRID
MAPRE1	Affinity Capture-MS	physical	26496610, (Europe PMC)	NA	BioGRID
MCM2	Affinity Capture-MS	physical	25963833, (Europe PMC)	NA	BioGRID
MCM7	anti bait coimmunoprecipitation	association	23764002, (Europe PMC)	0.35	IntAct
MEN1	Affinity Capture-Western, Reconstituted Complex	physical	16510874, 16510875, 19074834, (Europe PMC)	NA	BioGRID
MET	Affinity Capture-Western	physical	11254878, (Europe PMC)	NA	BioGRID
MLLT10	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down	association, direct interaction, physical association	20203130, 21103407, (Europe PMC)	0.66	IntAct
MOV10	Affinity Capture-RNA	physical	22658674, (Europe PMC)	NA	BioGRID
MSN	Co-fractionation	physical	26344197, (Europe PMC)	NA	BioGRID
MUC1	Affinity Capture-Western, Reconstituted Complex	physical	11152665, 11483589, 11877440, 12618757, 12750561, 9139698, 9819408, (Europe PMC)	NA	BioGRID
MYO7A	Affinity Capture-Western	physical	11080149, (Europe PMC)	NA	BioGRID
NCOA2	anti bait coimmunoprecipitation	physical association	12588987, (Europe PMC)	0.40	IntAct, MINT
NDRG1	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical, physical association	17220478, (Europe PMC)	0.50	BioGRID, IntAct
NDRG2	cosedimentation	colocalization	23068607, (Europe PMC)	0.35	IntAct, MINT
NEK2	Affinity Capture-Western, Biochemical Activity, Reconstituted Complex	physical	24501426, (Europe PMC)	NA	BioGRID
NFKB1	Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, proximity ligation assay, pull down	direct interaction, physical, physical association	15829968, 19358846, 25241761, (Europe PMC)	0.67	BioGRID, IntAct, MINT
NLK	Affinity Capture-Western	physical	12556497, (Europe PMC)	NA	BioGRID
NONO	Affinity Capture-MS, Affinity Capture-Western	physical	16230076, (Europe PMC)	NA	BioGRID
NOS3	anti bait coimmunoprecipitation, proximity ligation assay	physical association	25062958, (Europe PMC)	0.52	IntAct
NOTCH1	Affinity Capture-Western, Reconstituted Complex	physical	19000719, (Europe PMC)	NA	BioGRID
NR4A1	Affinity Capture-Western	physical	21986938, 26359353, (Europe PMC)	NA	BioGRID
NR5A1	Reconstituted Complex, Two-hybrid	physical	12554773, (Europe PMC)	NA	BioGRID
NR5A2	molecular sieving, pull down, x-ray crystallography	direct interaction, physical association	22187462, (Europe PMC)	0.65	IntAct
NSD2	Affinity Capture-Western	physical	22028615, (Europe PMC)	NA	BioGRID
NTRK1	Affinity Capture-MS	physical	25921289, (Europe PMC)	NA	BioGRID
NUDT5	Affinity Capture-MS, inference by socio-affinity scoring	physical, physical association	27173435, (Europe PMC)	0.27	BioGRID, IntAct
NUMB	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical association	24561623, (Europe PMC)	0.40, 0.50	IntAct
NUP153	Affinity Capture-Western	physical	22110128, (Europe PMC)	NA	BioGRID
NUP62	Affinity Capture-Western	physical	22110128, (Europe PMC)	NA	BioGRID
NUP98	Affinity Capture-Western	physical	22110128, (Europe PMC)	NA	BioGRID
NXF1	Affinity Capture-RNA	physical	22658674, (Europe PMC)	NA	BioGRID
OBSL1	Affinity Capture-MS	physical	24711643, (Europe PMC)	NA	BioGRID
PARD3	Co-localization	physical	25241761, (Europe PMC)	NA	BioGRID
PARD3	anti bait coimmunoprecipitation, proximity ligation assay	physical association	17057644, 25241761, (Europe PMC)	0.59	IntAct, MINT
PARP1	Affinity Capture-MS	physical	16230076, (Europe PMC)	NA	BioGRID
PARP2	protein array	adp ribosylation reaction	21812934, (Europe PMC)	0.44	IntAct, MINT
PBDC1	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
PECAM1	Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, proximity ligation assay	association, physical, physical association	10801826, 25241761, (Europe PMC)	0.56	BioGRID, IntAct
PHB2	Affinity Capture-MS	physical	17353931, (Europe PMC)	NA	BioGRID
PHB2	anti bait coimmunoprecipitation	physical association	17353931, (Europe PMC)	0.40	IntAct
PIK3R1	Co-localization, Reconstituted Complex, proximity ligation assay	physical, physical association	10477752, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
PIN1	Reconstituted Complex	physical	11533658, (Europe PMC)	NA	BioGRID
PITX2	Affinity Capture-Western, Co-localization, anti tag coimmunoprecipitation, proximity ligation assay	association, physical, physical association	12464179, 19174163, 25241761, (Europe PMC)	0.56	BioGRID, IntAct, MINT
PKD1	Affinity Capture-Western	physical	11113628, (Europe PMC)	NA	BioGRID
PKM	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down	physical, physical association	22056988, 27485204, (Europe PMC)	0.52	BioGRID, IntAct
PKP4	fluorescence microscopy	colocalization	12047349, (Europe PMC)	0.27	IntAct, MINT
PLEKHA7	anti bait coimmunoprecipitation	association	28877994, (Europe PMC)	0.35	IntAct
PLK1	Affinity Capture-MS, Affinity Capture-Western	physical	21610149, (Europe PMC)	NA	BioGRID
PML	Affinity Capture-Western, Reconstituted Complex	physical	12384561, 22155184, (Europe PMC)	NA	BioGRID
POU5F1	Affinity Capture-Western	physical	23539445, (Europe PMC)	NA	BioGRID
PPARG	Affinity Capture-Western	physical	15665104, 19495794, 24735796, (Europe PMC)	NA	BioGRID
PPM1A	anti bait coimmunoprecipitation	association	10644691, (Europe PMC)	0.35	IntAct, MINT
PRKCA	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	21949397, 21952047, (Europe PMC)	0.40	BioGRID, IntAct, MINT
PRKCG	Biochemical Activity	physical	25639486, (Europe PMC)	NA	BioGRID
PRKN	Affinity Capture-Western	physical	25877876, (Europe PMC)	NA	BioGRID
PROP1	Affinity Capture-Western, Reconstituted Complex	physical	16678101, (Europe PMC)	NA	BioGRID
PRPF38B	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
PRPF6	Affinity Capture-MS	physical	16230076, (Europe PMC)	NA	BioGRID
PSEN1	Affinity Capture-Western, Reconstituted Complex	physical	10341227, 16126725, 16306047, 17360711, 9738936, 9852041, (Europe PMC)	NA	BioGRID
PTBP3	anti bait coimmunoprecipitation	association	22575643, (Europe PMC)	0.35	IntAct, MINT
PTEN	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	20123964, 20372837, (Europe PMC)	0.40	BioGRID, IntAct
PTGS2	Affinity Capture-RNA, Protein-RNA	physical	22544606, (Europe PMC)	NA	BioGRID
PTH1R	fluorescence microscopy, proximity ligation assay, two hybrid	colocalization, physical association	23124878, (Europe PMC)	0.54	IntAct
PTK7	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid	physical association	21132015, (Europe PMC)	0.58	IntAct, MINT
PTN	Affinity Capture-Western	physical	10706604, (Europe PMC)	NA	BioGRID
PTPN1	Reconstituted Complex	physical	12377785, (Europe PMC)	NA	BioGRID
PTPN11	Affinity Capture-Western	physical	10681592, (Europe PMC)	NA	BioGRID
PTPN12	phosphatase assay	dephosphorylation reaction	19167335, (Europe PMC)	0.44	IntAct
PTPN13	Biochemical Activity	physical	10951583, (Europe PMC)	NA	BioGRID
PTPN14	Affinity Capture-MS, Affinity Capture-Western	physical	12808048, (Europe PMC)	NA	BioGRID
PTPRB	phosphatase assay	dephosphorylation reaction	19167335, (Europe PMC)	0.44	IntAct
PTPRC	phosphatase assay, pull down	dephosphorylation reaction, physical association	12370829, 19167335, (Europe PMC)	0.61	IntAct, MINT
PTPRF	Affinity Capture-Western, Reconstituted Complex	physical	11245482, 9245795, (Europe PMC)	NA	BioGRID
PTPRG	phosphatase assay	dephosphorylation reaction, physical association	19167335, 21112398, (Europe PMC)	0.61	IntAct, MINT
PTPRJ	Affinity Capture-Western, phosphatase assay, pull down	dephosphorylation reaction, physical, physical association	12370829, 19167335, (Europe PMC)	0.61	BioGRID, IntAct, MINT
PTPRK	Affinity Capture-Western, Reconstituted Complex	physical	8663237, (Europe PMC)	NA	BioGRID
PTPRO	phosphatase assay	dephosphorylation reaction	19167335, (Europe PMC)	0.44	IntAct
PTPRU	Affinity Capture-Western	physical	12501215, 16574648, 9054423, (Europe PMC)	NA	BioGRID
PTPRZ1	Affinity Capture-Western	physical	10706604, (Europe PMC)	NA	BioGRID
PXN	anti bait coimmunoprecipitation, pull down	direct interaction, physical association	22728435, (Europe PMC)	0.60	IntAct, MINT
PYGO2	Affinity Capture-Western	physical	24360964, (Europe PMC)	NA	BioGRID
RAB8B	Affinity Capture-Western	physical	12639940, (Europe PMC)	NA	BioGRID
RABAC1	cosedimentation	colocalization	23068607, (Europe PMC)	0.35	IntAct, MINT
RANBP2	Affinity Capture-Western	physical	22110128, (Europe PMC)	NA	BioGRID
RB1CC1	Affinity Capture-Western, Two-hybrid	physical	22751121, (Europe PMC)	NA	BioGRID
RBBP5	Affinity Capture-Western, Reconstituted Complex	physical	16510874, 16510875, 20937768, (Europe PMC)	NA	BioGRID
RBM39	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
RBMX	Affinity Capture-MS	physical	16230076, (Europe PMC)	NA	BioGRID
RBX1	enzymatic study	ubiquitination reaction	18805092, (Europe PMC)	0.44	IntAct
RELA	anti bait coimmunoprecipitation	physical association	23273993, 24072822, (Europe PMC)	0.59	IntAct
RNF14	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical	23449499, (Europe PMC)	0.35	BioGRID, IntAct, MINT
RNF220	Affinity Capture-Western	physical	25266658, (Europe PMC)	NA	BioGRID
RNF4	Reconstituted Complex	physical	27653698, (Europe PMC)	NA	BioGRID
RPL21	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
RPL41	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
RPLP2	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
RPSA	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
RUNX3	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, chromatin immunoprecipitation assay, pull down	association, physical association	18772112, (Europe PMC)	0.66	IntAct
RUVBL1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation	association, physical, physical association	16510874, 16510875, 18087039, 9843967, (Europe PMC)	0.50	BioGRID, IntAct
RUVBL2	Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex	physical	11080158, 15829968, 16699503, 20603076, (Europe PMC)	NA	BioGRID
RXRA	Affinity Capture-Western, Co-localization, proximity ligation assay	physical, physical association	12771132, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
RYK	Affinity Capture-MS	physical	21875946, (Europe PMC)	NA	BioGRID
SAPCD1	Affinity Capture-MS	physical	26186194, 28514442, (Europe PMC)	NA	BioGRID
SATB1	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid	direct interaction, physical, physical association	20126258, (Europe PMC)	0.66	BioGRID, IntAct
SCRIB	fluorescence microscopy, phage display	colocalization, physical association	24550280, (Europe PMC)	0.46	IntAct, MINT
SERBP1	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
SFN	Affinity Capture-Western	physical	26147002, (Europe PMC)	NA	BioGRID
SH3KBP1	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
SIAH1	Affinity Capture-Western, Biochemical Activity	physical	20181957, 24882689, 27871173, (Europe PMC)	NA	BioGRID
SIRT1	Affinity Capture-Western, anti bait coimmunoprecipitation	physical, physical association	20439735, (Europe PMC)	0.40	BioGRID, IntAct
SKP1	Affinity Capture-Western, Co-localization, Protein-peptide, enzymatic study, proximity ligation assay, x-ray crystallography	physical, physical association, ubiquitination reaction	11389839, 12820959, 18805092, 21466614, 25241761, 9990852, (Europe PMC)	0.71	BioGRID, IntAct
SLAMF7	Affinity Capture-MS	physical	28514442, (Europe PMC)	NA	BioGRID
SLC9A3R1	Affinity Capture-Western, Reconstituted Complex	physical	12830000, (Europe PMC)	NA	BioGRID
SLC9A3R2	Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification	association, physical, physical association	27173435, (Europe PMC)	0.51	BioGRID, IntAct
SMAD2	Affinity Capture-Western	physical	12000714, 20571128, (Europe PMC)	NA	BioGRID
SMAD3	Affinity Capture-Western	physical	12000714, 20571128, 21965288, 22241478, (Europe PMC)	NA	BioGRID
SMAD4	Affinity Capture-Western	physical	12000714, (Europe PMC)	NA	BioGRID
SMAD7	Affinity Capture-Western, Co-localization	physical	15684397, 18593713, (Europe PMC)	NA	BioGRID
SMARCA4	Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation	association, physical	11532957, 19571879, (Europe PMC)	0.35	BioGRID, IntAct
SMARCA5	Affinity Capture-MS, Reconstituted Complex	physical	16510874, 16510875, (Europe PMC)	NA	BioGRID
SMURF1	Affinity Capture-Western, Reconstituted Complex	physical	26015066, (Europe PMC)	NA	BioGRID
SNRPD1	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
SOX1	Affinity Capture-Western	physical	22767186, (Europe PMC)	NA	BioGRID
SOX17	anti bait coimmunoprecipitation	association, physical association	17875931, (Europe PMC)	0.50	IntAct
SOX2	Affinity Capture-MS, Affinity Capture-Western	physical	23539445, 23667531, (Europe PMC)	NA	BioGRID
SOX6	Affinity Capture-Western, Co-localization, Reconstituted Complex	physical	17412698, (Europe PMC)	NA	BioGRID
SP1	Affinity Capture-Western	physical	24798214, (Europe PMC)	NA	BioGRID
SRC	anti bait coimmunoprecipitation, protein kinase assay	phosphorylation reaction, physical association	22056988, (Europe PMC)	0.54	IntAct
STK39	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
STK4	tandem affinity purification	association	23386615, (Europe PMC)	0.35	IntAct
STRN3	Proximity Label-MS, proximity-dependent biotin identification	colocalization, physical	24255178, (Europe PMC)	0.35	BioGRID, IntAct
SUV39H1	Affinity Capture-Western	physical	21726809, (Europe PMC)	NA	BioGRID
TADA2A	Affinity Capture-Western	physical	18059173, (Europe PMC)	NA	BioGRID
TADA3	Affinity Capture-Western	physical	18059173, (Europe PMC)	NA	BioGRID
TAX1BP3	Co-crystal Structure	physical	18835279, (Europe PMC)	NA	BioGRID
TBL1X	Affinity Capture-Western, Co-localization, proximity ligation assay	physical, physical association	11389839, 18193033, 25241761, (Europe PMC)	0.40	BioGRID, IntAct
TBL1XR1	Affinity Capture-Western	physical	18193033, (Europe PMC)	NA	BioGRID
TBX5	anti tag coimmunoprecipitation, chromatin immunoprecipitation assay	association	23245941, (Europe PMC)	0.46	IntAct
TCF4	Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down	association, physical, physical association	11713476, 12657632, 12727872, 15060161, 15331612, 15525529, 15665104, 17072306, 17318191, 17412698, 17875931, 17909039, 17962194, 17983804, 18281465, 20126258, 21103407, 21743491, 22080605, 22699938, 23449499, 24532795, 24798214, 24876153, 25402006, 29361949, (Europe PMC)	0.94	BioGRID, IntAct, MINT
TCF7	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, tandem affinity purification	association, direct interaction, physical association	16442529, 17510365, 19358846, 25678599, (Europe PMC)	0.78	IntAct, MINT
TCF7L1	Co-crystal Structure, Protein-peptide	physical	11136974, 15327769, (Europe PMC)	NA	BioGRID
TCF7L2	Affinity Capture-Western, Co-crystal Structure, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, x-ray crystallography	association, direct interaction, physical, physical association	11713475, 11713476, 16230076, 16442529, 16569639, 16630820, 16724116, 17050667, 17283121, 17914096, 18772112, 19202075, 19304756, 19443654, 19816403, 20126258, 21670201, 22014570, 22056988, 22155184, 22304967, 26350900, 27902311, (Europe PMC)	0.97	BioGRID, IntAct, MINT
TERT	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	physical association	19571879, (Europe PMC)	0.52	IntAct
TES	Affinity Capture-MS	physical	28378594, (Europe PMC)	NA	BioGRID
TFAP2A	Affinity Capture-Western	physical	15331612, (Europe PMC)	NA	BioGRID
TGFBR2	Affinity Capture-Western	physical	12000714, (Europe PMC)	NA	BioGRID
TGIF1	fluorescence microscopy	colocalization	25873176, (Europe PMC)	0.27	IntAct
TLE1	Reconstituted Complex	physical	9751710, (Europe PMC)	NA	BioGRID
TMPO	anti bait coimmunoprecipitation	physical association	16858403, (Europe PMC)	0.40	IntAct, MINT
TNIK	anti bait coimmunoprecipitation, pull down	association, direct interaction	19816403, (Europe PMC)	0.52	IntAct, MINT
TNRC6B	display technology	physical association	20195357, (Europe PMC)	0.40	IntAct
TOB1	Affinity Capture-Western	physical	16890162, (Europe PMC)	NA	BioGRID
TOP2A	Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, fluorescence microscopy, two hybrid	association, colocalization, physical, physical association	16230076, 17983804, (Europe PMC)	0.57	BioGRID, IntAct
TP53BP2	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical association	25344754, (Europe PMC)	0.58	IntAct
TRAF4	Affinity Capture-Western	physical	24990246, (Europe PMC)	NA	BioGRID
TRIB2	fluorescence microscopy	colocalization	25311538, (Europe PMC)	0.27	IntAct, MINT
TRIM25	Affinity Capture-RNA	physical	29117863, (Europe PMC)	NA	BioGRID
TRIM33	Affinity Capture-Western, Biochemical Activity	physical	25639486, (Europe PMC)	NA	BioGRID
TRIM37	Affinity Capture-Western	physical	26395261, (Europe PMC)	NA	BioGRID
TRRAP	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex	physical	16510874, 16510875, 18347063, (Europe PMC)	NA	BioGRID
TUBA1A	Affinity Capture-MS	physical	15492215, (Europe PMC)	NA	BioGRID
UBA1	enzymatic study	ubiquitination reaction	18805092, (Europe PMC)	0.44	IntAct
UBE2B	Affinity Capture-Western, Biochemical Activity, Reconstituted Complex	physical	18339854, 22705350, (Europe PMC)	NA	BioGRID
UBE2D1	Reconstituted Complex	physical	18851830, (Europe PMC)	NA	BioGRID
UBE2D2	enzymatic study	ubiquitination reaction	18805092, (Europe PMC)	0.44	IntAct
UBE2R2	Biochemical Activity	physical	27044868, (Europe PMC)	NA	BioGRID
UBE3A	Affinity Capture-Western, Biochemical Activity	physical	27902311, (Europe PMC)	NA	BioGRID
UBR5	Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy	colocalization, physical, physical association	21118991, 28689657, (Europe PMC)	0.46	BioGRID, IntAct
UCHL1	Affinity Capture-Western	physical	19536331, (Europe PMC)	NA	BioGRID
UHRF2	Far Western, antibody array	physical, physical association	21952639, (Europe PMC)	0.40	BioGRID, IntAct
UNK	Affinity Capture-RNA	physical	25737280, (Europe PMC)	NA	BioGRID
USP15	Affinity Capture-Western	physical	26884171, (Europe PMC)	NA	BioGRID
USP4	Affinity Capture-Western	physical	26189775, (Europe PMC)	NA	BioGRID
USP7	Affinity Capture-Western, Biochemical Activity, Protein-peptide	physical	29045831, (Europe PMC)	NA	BioGRID
USP9X	Affinity Capture-Western, Co-fractionation, Reconstituted Complex	physical	10620020, 14742711, 27783990, (Europe PMC)	NA	BioGRID
VCL	Affinity Capture-Western	physical	22720799, 9405455, (Europe PMC)	NA	BioGRID
VEZT	Affinity Capture-Western	physical	11080149, (Europe PMC)	NA	BioGRID
VHL	anti bait coimmunoprecipitation	physical association	16983094, (Europe PMC)	0.40	IntAct
WBP2	Affinity Capture-Western	physical	27578003, (Europe PMC)	NA	BioGRID
WWTR1	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical association	22234184, 23245942, (Europe PMC)	0.64	IntAct, MINT
XPO1	Affinity Capture-MS	physical	26673895, (Europe PMC)	NA	BioGRID
YAP1	Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, inference by socio-affinity scoring, pull down	association, direct interaction, physical, physical association	21376238, 22234184, 23245941, 24976009, 27173435, (Europe PMC)	0.40, 0.88	BioGRID, IntAct, MINT
YES1	anti bait coimmunoprecipitation	association	23245941, (Europe PMC)	0.35	IntAct
YWHAZ	Affinity Capture-MS, Affinity Capture-Western, coimmunoprecipitation	association, physical	15492215, 17287208, 22912335, (Europe PMC)	0.35	BioGRID, IntAct, MINT
ZBTB33	Affinity Capture-Western, Reconstituted Complex	physical	21670201, (Europe PMC)	NA	BioGRID
ZFYVE9	Two-hybrid, two hybrid	physical, physical association	15231748, (Europe PMC)	0.37	BioGRID, IntAct, MINT
ZIC3	Reconstituted Complex, pull down	physical, physical association	25402006, (Europe PMC)	0.40	BioGRID, IntAct
ZMIZ1	Affinity Capture-MS	physical	26522984, (Europe PMC)	NA	BioGRID

Top

CTNNB1