Top PTPN2
Gene Name PTPN2 (QuickGO )Interactive visualization PTPN2 structures tutorial to explore the interctive visulaization)
Synonyms PTPN2, PTPT
Protein Name PTPN2
Alternative Name(s) Tyrosine-protein phosphatase non-receptor type 2;3.1.3.48;T-cell protein-tyrosine phosphatase;TCPTP;
EntrezGene ID 5771 (Comparitive Toxicogenomics)
UniProt AC (Human) P17706 (protein sequence )
Enzyme Class EC 3.1.3.48 (BRENDA Molecular Weight 48473 Dalton Protein Length 415 amino acids (AA) Genome Browsers NCBI | ENSG00000175354 (Ensembl) | UCSC Crosslinking annotations Query our ID-mapping tableOrthologues Quest For Orthologues (QFO) | GeneTree Classification Superfamily: Class I Cys-based PTPs --> Family: NR-PTP | Historic class: Class I Cys-based PTPs --> Classical PTPs --> Non-receptor type PTPs (NR-PTPs) | CATH ID: 3.90.190.10 | SCOP Fold: CC1 Phosphatase activity active | Catalytic signature motif: HCSAGIGR Phosphorylation Network Visualize
Localization (UniProt annotation) Isoform 1: Endoplasmic reticulum Endoplasmic reticulum-Golgiintermediate compartment Note=Targeted to the endoplasmic reticulum by its C-terminalhydrophobic region Isoform 2: Nucleus Cytoplasm Cellmembrane Note=Predominantly localizes to chromatin (Bysimilarity) Able to shuttle between the nucleus and the cytoplasmand to dephosphorylate plasma membrane receptors (PubMed:9488479)Recruited by activated ITGA1 at the plasma membrane Function (UniProt annotation) Non-receptor type tyrosine-specific phosphatase thatdephosphorylates receptor protein tyrosine kinases including INSR,EGFR, CSF1R, PDGFR Also dephosphorylates non-receptor proteintyrosine kinases like JAK1, JAK2, JAK3, Src family kinases, STAT1,STAT3 and STAT6 either in the nucleus or the cytoplasm Negativelyregulates numerous signaling pathways and biological processeslike hematopoiesis, inflammatory response, cell proliferation anddifferentiation, and glucose homeostasis Plays a multifaceted andimportant role in the development of the immune system Functionsin T-cell receptor signaling through dephosphorylation of FYN andLCK to control T-cells differentiation and activationDephosphorylates CSF1R, negatively regulating its downstreamsignaling and macrophage differentiation Negatively regulatescytokine (IL2/interleukin-2 and interferon)-mediated signalingthrough dephosphorylation of the cytoplasmic kinases JAK1, JAK3and their substrate STAT1, that propagate signaling downstream ofthe cytokine receptors Also regulates the IL6/interleukin-6 andIL4/interleukin-4 cytokine signaling through dephosphorylation ofSTAT3 and STAT6 respectively In addition to the immune system, itis involved in anchorage-dependent, negative regulation of EGF-stimulated cell growth Activated by the integrin ITGA1/ITGB1, itdephosphorylates EGFR and negatively regulates EGF signalingDephosphorylates PDGFRB and negatively regulates platelet-derivedgrowth factor receptor-beta signaling pathway and therefore cellproliferation Negatively regulates tumor necrosis factor-mediatedsignaling downstream via MAPK through SRC dephosphorylation Mayalso regulate the hepatocyte growth factor receptor signalingpathway through dephosphorylation of the hepatocyte growth factorreceptor MET Plays also an important role in glucose homeostasisFor instance, negatively regulates the insulin receptor signalingpathway through the dephosphorylation of INSR and controlgluconeogenesis and liver glucose production through negativeregulation of the IL6 signaling pathways May also bind DNA Catalytic Activity (UniProt annotation) Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate Protein Sequence MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYINASLVDIEEAQ
RSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQ
LENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPAFDHSPNKIMTEKYNGNRIGL
EEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKATTAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILV
GAFVGWTLFFQQNAL
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
GO:0000122 P:negative regulation of transcription by RNA polymerase II GO:0004725 F:protein tyrosine phosphatase activity GO:0004726 F:non-membrane spanning protein tyrosine phosphatase activity GO:0005178 F:integrin binding GO:0005634 C:nucleus GO:0005654 C:nucleoplasm GO:0005783 C:endoplasmic reticulum GO:0005793 C:endoplasmic reticulum-Golgi intermediate compartment GO:0005829 C:cytosol GO:0005886 C:plasma membrane GO:0008285 P:negative regulation of cell proliferation GO:0008286 P:insulin receptor signaling pathway GO:0010804 P:negative regulation of tumor necrosis factor-mediated signaling pathway GO:0010888 P:negative regulation of lipid storage GO:0019901 F:protein kinase binding GO:0019905 F:syntaxin binding GO:0030183 P:B cell differentiation GO:0030217 P:T cell differentiation GO:0030218 P:erythrocyte differentiation GO:0030971 F:receptor tyrosine kinase binding GO:0035335 P:peptidyl-tyrosine dephosphorylation GO:0042059 P:negative regulation of epidermal growth factor receptor signaling pathway GO:0042532 P:negative regulation of tyrosine phosphorylation of STAT protein GO:0042593 P:glucose homeostasis GO:0045650 P:negative regulation of macrophage differentiation GO:0045722 P:positive regulation of gluconeogenesis GO:0046627 P:negative regulation of insulin receptor signaling pathway GO:0050728 P:negative regulation of inflammatory response GO:0050860 P:negative regulation of T cell receptor signaling pathway GO:0050922 P:negative regulation of chemotaxis GO:0060334 P:regulation of interferon-gamma-mediated signaling pathway GO:0060336 P:negative regulation of interferon-gamma-mediated signaling pathway GO:0060339 P:negative regulation of type I interferon-mediated signaling pathway GO:0061099 P:negative regulation of protein tyrosine kinase activity GO:0070104 P:negative regulation of interleukin-6-mediated signaling pathway GO:0070373 P:negative regulation of ERK1 and ERK2 cascade GO:0071345 P:cellular response to cytokine stimulus GO:0097677 F:STAT family protein binding GO:1902202 P:regulation of hepatocyte growth factor receptor signaling pathway GO:1902206 P:negative regulation of interleukin-2-mediated signaling pathway GO:1902215 P:negative regulation of interleukin-4-mediated signaling pathway GO:1902227 P:negative regulation of macrophage colony-stimulating factor signaling pathway GO:1902233 P:negative regulation of positive thymic T cell selection GO:1902237 P:positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway GO:1903899 P:positive regulation of PERK-mediated unfolded protein response GO:2000587 P:negative regulation of platelet-derived growth factor receptor-beta signaling pathway
Download FASTA sequences of PTPN2-substrates in HumansSubstrate Gene Name Substrate UniProt_AC DephosphoSite and sequence (+/-5) Bioassay Type PubMed ID View in Europe PMC Reliability of the interaction INSR P06213 Tyr-1189_IYETDyYRKGG, Tyr-1190 _YETDYyRKGGK In vitro and in vivo 12612081 , 10734133 , Europe PMC STAT1 P42224 Tyr-701_PKGTGyIKTEL In vitro and in vivo 12138178 , 12923054 , 12171910 , Europe PMC EGFR P00533 NA In vitro and in vivo 9488479 , 10488121 , 11479308 , Europe PMC STAT5B P51692 NA In vitro and in vivo 11773439 , Europe PMC STAT5A P42229 NA In vitro and in vivo 11773439 , Europe PMC STAT6 P42226 NA In vitro and in vivo 17210636 , Europe PMC STAT3 P40763 NA In vitro and in vivo 12359225 , Europe PMC KDR P35968 Tyr-996_APEDLyKDFLT, Tyr-1054_LARDIyKDPDY, Tyr-1059_YKDPDyVRKGD, Tyr-1214_DPKFHyDNTAG In vitro and in vivo 18840653 , Europe PMC SRC P12931 Tyr-419 _IEDNEyTARQG In vitro and in vivo 15696169 , Europe PMC PDGFRB P09619 Tyr-771_IESSNyMAPYD, Tyr-1021 _EGDNDyIIPLP In vitro and in vivo 14966296 , Europe PMC SHC1 P29353 Tyr-239 in Isoform p52Shc _PPDHQyYNDFP In vivo 9488479 , Europe PMC JAK1 P23458 Tyr-1033_ETDKEyYTVKD, Tyr-1034 _TDKEYyTVKDD In vivo 11909529 , Europe PMC MET P08581 Tyr-1234_MYDKEyYSVHN, Tyr-1235_YDKEYySVHNK In vivo 18819921 , Europe PMC WASL O00401 Tyr-256_TSKVIyDFIEK In vitro 16293614 , Europe PMC JAK3 P52333 NA In vivo 11909529 , Europe PMC FKBP4 Q02790 NA In vivo 12552015 , Europe PMC CAV1 Q03135 Tyr-14_SEGHLyTVPIR In vitro 20940300 , Europe PMC
Pathway ID Pathway Name Pathway Description (KEGG) hsa04630 Jak-STAT signaling pathway The Janus kinase/signal transducers and activators of transcription (JAK/STAT) pathway is one of a handful of pleiotropic cascades used to transduce a multitude of signals for development and homeostasis in animals, from humans to flies. In mammals, the JAK/STAT pathway is the principal signaling mechanism for a wide array of cytokines and growth factors. Following the binding of cytokines to their cognate receptor, STATs are activated by members of the JAK family of tyrosine kinases. Once activated, they dimerize and translocate to the nucleus and modulate the expression of target genes. In addition to the activation of STATs, JAKs mediate the recruitment of other molecules such as the MAP kinases, PI3 kinase etc. These molecules process downstream signals via the Ras-Raf-MAP kinase and PI3 kinase pathways which results in the activation of additional transcription factors.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-6807004 Negative regulation of MET activity. Signaling by MET receptor is negatively regulated mainly by MET receptor dephosphorylation or MET receptor degradation. Protein tyrosine phosphatase PTPRJ dephosphorylates MET tyrosine residue Y1349, thus removing the docking site for the GAB1 adapter (Palka et al. 2003). Protein tyrosine phosphatases PTPN1 and PTPN2 dephosphorylate MET tyrosines Y1234 and Y1235 in the kinase activation loop, thus attenuating catalytic activity of MET (Sangwan et al. 2008). The E3 ubiquitin ligase CBL promotes ubiquitination of the activated MET receptor and subsequent MET degradation. CBL contains a RING finger domain that engages E2 protein ubiquitin ligases to mediate ubiquitination of MET, which may occur at the cell membrane or in the early endocytic compartment. Ubiquitinated MET is degraded in a late endosomal or lysosomal compartment in a proteasome-dependent manner. The involvement of proteasome in MET degradation seems to be indirect, through an effect on MET endocytic trafficking (Jeffers et al. 1997, Peschard et al. 2001, Hammond et al. 2001, Petrelli et al. 2002). LRIG1 promotes lysosome-dependent degradation of MET in the absence of HGF-mediated activation (Lee et al. 2014, Oh et al. 2014).MET-mediated activation of RAS signaling is inhibited by MET receptor binding to MUC20 (Higuchi et al. 2004) or RANBP10 (Wang et al. 2004) R-HSA-877312 Regulation of IFNG signaling. At least three different classes of negative regulators exist to control the extent of INFG stimulation and signaling. These include the feedback inhibitors belonging to protein family suppressors of cytokine signaling (SOCS), the Scr-homology 2 (SH2)-containing protein tyrosine phosphatases (SHPs), and the protein inhibitors of activated STATs (PIAS). The induction of these regulators seems to be able to stop further signal transduction by inhibiting various steps in IFNG cascade R-HSA-9008059 Interleukin-37 signaling. Interleukins (IL) are immunomodulatory proteins that elicit a wide array of responses in cells and tissues. Interleukin 37 (IL37), also known as IL 1F7, is a member of the IL 1 family (Sharma et al. 2008). Isoform b of IL37 (referred just as IL37) is synthesized as a precursor that requires processing (primarily by caspase 1) to attain full receptor agonist or antagonist function (Kumar et al. 2002). Both full length and processed IL37 can bind to the IL 18 binding protein (IL 18BP) and the Interleukin 18 receptor 1 (IL 18R1) (Shi et al. 2003). Upon binding to the IL18R1, IL37 recruits Single Ig IL 1 related receptor (SIGIRR) (Nold-Petry et al. 2015). The IL37:IL18R1 complex can activate phosphorylation of Signal transducer and activator of transcription 3 (STAT3), Tyrosine protein kinase Mer and Phosphatidylinositol 3,4,5 trisphosphate 3 phosphatase and dual specificity protein phosphatase PTEN and can also inhibit Nuclear factor NF kappa B p105 subunit (NFKB) (Nold-Petry et al. 2015). Processed IL37 can be secreted from the cytosol to the extracellular space or translocated into the nucleus (Bulau et al. 2014). Full length IL37 can also be secreted from the cytosol to the extracellular space (Bulau et al. 2014). Processed IL37 can bind with Mothers against decapentaplegic homolog 3 (SMAD3) in the cytosol and then translocate to the nucleus, where it facilitates transcription of Tyrosine protein phosphatase non receptors (PTPNs) (Nold et al. 2010, Luo et al. 2017). These events ultimately lead to suppression of cytokine production in several types of immune cells resulting in reduced inflammation
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ANP32B Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID ANP32C Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID ANP32E Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID APLP2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID APP Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID ASGR1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID B4GAT1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BAG3 Affinity Capture-Luminescence physical 23824909 , (Europe PMC )NA BioGRID BRIX1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID BYSL Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID C3AR1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID C5AR2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID C8orf33 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CALU Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CASC4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CASKIN1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID COL5A1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CSPG5 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID DIMT1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID DNAJC10 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID DUSP10 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID EGFR Affinity Capture-Western, genetic interference genetic interaction, physical 11514572 , 15592458 , (Europe PMC )0.17 BioGRID, IntAct, MINT EIF2S1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID EXOSC4 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID FTSJ3 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID G3BP1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID GADD45GIP1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID GAR1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID GHR Far Western, Reconstituted Complex, array technology, far western blotting, phosphatase assay dephosphorylation reaction, direct interaction, physical, physical association 12907755 , (Europe PMC )0.65 BioGRID, IntAct GOLIM4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID GRSF1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID GTPBP10 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID HADHA Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HARS Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HMGN5 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HSPD1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID KATNB1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID KPNA1 Affinity Capture-MS physical 27432908 , 27880917 , (Europe PMC )NA BioGRID KPNA5 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID KPNA6 Affinity Capture-MS physical 27432908 , 27880917 , (Europe PMC )NA BioGRID METTL13 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MRM3 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID NMNAT1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID NSUN5 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID NUP50 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID OCLN Biochemical Activity physical 26090670 , (Europe PMC )NA BioGRID PNO1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PSMC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 27880917 , (Europe PMC )0.35 BioGRID, IntAct PSMC2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMC3IP Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PSMC4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMC5 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMC6 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMD1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMD10 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMD13 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PSMD14 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PSMD2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMD4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMD6 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMD8 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PTPN20 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PTPN6 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RBM34 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RCL1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RPL3L Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RPP30 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID SETD7 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SLC39A4 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SLC39A5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SRC Affinity Capture-Western, Biochemical Activity physical 15696169 , (Europe PMC )NA BioGRID STAT1 Affinity Capture-Western physical 12171910 , 19171783 , (Europe PMC )NA BioGRID STAT3 Affinity Capture-Western physical 12359225 , (Europe PMC )NA BioGRID STAT6 Affinity Capture-Western, Biochemical Activity physical 17210636 , (Europe PMC )NA BioGRID TCTN2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TFB1M Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID TMEM17 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TMEM216 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TNFSF8 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRAF2 Affinity Capture-Western physical 15696169 , (Europe PMC )NA BioGRID TRMT61B Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID TXNDC5 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID UBC Reconstituted Complex physical 28190767 , (Europe PMC )NA BioGRID UCHL5 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct VARS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ZC3HAV1L Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CORO1C pull down association 28330616 , (Europe PMC )0.35 IntAct DBN1 pull down association 28330616 , (Europe PMC )0.35 IntAct EGFR Affinity Capture-Western, genetic interference genetic interaction, physical 11514572 , 15592458 , (Europe PMC )0.17 BioGRID, IntAct, MINT EIF5A pull down association 28330616 , (Europe PMC )0.35 IntAct GHR Far Western, Reconstituted Complex, array technology, far western blotting, phosphatase assay dephosphorylation reaction, direct interaction, physical, physical association 12907755 , (Europe PMC )0.65 BioGRID, IntAct GOLGB1 confocal microscopy colocalization 16595549 , (Europe PMC )0.27 IntAct INSR anti bait coimmunoprecipitation physical association 15192089 , (Europe PMC )0.40 IntAct, MINT ITGA1 anti bait coimmunoprecipitation, fluorescence microscopy colocalization, physical association 15592458 , (Europe PMC )0.46 IntAct, MINT LMAN1 confocal microscopy colocalization 16595549 , (Europe PMC )0.27 IntAct MYO1C pull down association 28330616 , (Europe PMC )0.35 IntAct PSMC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 27880917 , (Europe PMC )0.35 BioGRID, IntAct PSMD14 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PTPN1 pull down physical association 28330616 , (Europe PMC )0.40 IntAct SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT TCTN2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TMED10 anti tag coimmunoprecipitation, confocal microscopy, two hybrid colocalization, physical association 16595549 , (Europe PMC )0.54 IntAct TMED9 anti tag coimmunoprecipitation, confocal microscopy, two hybrid colocalization, physical association 16595549 , (Europe PMC )0.54 IntAct TMEM17 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TMEM216 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TMOD3 pull down association 28330616 , (Europe PMC )0.35 IntAct TPM4 pull down association 28330616 , (Europe PMC )0.35 IntAct UCHL5 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct WASL phosphatase assay dephosphorylation reaction 16293614 , (Europe PMC )0.44 IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source INSR anti bait coimmunoprecipitation physical association 15192089 , (Europe PMC )0.40 IntAct, MINT ITGA1 anti bait coimmunoprecipitation, fluorescence microscopy colocalization, physical association 15592458 , (Europe PMC )0.46 IntAct, MINT SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ANP32B Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID ANP32C Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID ANP32E Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID APLP2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID APP Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID ASGR1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID B4GAT1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BAG3 Affinity Capture-Luminescence physical 23824909 , (Europe PMC )NA BioGRID BRIX1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID BYSL Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID C3AR1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID C5AR2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID C8orf33 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CALU Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CASC4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CASKIN1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CDC42 phosphatase assay phosphorylation reaction 16293614 , (Europe PMC )0.44 IntAct COL5A1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CORO1C pull down association 28330616 , (Europe PMC )0.35 IntAct CSPG5 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID DBN1 pull down association 28330616 , (Europe PMC )0.35 IntAct DIMT1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID DNAJC10 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID DUSP10 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID EGFR Affinity Capture-Western, genetic interference genetic interaction, physical 11514572 , 15592458 , (Europe PMC )0.17 BioGRID, IntAct, MINT EIF2S1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID EIF5A pull down association 28330616 , (Europe PMC )0.35 IntAct EXOSC4 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID FTSJ3 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID G3BP1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID GADD45GIP1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID GAR1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID GHR Far Western, Reconstituted Complex, array technology, far western blotting, phosphatase assay dephosphorylation reaction, direct interaction, physical, physical association 12907755 , (Europe PMC )0.65 BioGRID, IntAct GOLGB1 confocal microscopy colocalization 16595549 , (Europe PMC )0.27 IntAct GOLIM4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID GRSF1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID GTPBP10 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID HADHA Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HARS Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HMGN5 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HSPD1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID INSR anti bait coimmunoprecipitation physical association 15192089 , (Europe PMC )0.40 IntAct, MINT ITGA1 anti bait coimmunoprecipitation, fluorescence microscopy colocalization, physical association 15592458 , (Europe PMC )0.46 IntAct, MINT KATNB1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID KPNA1 Affinity Capture-MS physical 27432908 , 27880917 , (Europe PMC )NA BioGRID KPNA5 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID KPNA6 Affinity Capture-MS physical 27432908 , 27880917 , (Europe PMC )NA BioGRID LMAN1 confocal microscopy colocalization 16595549 , (Europe PMC )0.27 IntAct METTL13 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MRM3 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID MYO1C pull down association 28330616 , (Europe PMC )0.35 IntAct NMNAT1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID NSUN5 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID NUP50 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID OCLN Biochemical Activity physical 26090670 , (Europe PMC )NA BioGRID PNO1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PSMC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 27880917 , (Europe PMC )0.35 BioGRID, IntAct PSMC2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMC3IP Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PSMC4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMC5 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMC6 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMD1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMD10 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMD13 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PSMD14 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PSMD2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMD4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMD6 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMD8 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PTPN1 pull down physical association 28330616 , (Europe PMC )0.40 IntAct PTPN20 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PTPN6 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RBM34 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RCL1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RPL3L Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RPP30 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID SETD7 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SLC39A4 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SLC39A5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SRC Affinity Capture-Western, Biochemical Activity physical 15696169 , (Europe PMC )NA BioGRID STAT1 Affinity Capture-Western physical 12171910 , 19171783 , (Europe PMC )NA BioGRID STAT3 Affinity Capture-Western physical 12359225 , (Europe PMC )NA BioGRID STAT6 Affinity Capture-Western, Biochemical Activity physical 17210636 , (Europe PMC )NA BioGRID TCTN2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TFB1M Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID TMED10 anti tag coimmunoprecipitation, confocal microscopy, two hybrid colocalization, physical association 16595549 , (Europe PMC )0.54 IntAct TMED9 anti tag coimmunoprecipitation, confocal microscopy, two hybrid colocalization, physical association 16595549 , (Europe PMC )0.54 IntAct TMEM17 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TMEM216 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TMOD3 pull down association 28330616 , (Europe PMC )0.35 IntAct TNFSF8 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TPM4 pull down association 28330616 , (Europe PMC )0.35 IntAct TRAF2 Affinity Capture-Western physical 15696169 , (Europe PMC )NA BioGRID TRMT61B Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID TXNDC5 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID UBC Reconstituted Complex physical 28190767 , (Europe PMC )NA BioGRID UCHL5 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct VARS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID WASL phosphatase assay dephosphorylation reaction 16293614 , (Europe PMC )0.44 IntAct ZC3HAV1L Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
CDK1 S304_LSPAFDHsPNKIMTE , in vitro, in vivo 15030318 , 18669648 , 18767875 , 19413330 , 19651622 , 20068231 ,(Europe PMC )HPRD, PhosphoSitePlus , CDK2 S304_LSPAFDHsPNKIMTE , in vitro, in vivo 15030318 , 18669648 , 18767875 , 19413330 , 19651622 , 20068231 ,(Europe PMC )HPRD, PhosphoSitePlus , CDK5 S304_LSPAFDHsPNKIMTE , in vitro, in vivo 15030318 , 18669648 , 18767875 , 19413330 , 19651622 , 20068231 ,(Europe PMC )HPRD, Unknown S298_ELSKEDLsPAFDHSP , S304_LSPAFDHsPNKIMTE , HTP, in vitro, in vivo 15030318 , 18669648 , 18767875 , 19413330 , 19651622 , 20068231 ,(Europe PMC )HPRD, PhosphoELM ,
Statistics
