Top PSTPIP1
Localization (UniProt annotation) Cytoplasm Cellmembrane Cell projection, uropodium Cytoplasm, cytoskeletonCytoplasm, perinuclear region Cellprojection, lamellipodium Cleavagefurrow Note=Mainly cytoplasmic inT-cells (PubMed:9857189) Colocalizes in cluster with CD2 near thecell surface membrane in activated T-cells (PubMed:9857189) Inmonocytes, forms a branched filamentous network in the cytoplasm(PubMed:19584923) In transfected cells, forms relatively straightfilaments radiating out from the nucleus (PubMed:19584923)Filament formation requires an intact tubulin cytoskeleton(PubMed:19584923) In migrating neutrophils, colocalizes withPIP5K1C and DNM2 to the trailing edge of the uropod in a actin-dependent manner (PubMed:18480402) Colocalized with PTPN12 in thecytoplasm and the perinuclear region During interphase,colocalizes with F-actin in the cortical cytoskeleton,lamellipodia, and stress fibers In dividing cells, colocalizeswith the F-actin rich cytokinetic cleavage furrow Colocalizedwith CD2AP and WAS in the actin cytoskeleton within the cytoplasmColocalized with CD2, CD2AP and WAS at the site of T-cell:APCcontact (By similarity) Function (UniProt annotation) Involved in regulation of the actin cytoskeleton Mayregulate WAS actin-bundling activity Bridges the interactionbetween ABL1 and PTPN18 leading to ABL1 dephosphorylation Mayplay a role as a scaffold protein between PTPN12 and WAS and allowPTPN12 to dephosphorylate WAS Has the potential to physicallycouple CD2 and CD2AP to WAS Acts downstream of CD2 and CD2AP torecruit WAS to the T-cell:APC contact site so as to promote theactin polymerization required for synapse induction during T-cellactivation (By similarity) Down-regulates CD2-stimulated adhesionthrough the coupling of PTPN12 to CD2 Also has a role in innateimmunity and the inflammatory response Recruited to inflammasomesby MEFV Induces formation of pyroptosomes, large supramolecularstructures composed of oligomerized PYCARD dimers which form priorto inflammatory apoptosis Binding to MEFV allows MEFV to bind toPYCARD and facilitates pyroptosome formation Regulatesendocytosis and cell migration in neutrophils Catalytic Activity (UniProt annotation) N/A Protein Sequence MMPQLQFKDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDMEELLRQRAQAEERYGKELVQIARKAGGQTEINSLRASFDSL
KQQMENVGSSHIQLALTLREELRSLEEFRERQKEQRKKYEAVMDRVQKSKLSLYKKAMESKKTYEQKCRDADDAEQAFER
ISANGHQKQVEKSQNKARQCKDSATEAERVYRQSIAQLEKVRAEWEQEHRTTCEAFQLQEFDRLTILRNALWVHSNQLSM
QCVKDDELYEEVRLTLEGCSIDADIDSFIQAKSTGTEPPAPVPYQNYYDREVTPLTSSPGIQPSCGMIKRFSGLLHGSPK
TTSLAASAASTETLTPTPERNEGVYTAIAVQEIQGNPASPAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVE
RNGQRGFVPGSYLEKL
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
PSTPIP1 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa04621 NOD-like receptor signaling pathway Specific families of pattern recognition receptors are responsible for detecting various pathogens and generating innate immune responses. The intracellular NOD-like receptor (NLR) family contains more than 20 members in mammals and plays a pivotal role in the recognition of intracellular ligands. NOD1 and NOD2, two prototypic NLRs, sense the cytosolic presence of the bacterial peptidoglycan fragments that escaped from endosomal compartments, driving the activation of NF-{kappa}B and MAPK, cytokine production and apoptosis. On the other hand, a different set of NLRs induces caspase-1 activation through the assembly of multiprotein complexes called inflammasomes. The activated of caspase-1 regulates maturation of the pro-inflammatory cytokines IL-1B, IL-18 and drives pyroptosis.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-844456 The NLRP3 inflammasome. The NLRP3 (Cryopyrin) inflammasome is currently the best characterized. It consists of NLRP3, ASC (PYCARD) and procaspase-1; CARD8 (Cardinal) is also suggested to be a component. It is activated by a number of pathogens and bacterial toxins as well as diverse PAMPs, danger-associated molecular patterns (DAMPS) such as hyaluronan and uric acid, and exogenous irritants such as silica and asbestos (see Table S1 Schroder & Tschopp, 2010). Mutations in NLRP3 which lead to constitutive activation are linked to the human diseases Muckle-Wells syndrome, familial cold autoinflammatory syndrome and NOMID (Ting et al. 2006), characterized by skin rashes and other symptoms associated with generalized inflammation. The cause of these symptoms is uncontrolled IL-1 beta production.\nMultiple studies have shown that activation of the NLRP3 inflammasome by particulate activators (e.g. Hornung et al. 2008) requires phagocytosis, but this is not required for the response to ATP, which is mediated by the P2X7 receptor (Kahlenberg & Dubyak, 2004) and appears to involve the pannexin membrane channel (Pellegrin & Suprenenant 2006). Direct binding of activators to NLRP3 has not been demonstrated and the exact process of activation is unclear, though it is speculated to involve changes in conformation that free the NACHT domain for oligomerization (Inohara & Nunez 2001, 2003)
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTB Affinity Capture-MS physical 19041431 , (Europe PMC )NA BioGRID ATIC Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct BUB3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct BZW1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct BZW2 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct CARS Affinity Capture-MS physical 19041431 , (Europe PMC )NA BioGRID CD2 Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid direct interaction, physical, physical association 11971877 , 9857189 , (Europe PMC )0.74 BioGRID, IntAct, MINT DDX21 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct DNM2 Affinity Capture-MS, Reconstituted Complex physical 16418535 , 19041431 , (Europe PMC )NA BioGRID FAM90A1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct FBXL18 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID FDFT1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HSPA1A Affinity Capture-MS physical 19041431 , (Europe PMC )NA BioGRID KHDRBS1 Protein-peptide physical 22745667 , (Europe PMC )NA BioGRID KMT5C Affinity Capture-RNA physical 26904956 , (Europe PMC )NA BioGRID LSM4 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct MED28 Affinity Capture-Western, peptide array physical, physical association 16964398 , (Europe PMC )0.40 BioGRID, IntAct, MINT MEFV Affinity Capture-Western, anti bait coimmunoprecipitation, pull down association, physical, physical association 17964261 , 26025129 , (Europe PMC )0.58 BioGRID, IntAct MVP Two-hybrid physical 24722188 , (Europe PMC )NA BioGRID PCDHB14 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct PRPF31 Two-hybrid, two hybrid array, two hybrid bait and prey pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 25910212 , (Europe PMC )0.79 BioGRID, IntAct PTPN12 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, imaging technique, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach colocalization, physical, physical association 11971877 , 14707117 , 9422760 , (Europe PMC )0.77 BioGRID, IntAct, MINT PTPN18 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, pull down direct interaction, physical, physical association 9265651 , 9422760 , (Europe PMC )0.60 BioGRID, IntAct, MINT PYCARD Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 24407287 , (Europe PMC )0.35 BioGRID, IntAct RPL18A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL21 Affinity Capture-MS physical 17353931 , (Europe PMC )NA BioGRID RPL23A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL26 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL29 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL3 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL31 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL32 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL34 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL35 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL35A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL36 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL36A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL37A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RTP5 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct RUVBL1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct SDCBP Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SH2D4A Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SHBG Two-hybrid physical 15862967 , (Europe PMC )NA BioGRID SPG7 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID TRAF3IP3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct TUBB Affinity Capture-MS physical 19041431 , (Europe PMC )NA BioGRID TULP3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct UBE2W Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.67 BioGRID, IntAct, MINT WAS Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, imaging technique colocalization, physical, physical association 14707117 , 19041431 , 9488710 , (Europe PMC )0.46 BioGRID, IntAct, MINT WASL Reconstituted Complex physical 16418535 , (Europe PMC )NA BioGRID WIPF1 Affinity Capture-MS physical 19041431 , (Europe PMC )NA BioGRID ZNF175 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AKAP9 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ANAPC2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ASAP1 enzyme linked immunosorbent assay direct interaction 16636290 , (Europe PMC )0.44 IntAct, MINT ATIC Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct AXIN1 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 26871637 , (Europe PMC )0.56 IntAct BUB3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct BZW1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct BZW2 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct CD2 Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid direct interaction, physical, physical association 11971877 , 9857189 , (Europe PMC )0.74 BioGRID, IntAct, MINT DDX21 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct DSP anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058344 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058563 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1059132 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1059180 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1059258 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1059291 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct FAM90A1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct FASLG anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, phage display, pull down physical association 16318909 , 19807924 , (Europe PMC )0.70 IntAct, MINT FDFT1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct GNL3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct KIF14 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct KMT2B anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct LSM4 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct MED28 Affinity Capture-Western, peptide array physical, physical association 16964398 , (Europe PMC )0.40 BioGRID, IntAct, MINT MEFV Affinity Capture-Western, anti bait coimmunoprecipitation, pull down association, physical, physical association 17964261 , 26025129 , (Europe PMC )0.58 BioGRID, IntAct MYH13 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PCDHB14 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct PRPF31 Two-hybrid, two hybrid array, two hybrid bait and prey pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 25910212 , (Europe PMC )0.79 BioGRID, IntAct PSTPIP1 anti tag coimmunoprecipitation, cross-linking study, molecular sieving physical association 17964261 , (Europe PMC )0.59 IntAct PTPN1 coimmunoprecipitation physical association 9857189 , (Europe PMC )0.40 IntAct, MINT PTPN12 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, imaging technique, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach colocalization, physical, physical association 11971877 , 14707117 , 9422760 , (Europe PMC )0.77 BioGRID, IntAct, MINT PTPN18 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, pull down direct interaction, physical, physical association 9265651 , 9422760 , (Europe PMC )0.60 BioGRID, IntAct, MINT PTPN22 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down physical association 25040622 , (Europe PMC )0.59 IntAct, MINT PYCARD Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 24407287 , (Europe PMC )0.35 BioGRID, IntAct RPL18A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL23A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL26 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL28 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct RPL29 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL3 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL31 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL32 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL34 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL35 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL35A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL36 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL36A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL37A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RTP5 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct RUVBL1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RXRB two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 26871637 , (Europe PMC )0.56 IntAct SCG5 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SDCBP Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SGK494 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SH2D4A Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SPG7 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 25416956 , (Europe PMC )0.56 IntAct SUCO anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TAF1L anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TRAF3IP3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct TULP3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct UBE2W Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.67 BioGRID, IntAct, MINT WAS Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, imaging technique colocalization, physical, physical association 14707117 , 19041431 , 9488710 , (Europe PMC )0.46 BioGRID, IntAct, MINT ZNF175 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CD2 Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid direct interaction, physical, physical association 11971877 , 9857189 , (Europe PMC )0.74 BioGRID, IntAct, MINT FASLG anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, phage display, pull down physical association 16318909 , 19807924 , (Europe PMC )0.70 IntAct, MINT MED28 Affinity Capture-Western, peptide array physical, physical association 16964398 , (Europe PMC )0.40 BioGRID, IntAct, MINT PTPN1 coimmunoprecipitation physical association 9857189 , (Europe PMC )0.40 IntAct, MINT PTPN12 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, imaging technique, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach colocalization, physical, physical association 11971877 , 14707117 , 9422760 , (Europe PMC )0.77 BioGRID, IntAct, MINT PTPN18 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, pull down direct interaction, physical, physical association 9265651 , 9422760 , (Europe PMC )0.60 BioGRID, IntAct, MINT PTPN22 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down physical association 25040622 , (Europe PMC )0.59 IntAct, MINT UBE2W Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.67 BioGRID, IntAct, MINT WAS Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, imaging technique colocalization, physical, physical association 14707117 , 19041431 , 9488710 , (Europe PMC )0.46 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABL1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11163214 , (Europe PMC )NA BioGRID ACTB Affinity Capture-MS physical 19041431 , (Europe PMC )NA BioGRID AKAP9 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ANAPC2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ASAP1 enzyme linked immunosorbent assay direct interaction 16636290 , (Europe PMC )0.44 IntAct, MINT ATIC Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct AXIN1 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 26871637 , (Europe PMC )0.56 IntAct BUB3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct BZW1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct BZW2 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct CARS Affinity Capture-MS physical 19041431 , (Europe PMC )NA BioGRID CD2 Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid direct interaction, physical, physical association 11971877 , 9857189 , (Europe PMC )0.74 BioGRID, IntAct, MINT DDX21 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct DNM2 Affinity Capture-MS, Reconstituted Complex physical 16418535 , 19041431 , (Europe PMC )NA BioGRID DSP anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058344 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058563 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1059132 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1059180 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1059258 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1059291 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct FAM90A1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct FASLG anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, phage display, pull down physical association 16318909 , 19807924 , (Europe PMC )0.70 IntAct, MINT FBXL18 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID FDFT1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct GNL3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct HSPA1A Affinity Capture-MS physical 19041431 , (Europe PMC )NA BioGRID KHDRBS1 Protein-peptide physical 22745667 , (Europe PMC )NA BioGRID KIF14 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct KMT2B anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct KMT5C Affinity Capture-RNA physical 26904956 , (Europe PMC )NA BioGRID LSM4 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct MED28 Affinity Capture-Western, peptide array physical, physical association 16964398 , (Europe PMC )0.40 BioGRID, IntAct, MINT MEFV Affinity Capture-Western, anti bait coimmunoprecipitation, pull down association, physical, physical association 17964261 , 26025129 , (Europe PMC )0.58 BioGRID, IntAct MVP Two-hybrid physical 24722188 , (Europe PMC )NA BioGRID MYH13 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PCDHB14 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct PRPF31 Two-hybrid, two hybrid array, two hybrid bait and prey pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 25910212 , (Europe PMC )0.79 BioGRID, IntAct PSTPIP1 anti tag coimmunoprecipitation, cross-linking study, molecular sieving physical association 17964261 , (Europe PMC )0.59 IntAct PTPN1 coimmunoprecipitation physical association 9857189 , (Europe PMC )0.40 IntAct, MINT PTPN12 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, imaging technique, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach colocalization, physical, physical association 11971877 , 14707117 , 9422760 , (Europe PMC )0.77 BioGRID, IntAct, MINT PTPN18 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, pull down direct interaction, physical, physical association 9265651 , 9422760 , (Europe PMC )0.60 BioGRID, IntAct, MINT PTPN22 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down physical association 25040622 , (Europe PMC )0.59 IntAct, MINT PYCARD Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 24407287 , (Europe PMC )0.35 BioGRID, IntAct RPL18A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL21 Affinity Capture-MS physical 17353931 , (Europe PMC )NA BioGRID RPL23A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL26 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL28 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct RPL29 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL3 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL31 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL32 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL34 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL35 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL35A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL36 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL36A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RPL37A Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RTP5 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct RUVBL1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RXRB two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 26871637 , (Europe PMC )0.56 IntAct SCG5 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SDCBP Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SGK494 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SH2D4A Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SHBG Two-hybrid physical 15862967 , (Europe PMC )NA BioGRID SPG7 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID SPG7 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 25416956 , (Europe PMC )0.56 IntAct SUCO anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TAF1L anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TRAF3IP3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct TUBB Affinity Capture-MS physical 19041431 , (Europe PMC )NA BioGRID TULP3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct UBE2W Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.67 BioGRID, IntAct, MINT WAS Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, imaging technique colocalization, physical, physical association 14707117 , 19041431 , 9488710 , (Europe PMC )0.46 BioGRID, IntAct, MINT WASL Reconstituted Complex physical 16418535 , (Europe PMC )NA BioGRID WIPF1 Affinity Capture-MS physical 19041431 , (Europe PMC )NA BioGRID ZNF175 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association
Statistics
