- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PTPN12
Gene Name  | PTPN12 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PTPN12 | |
| Protein Name | PTPN12 |
|
| Alternative Name(s) |
Tyrosine-protein phosphatase non-receptor type 12;3.1.3.48;PTP-PEST;Protein-tyrosine phosphatase G1;PTPG1; | |
| EntrezGene ID | 5782 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q05209 (protein sequence) | |
| Enzyme Class | EC 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 88106 Dalton | |
| Protein Length | 780 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000127947 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class I Cys-based PTPs --> Family: NR-PTP | Historic class: Class I Cys-based PTPs --> Classical PTPs --> Non-receptor type PTPs (NR-PTPs) | CATH ID: 3.90.190.10 | SCOP Fold: CC1 | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Cell junction, focal adhesion Cellprojection, podosome Note=Partialtranslocation to focal adhesion sites may be mediated byinteraction with SORBS2 | |||
| Function (UniProt annotation) | |||
| Dephosphorylates a range of proteins, and therebyregulates cellular signaling cascades (PubMed:18559503)Dephosphorylates cellular tyrosine kinases, such as ERBB2 andPTK2B/PYK2, and thereby regulates signaling via ERBB2 andPTK2B/PYK2 (PubMed:17329398, PubMed:27134172) Selectivelydephosphorylates ERBB2 phosphorylated at 'Tyr-1112', 'Tyr-1196',and/or 'Tyr-1248' (PubMed:27134172) | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate | |||
| Protein Sequence | |||
| MEQVEILRKFIQRVQAMKSPDHNGEDNFARDFMRLRRLSTKYRTEKIYPTATGEKEENVKKNRYKDILPFDHSRVKLTLK TPSQDSDYINANFIKGVYGPKAYVATQGPLANTVIDFWRMIWEYNVVIIVMACREFEMGRKKCERYWPLYGEDPITFAPF KISCEDEQARTDYFIRTLLLEFQNESRRLYQFHYVNWPDHDVPSSFDSILDMISLMRKYQEHEDVPICIHCSAGCGRTGA ICAIDYTWNLLKAGKIPEEFNVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQLFEKQLQLYEIHGAQKIADGVNEINTEN MVSSIEPEKQDSPPPKPPRTRSCLVEGDAKEEILQPPEPHPVPPILTPSPPSAFPTVTTVWQDNDRYHPKPVLHMVSSEQ HSADLNRNYSKSTELPGKNESTIEQIDKKLERNLSFEIKKVPLQEGPKSFDGNTLLNRGHAIKIKSASPCIADKISKPQE LSSDLNVGDTSQNSCVDCSVTQSNKVSVTPPEESQNSDTPPRPDRLPLDEKGHVTWSFHGPENAIPIPDLSEGNSSDINY QTRKTVSLTPSPTTQVETPDLVDHDNTSPLFRTPLSFTNPLHSDDSDSDERNSDGAVTQNKTNISTASATVSAATSTESI STRKVLPMSIARHNIAGTTHSGAEKDVDVSEDSPPPLPERTPESFVLASEHNTPVRSEWSELQSQERSEQKKSEGLITSE NEKCDHPAGGIHYEMCIECPPTFSDKREQISENPTEATDIGFGNRCGKPKGPRDPPSEWT |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0002102 | C:podosome |
| GO:0004721 | F:phosphoprotein phosphatase activity |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0004726 | F:non-membrane spanning protein tyrosine phosphatase activity |
| GO:0005654 | C:nucleoplasm |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0005925 | C:focal adhesion |
| GO:0006470 | P:protein dephosphorylation |
| GO:0017124 | F:SH3 domain binding |
| GO:0035335 | P:peptidyl-tyrosine dephosphorylation |
| GO:0038128 | P:ERBB2 signaling pathway |
| GO:0042058 | P:regulation of epidermal growth factor receptor signaling pathway |
| GO:0042246 | P:tissue regeneration |
| GO:0042995 | C:cell projection |
| GO:0071345 | P:cellular response to cytokine stimulus |
| GO:0071364 | P:cellular response to epidermal growth factor stimulus |
| GO:1901185 | P:negative regulation of ERBB signaling pathway |
| GO:2000587 | P:negative regulation of platelet-derived growth factor receptor-beta signaling pathway |
Download FASTA sequences of PTPN12-substrates in Humans
| Substrate Gene Name | Substrate UniProt_AC | DephosphoSite and sequence (+/-5) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| BCAR1 | P56945 | NA | In vitro and in vivo | 9285683, 12714323, 9748319, 8887669, 9920935, | Europe PMC |  |
| PTK2 | Q05397 | Tyr-397 _SETDDyAEIID | In vitro and in vivo | 19595712, | Europe PMC | |
| PTK2B | Q14289 | Tyr-402_IESDIyAEIPD, Tyr-579_IEDEDyYKASV, Tyr-580_EDEDYyKASVT | In vitro and in vivo | 11337490, | Europe PMC | |
| PSTPIP1 | O43586 | Tyr-344 _RNELVyASIEV | In vivo | 11711533, | Europe PMC | |
| ABL1 | P00519 | NA | In vivo | 11163214, | Europe PMC | |
| SRC | P12931 | Tyr-424_IEDNEyTARQG | In vivo | 18482983, | Europe PMC | |
| WAS | P42768 | Tyr-291_TSKLIyDFIED | In vivo | 14707117, | Europe PMC | |
| EGFR | P00533 | Tyr-1148_1148 | in vivo | 21376233, | Europe PMC | |
| ERBB2 | P04626 | Tyr-1248_AENPEyLGLDV | in vivo | 21376233, | Europe PMC | |
[Feedback|Contribution]
[ Feedback|Contribution]
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-1250196 | SHC1 events in ERBB2 signaling. | All ERBB2 heterodimers, ERBB2:EGFR, ERBB2:ERBB3 and ERBB2:ERBB4, are able to activate RAF/MAP kinase cascade by recruiting SHC1 (Pinkas-Kramarski et al. 1996, Sepp-Lorenzino et al. 1996) to phosphorylated C-tail tyrosine residues in either EGFR (Y1148 and Y1173), ERBB2 (Y1196, Y1221, Y1222 and Y1248), ERBB3 (Y1328) or ERBB4 (Y1188 and Y1242 in JM-A CYT1 isoform, Y1178 and Y1232 in JM-B CYT1 isoform, Y1172 and Y1226 in JM-A CYT2 isoform). SHC1 recruitment is followed by phosphorylation (Segatto et al. 1993, Soler et al. 1994), and the phosphorylated SHC1 recruits GRB2:SOS1 complex (Xie et al. 1995), which leads to SOS1-mediated guanyl-nucleotide exchange on RAS (Xie et al. 1995) and downstream activation of RAF and MAP kinases |
| R-HSA-182971 | EGFR downregulation. | Regulation of receptor tyrosine kinase (RTK) activity is implicated in the control of almost all cellular functions. One of the best understood RTKs is epidermal growth factor receptor (EGFR). Growth factors can bind to EGFR and activate it to initiate signalling cascades within the cell. EGFRs can also be recruited to clathrin-coated pits which can be internalised into endocytic vesicles. From here, EGFRs can either be recycled back to the plasma membrane or directed to lysosomes for destruction.This provides a mechanism by which EGFR signalling is negatively regulated and controls the strength and duration of EGFR-induced signals. It also prevents EGFR hyperactivation as commonly seen in tumorigenesis.The proto-oncogene Cbl can negatively regulate EGFR signalling. The Cbl family of RING-type ubiquitin ligases are able to poly-ubiquitinate EGFR, an essential step in EGFR degradation. All Cbl proteins have a unique domain that recognises phosphorylated tyrosine residues on activated EGFRs. They also direct the ubiquitination and degradation of activated EGFRs by recruiting ubiquitin-conjugation enzymes. Cbl proteins function by specifically targeting activated EGFRs and mediating their down-regulation, thus providing a means by which signaling processes can be negatively regulated.Cbl also promotes receptor internalization via it's interaction with an adaptor protein, CIN85 (Cbl-interacting protein of 85kDa). CIN85 binds to Cbl via it's SH3 domain and is enhanced by the EGFR-induced tyrosine phosphorylation of Cbl. The proline-rich region of CIN85 interacts with endophilins which are regulatory components of clathrin-coated vesicles (CCVs). Endophilins bind to membranes and induce membrane curvature, in conjunction with other proteins involved in CCV formation. The rapid recruitment of endophilin to the activated receptor complex by CIN85 is the mechanism which controls receptor internalization |
| R-HSA-186797 | Signaling by PDGF. | Platelet-derived Growth Factor (PDGF) is a potent stimulator of growth and motility of connective tissue cells such as fibroblasts and smooth muscle cells as well as other cells such as capillary endothelial cells and neurons.The PDGF family of growth factors is composed of four different polypeptide chains encoded by four different genes. The classical PDGF chains, PDGF-A and PDGF-B, and more recently discovered PDGF-C and PDGF-D. The four PDGF chains assemble into disulphide-bonded dimers via homo- or heterodimerization, and five different dimeric isoforms have been described so far; PDGF-AA, PDGF-AB, PDGF-BB, PDGF-CC and PDGF-DD. It is notable that no heterodimers involving PDGF-C and PDGF-D chains have been described. PDGF exerts its effects by binding to, and activating, two protein tyrosine kinase (PTK) receptors, alpha and beta. These receptors dimerize and undergo autophosphorylation. The phosphorylation sites then attract downstream effectors to transduct the signal into the cell |
| R-HSA-8863795 | Downregulation of ERBB2 signaling. | Signaling by ERBB2 can be downregulated by ubiquitination and subsequent proteasome-dependent degradation of ERBB2 or activated ERBB2 heterodimers. In addition, protein tyrosine phosphatases that dephosphorylate tyrosine residues in the C-terminus of ERBB2 prevent the recruitment of adapter proteins involved in signal transduction, thus attenuating ERBB2 signaling.STUB1 (CHIP) and CUL5 are E3 ubiquitin ligases that can target non-activated ERBB2 for proteasome-dependent degradation (Xu et al. 2002, Ehrlich et al. 2009). RNF41 (NRDP1) is an E3 ubiquitin ligase that targets ERBB3 and activated heterodimers of ERBB2 and ERBB3 for proteasome-dependent degradation by ubiquitinating ERBB3 (Cao et al. 2007).Two protein tyrosine phosphatases of the PEST family, PTPN12 and PTPN18, dephosphorylate tyrosine residues in the C-terminus of ERBB2, thus preventing signal transduction to RAS and PI3K effectors (Sun et al. 2011, Wang et al. 2014) |
| R-HSA-9008059 | Interleukin-37 signaling. | Interleukins (IL) are immunomodulatory proteins that elicit a wide array of responses in cells and tissues. Interleukin 37 (IL37), also known as IL 1F7, is a member of the IL 1 family (Sharma et al. 2008). Isoform b of IL37 (referred just as IL37) is synthesized as a precursor that requires processing (primarily by caspase 1) to attain full receptor agonist or antagonist function (Kumar et al. 2002). Both full length and processed IL37 can bind to the IL 18 binding protein (IL 18BP) and the Interleukin 18 receptor 1 (IL 18R1) (Shi et al. 2003). Upon binding to the IL18R1, IL37 recruits Single Ig IL 1 related receptor (SIGIRR) (Nold-Petry et al. 2015). The IL37:IL18R1 complex can activate phosphorylation of Signal transducer and activator of transcription 3 (STAT3), Tyrosine protein kinase Mer and Phosphatidylinositol 3,4,5 trisphosphate 3 phosphatase and dual specificity protein phosphatase PTEN and can also inhibit Nuclear factor NF kappa B p105 subunit (NFKB) (Nold-Petry et al. 2015). Processed IL37 can be secreted from the cytosol to the extracellular space or translocated into the nucleus (Bulau et al. 2014). Full length IL37 can also be secreted from the cytosol to the extracellular space (Bulau et al. 2014). Processed IL37 can bind with Mothers against decapentaplegic homolog 3 (SMAD3) in the cytosol and then translocate to the nucleus, where it facilitates transcription of Tyrosine protein phosphatase non receptors (PTPNs) (Nold et al. 2010, Luo et al. 2017). These events ultimately lead to suppression of cytokine production in several types of immune cells resulting in reduced inflammation |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AIFM1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ANKS1A | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| APP | Reconstituted Complex | physical | 21244100, 21832049, (Europe PMC) | NA | BioGRID |
| ARHGAP10 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| ASAP1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| BAG6 | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| BCAR1 | Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex, affinity chromatography technology, pull down | direct interaction, physical, physical association | 12714323, 27880917, 8887669, 9285683, 9748319, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| CENPJ | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CGA | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CSH1 | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| CSH2 | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| CSK | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| DEK | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| DNPEP | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| EFS | Reconstituted Complex | physical | 9748319, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-Luminescence, PCA, Two-hybrid, bimolecular fluorescence complementation, ubiquitin reconstruction | physical, physical association | 20029029, 21376233, 24658140, 25402006, 28065597, (Europe PMC) | 0.67 | BioGRID, IntAct |
| EPN1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ERBB3 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| ERBB4 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| FGFR2 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| FGFR4 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| GANAB | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| GRB2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical | 21706016, 9135065, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GSN | Affinity Capture-Western | physical | 11577104, (Europe PMC) | NA | BioGRID |
| IFT20 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| IGF1R | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| JAK2 | Affinity Capture-Western | physical | 11731619, (Europe PMC) | NA | BioGRID |
| KDR | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| LMTK2 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| LPXN | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| NANOG | Affinity Capture-MS | physical | 26687479, (Europe PMC) | NA | BioGRID |
| NCK2 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| NEDD9 | Reconstituted Complex | physical | 9748319, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS, phosphatase assay | dephosphorylation reaction, physical | 19167335, 25921289, (Europe PMC) | 0.44 | BioGRID, IntAct |
| NUSAP1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PACSIN2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PLOD2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PSG9 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PSTPIP1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, imaging technique, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach | colocalization, physical, physical association | 11971877, 14707117, 9422760, , (Europe PMC) | 0.77 | BioGRID, IntAct, MINT |
| PSTPIP2 | Affinity Capture-MS, Proximity Label-MS | physical | 27880917, 28514442, (Europe PMC) | NA | BioGRID |
| PTK2B | Biochemical Activity | physical | 11337490, (Europe PMC) | NA | BioGRID |
| PTK7 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| PTPN6 | Affinity Capture-MS | physical | 27432908, 28514442, (Europe PMC) | NA | BioGRID |
| PXN | Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, Reconstituted Complex, Two-hybrid, phosphatase assay | dephosphorylation reaction, physical | 10400685, 10625692, 19167335, 27880917, 28514442, 9497381, (Europe PMC) | 0.44 | BioGRID, IntAct |
| RBM19 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ROR2 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| SHC1 | Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, Reconstituted Complex, Two-hybrid, tandem affinity purification, two hybrid array | association, physical, physical association | 19380743, 24189400, 24412244, 27880917, 28514442, 7929214, 8626541, (Europe PMC) | 0.66 | BioGRID, IntAct, MINT |
| SMAD5 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SORBS2 | Affinity Capture-Western, Reconstituted Complex | physical | 18559503, (Europe PMC) | NA | BioGRID |
| STX16 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TEX10 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TGFB1I1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 10092676, (Europe PMC) | NA | BioGRID |
| THAP2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TNS3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TRIM47 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| UGP2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| UTRN | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| VAPA | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| VASN | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| WASF1 | Affinity Capture-Western | physical | 18559503, (Europe PMC) | NA | BioGRID |
| ZFP2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| BAG6 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| BCAR1 | Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex, affinity chromatography technology, pull down | direct interaction, physical, physical association | 12714323, 27880917, 8887669, 9285683, 9748319, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| CCDC180 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| CDH2 | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| CENPJ | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CGA | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CTNNB1 | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| EGFR | Affinity Capture-Luminescence, PCA, Two-hybrid, bimolecular fluorescence complementation, ubiquitin reconstruction | physical, physical association | 20029029, 21376233, 24658140, 25402006, 28065597, (Europe PMC) | 0.67 | BioGRID, IntAct |
| ERBB2 | bimolecular fluorescence complementation, phosphatase assay | dephosphorylation reaction, physical association | 19167335, 21376233, (Europe PMC) | 0.59 | IntAct |
| FANCC | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| FRAT2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| GAB1 | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| GHR | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| GRB2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical | 21706016, 9135065, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GRIN2B | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| IFT20 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| INSR | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| KIT | anti tag coimmunoprecipitation | physical association | 12614164, (Europe PMC) | 0.40 | IntAct, MINT |
| LCK | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| MET | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| NSF | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| NTRK1 | Affinity Capture-MS, phosphatase assay | dephosphorylation reaction, physical | 19167335, 25921289, (Europe PMC) | 0.44 | BioGRID, IntAct |
| PDGFRB | affinity technology, bimolecular fluorescence complementation, phosphatase assay | dephosphorylation reaction, physical association | 12614164, 19167335, 21376233, (Europe PMC) | 0.70 | IntAct, MINT |
| PDPK1 | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| PPP3R2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| PSG9 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PSTPIP1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, imaging technique, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach | colocalization, physical, physical association | 11971877, 14707117, 9422760, , (Europe PMC) | 0.77 | BioGRID, IntAct, MINT |
| PXN | Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, Reconstituted Complex, Two-hybrid, phosphatase assay | dephosphorylation reaction, physical | 10400685, 10625692, 19167335, 27880917, 28514442, 9497381, (Europe PMC) | 0.44 | BioGRID, IntAct |
| RBM19 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SFRP4 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| SHC1 | Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, Reconstituted Complex, Two-hybrid, tandem affinity purification, two hybrid array | association, physical, physical association | 19380743, 24189400, 24412244, 27880917, 28514442, 7929214, 8626541, (Europe PMC) | 0.66 | BioGRID, IntAct, MINT |
| SMAD1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| SMAD5 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| STX16 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| STX17 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| TEC | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| TEK | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| TEX10 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| THAP2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TNK2 | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| UTRN | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| WAS | anti bait coimmunoprecipitation, phosphatase assay | dephosphorylation reaction, physical association | 14707117, 19167335, (Europe PMC) | 0.61 | IntAct, MINT |
| ZFP2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF510 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| BAG6 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| BCAR1 | Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex, affinity chromatography technology, pull down | direct interaction, physical, physical association | 12714323, 27880917, 8887669, 9285683, 9748319, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| CCDC180 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| CGA | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FANCC | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| FRAT2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| IFT20 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| KIT | anti tag coimmunoprecipitation | physical association | 12614164, (Europe PMC) | 0.40 | IntAct, MINT |
| PDGFRB | affinity technology, bimolecular fluorescence complementation, phosphatase assay | dephosphorylation reaction, physical association | 12614164, 19167335, 21376233, (Europe PMC) | 0.70 | IntAct, MINT |
| PPP3R2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| PSG9 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PSTPIP1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, imaging technique, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach | colocalization, physical, physical association | 11971877, 14707117, 9422760, , (Europe PMC) | 0.77 | BioGRID, IntAct, MINT |
| RBM19 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SFRP4 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| SHC1 | Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, Reconstituted Complex, Two-hybrid, tandem affinity purification, two hybrid array | association, physical, physical association | 19380743, 24189400, 24412244, 27880917, 28514442, 7929214, 8626541, (Europe PMC) | 0.66 | BioGRID, IntAct, MINT |
| SMAD1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| SMAD5 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| STX16 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| STX17 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| TEX10 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| THAP2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| UTRN | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| WAS | anti bait coimmunoprecipitation, phosphatase assay | dephosphorylation reaction, physical association | 14707117, 19167335, (Europe PMC) | 0.61 | IntAct, MINT |
| ZFP2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF510 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AIFM1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ANKS1A | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ANP32B | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| APP | Reconstituted Complex | physical | 21244100, 21832049, (Europe PMC) | NA | BioGRID |
| ARHGAP10 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| ASAP1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| BAG6 | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| BAG6 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| BCAR1 | Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex, affinity chromatography technology, pull down | direct interaction, physical, physical association | 12714323, 27880917, 8887669, 9285683, 9748319, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| CCDC180 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| CDH2 | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| CENPJ | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CGA | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CSH1 | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| CSH2 | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| CSK | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CTNNB1 | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| DEK | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| DNPEP | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| EFS | Reconstituted Complex | physical | 9748319, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-Luminescence, PCA, Two-hybrid, bimolecular fluorescence complementation, ubiquitin reconstruction | physical, physical association | 20029029, 21376233, 24658140, 25402006, 28065597, (Europe PMC) | 0.67 | BioGRID, IntAct |
| EPN1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ERBB2 | bimolecular fluorescence complementation, phosphatase assay | dephosphorylation reaction, physical association | 19167335, 21376233, (Europe PMC) | 0.59 | IntAct |
| ERBB3 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| ERBB4 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| FANCC | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| FGFR2 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| FGFR4 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| FRAT2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| GAB1 | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| GANAB | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| GHR | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| GRB2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical | 21706016, 9135065, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GRIN2B | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| GSN | Affinity Capture-Western | physical | 11577104, (Europe PMC) | NA | BioGRID |
| IFT20 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| IGF1R | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| INSR | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| JAK2 | Affinity Capture-Western | physical | 11731619, (Europe PMC) | NA | BioGRID |
| KDR | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| KIT | anti tag coimmunoprecipitation | physical association | 12614164, (Europe PMC) | 0.40 | IntAct, MINT |
| LCK | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| LMTK2 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| LPXN | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MET | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| NANOG | Affinity Capture-MS | physical | 26687479, (Europe PMC) | NA | BioGRID |
| NCK2 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| NEDD9 | Reconstituted Complex | physical | 9748319, (Europe PMC) | NA | BioGRID |
| NSF | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| NTRK1 | Affinity Capture-MS, phosphatase assay | dephosphorylation reaction, physical | 19167335, 25921289, (Europe PMC) | 0.44 | BioGRID, IntAct |
| NUSAP1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PACSIN2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PDGFRB | affinity technology, bimolecular fluorescence complementation, phosphatase assay | dephosphorylation reaction, physical association | 12614164, 19167335, 21376233, (Europe PMC) | 0.70 | IntAct, MINT |
| PDPK1 | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| PLOD2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PPP3R2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| PSG9 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PSTPIP1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, imaging technique, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach | colocalization, physical, physical association | 11971877, 14707117, 9422760, , (Europe PMC) | 0.77 | BioGRID, IntAct, MINT |
| PSTPIP2 | Affinity Capture-MS, Proximity Label-MS | physical | 27880917, 28514442, (Europe PMC) | NA | BioGRID |
| PTK2B | Biochemical Activity | physical | 11337490, (Europe PMC) | NA | BioGRID |
| PTK7 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| PTPN6 | Affinity Capture-MS | physical | 27432908, 28514442, (Europe PMC) | NA | BioGRID |
| PXN | Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, Reconstituted Complex, Two-hybrid, phosphatase assay | dephosphorylation reaction, physical | 10400685, 10625692, 19167335, 27880917, 28514442, 9497381, (Europe PMC) | 0.44 | BioGRID, IntAct |
| RBM19 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ROR2 | Two-hybrid | physical | 28065597, (Europe PMC) | NA | BioGRID |
| SFRP4 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| SHC1 | Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, Reconstituted Complex, Two-hybrid, tandem affinity purification, two hybrid array | association, physical, physical association | 19380743, 24189400, 24412244, 27880917, 28514442, 7929214, 8626541, (Europe PMC) | 0.66 | BioGRID, IntAct, MINT |
| SMAD1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| SMAD5 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SORBS2 | Affinity Capture-Western, Reconstituted Complex | physical | 18559503, (Europe PMC) | NA | BioGRID |
| STX16 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| STX17 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| TEC | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| TEK | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| TEX10 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TGFB1I1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 10092676, (Europe PMC) | NA | BioGRID |
| THAP2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TNK2 | phosphatase assay | dephosphorylation reaction | 19167335, (Europe PMC) | 0.44 | IntAct |
| TNS3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TRIM47 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| UGP2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| UTRN | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| VAPA | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| VASN | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| WAS | anti bait coimmunoprecipitation, phosphatase assay | dephosphorylation reaction, physical association | 14707117, 19167335, (Europe PMC) | 0.61 | IntAct, MINT |
| WASF1 | Affinity Capture-Western | physical | 18559503, (Europe PMC) | NA | BioGRID |
| ZFP2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF510 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |