- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
RBL1
Gene Name  | RBL1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 1H28 |
| Synonyms | RBL1 | |
| Protein Name | RBL1 | |
| Alternative Name(s) | Retinoblastoma-like protein 1;107 kDa retinoblastoma-associated protein;p107;pRb1; | |
| Protein Family | Belongs to the retinoblastoma protein (RB) family | |
| EntrezGene ID | 5933 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P28749 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 120847 Dalton | |
| Protein Length | 1068 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000080839 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG1010 | eggNOG - ENOG410XQF7 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Nucleus | |||
| Function (UniProt annotation) | |||
| Key regulator of entry into cell division Directlyinvolved in heterochromatin formation by maintaining overallchromatin structure and, in particular, that of constitutiveheterochromatin by stabilizing histone methylation Recruits andtargets histone methyltransferases KMT5B and KMT5C, leading toepigenetic transcriptional repression Controls histone H4 'Lys-20' trimethylation Probably acts as a transcription repressor byrecruiting chromatin-modifying enzymes to promoters Potentinhibitor of E2F-mediated trans-activation Forms a complex withadenovirus E1A and with SV40 large T antigen May bind andmodulate functionally certain cellular proteins with which T andE1A compete for pocket binding May act as a tumor suppressor | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MFEDKPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVTHWLACSLYVACRKSIIPTVGKGIM EGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRERIERLERNFEVSTVIFKKYEPIFLDIFQNPYEEPPKLPRS RKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRQDLLNPSFKGLPSDFHTADFT ASEEPPCIIAVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLSSFTDNSKAVNKEYEEYVLTVGDFDERI FLGADAEEEIGTPRKFTRDTPLGKLTAQANVEYNLQQHFEKKRSFAPSTPLTGRRYLREKEAVITPVASATQSVSRLQSI VAGLKNAPSDQLINIFESCVRNPVENIMKILKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQET RRLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVVIRSEEGLSRDMVKHLNSIEE QILESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLS PISVHERYSSPTAGSAKRRLFGEDPPKEMLMDKIITEGTKLKIAPSSSITAENVSILPGQTLLTMATAPVTGTTGHKVTI PLHGVANDAGEITLIPLSMNTNQESKVKSPVSLTAHSLIGASPKQTNLTKAQEVHSTGINRPKRTGSLALFYRKVYHLAS VRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLDQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYR SVLLKSIPREVVAYNKNINDDFEMIDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDA PPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRSALLYKFNGSPSKSLKDINNMIRQGEQRTKKRVIAIDSDAE SPAKRVCQENDDVLLKRLQDVVSERANH | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| DOC_CYCLIN_1 | 658-RRLF-661 | Cyclin recognition site | [RK].L.{0,1}[FYLIVMP] |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000122 | P:negative regulation of transcription by RNA polymerase II |
| GO:0005654 | C:nucleoplasm |
| GO:0005667 | C:transcription factor complex |
| GO:0006325 | P:chromatin organization |
| GO:0006351 | P:transcription |
| GO:0007049 | DNA-templated |
| GO:0008134 | P:cell cycle |
| GO:0010629 | F:transcription factor binding |
| GO:0016032 | P:negative regulation of gene expression |
| GO:0043550 | P:viral process |
| GO:0045944 | P:regulation of lipid kinase activity |
| GO:0051726 | P:positive regulation of transcription by RNA polymerase II |
| GO:1990841 | P:regulation of cell cycle |
| GO:2000773 | F:promoter-specific chromatin binding |
RBL1 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in RBL1 (P28749) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PPP2CA | P67775 | NA | In vitro and in vivo | 15467457,20663872,18927618,23775125, | Europe PMC |  |
| PPP2CB | P62714 | NA | In vitro and in vivo | 15467457,20663872,18927618,23775125, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04110 | Cell cycle | Mitotic cell cycle progression is accomplished through a reproducible sequence of events, DNA replication (S phase) and mitosis (M phase) separated temporally by gaps known as G1 and G2 phases. Cyclin-dependent kinases (CDKs) are key regulatory enzymes, each consisting of a catalytic CDK subunit and an activating cyclin subunit. CDKs regulate the cell's progression through the phases of the cell cycle by modulating the activity of key substrates. Downstream targets of CDKs include transcription factor E2F and its regulator Rb. Precise activation and inactivation of CDKs at specific points in the cell cycle are required for orderly cell division. Cyclin-CDK inhibitors (CKIs), such as p16Ink4a, p15Ink4b, p27Kip1, and p21Cip1, are involved in the negative regulation of CDK activities, thus providing a pathway through which the cell cycle is negatively regulated.Eukaryotic cells respond to DNA damage by activating signaling pathways that promote cell cycle arrest and DNA repair. In response to DNA damage, the checkpoint kinase ATM phosphorylates and activates Chk2, which in turn directly phosphorylates and activates p53 tumor suppressor protein. p53 and its transcriptional targets play an important role in both G1 and G2 checkpoints. ATR-Chk1-mediated protein degradation of Cdc25A protein phosphatase is also a mechanism conferring intra-S-phase checkpoint activation. |
| hsa04218 | Cellular senescence | Cellular senescence is a state of irreversible cellular arrest and can be triggered by a number of factors, such as telomere shortening, oncogene activation, irradiation, DNA damage and oxidative stress. It is characterized by enlarged flattened morphology, senescence-associated beta-galactosidase (SA-b-gal) activity, secretion of inflammatory cytokines, growth factors and matrix metalloproteinases, as part of the senescence-associated secretory phenotype (SASP). Cellular senescence is functionally associated with many biological processes including aging, tumor suppression, placental biology, embryonic development, and wound healing. |
| hsa04350 | TGF-beta signaling pathway | The transforming growth factor-beta (TGF-beta) family members, which include TGF-betas, activins and bone morphogenetic proteins (BMPs), are structurally related secreted cytokines found in species ranging from worms and insects to mammals. A wide spectrum of cellular functions such as proliferation, apoptosis, differentiation and migration are regulated by TGF-beta family members. TGF-beta family member binds to the Type II receptor and recruits Type I, whereby Type II receptor phosphorylates and activates Type I. The Type I receptor, in turn, phosphorylates receptor-activated Smads ( R-Smads: Smad1, Smad2, Smad3, Smad5, and Smad8). Once phosphorylated, R-Smads associate with the co-mediator Smad, Smad4, and the heteromeric complex then translocates into the nucleus. In the nucleus, Smad complexes activate specific genes through cooperative interactions with other DNA-binding and coactivator (or co-repressor) proteins. |
| hsa05165 | Human papillomavirus infection | Human papillomavirus (HPV) is a non-enveloped, double-stranded DNA virus. HPV infect mucoal and cutaneous epithelium resulting in several types of pathologies, most notably, cervical cancer. All types of HPV share a common genomic structure and encode eight proteins: E1, E2, E4, E5, E6, and E7 (early) and L1 and L2 (late). It has been demonstrated that E1 and E2 are involved in viral transcription and replication. The functions of the E4 protein is not yet fully understood. E5, E6, and E7 act as oncoproteins. E5 inhibits the V-ATPase, prolonging EGFR signaling and thereby promoting cell proliferation. The expression of E6 and E7 not only inhibits the tumor suppressors p53 and Rb, but also alters additional signalling pathways. Among these pathways, PI3K/Akt signalling cascade plays a very important role in HPV-induced carcinogenesis. The L1 and L2 proteins form icosahedral capsids for progeny virion generation. |
| hsa05203 | Viral carcinogenesis | There is a strong association between viruses and the development of human malignancies. We now know that at least six human viruses, Epstein-Barr virus (EBV), hepatitis B virus (HBV), hepatitis C virus (HCV), human papilloma virus (HPV), human T-cell lymphotropic virus (HTLV-1) and Kaposi's associated sarcoma virus (KSHV) contribute to 10-15% of the cancers worldwide. Via expression of many potent oncoproteins, these tumor viruses promote an aberrant cell-proliferation via modulating cellular cell-signaling pathways and escape from cellular defense system such as blocking apoptosis. Human tumor virus oncoproteins can also disrupt pathways that are necessary for the maintenance of the integrity of host cellular genome. Viruses that encode such activities can contribute to initiation as well as progression of human cancers. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-1362277 | Transcription of E2F targets under negative control by DREAM complex. | DREAM complex is evolutionarily conserved and is reponsible for transcriptional repressession of cell cycle-regulated genes in G0 and early G1 |
| R-HSA-1362300 | Transcription of E2F targets under negative control by p107 (RBL1) and p130 (RBL2) in complex with HDAC1. | In G0 and early G1, expression of E2F target genes such as Cyclin A, E2F1, CDC2 and MYBL2 is inhibited by complexes containing p130 (RBL2) and p107 (RBL1), respectively, and histone deacetylase HDAC1 |
| R-HSA-1538133 | G0 and Early G1. | In G0 and early G1 in quiescent cells, p130 (RBL2) bound to E2F4 or E2F5 and either DP1 or DP2, associates with the MuvB complex, forming an evolutionarily conserved DREAM complex, that represses transcription of cell cycle genes. During early G1 phase in actively cycling cells, p107 (RBL1) forms a complex with E2F4 and DP1 or DP2 and represses transcription of E2F target genes. Both p130 (RBL2) and p107 (RBL1) repress transcription of E2F targets through recruiting histone deacetylase HDAC1, possibly in complex with other chromatin modifying enzymes, to E2F-regulated promoters. Expression of p107 (RBL1) is cell cycle regulated, with its levels peaking in late G1 and S phase. Although p107 (RBL1) is phosphorylated by cyclin D assocaited kinases during late G1 phase, a small pool of p107 (RBL1) is thought to be present throughout G1 and S phase, and could be involved in fine tuning the transcription of S-phase genes. This is supported by studies showing that unlike RB1 and p130 (RBL2), which are able to induce G1 arrest when over-expressed, p107 (RBL1) over-expression can arrest the cell cycle in both G1 and S phase. For recent reviews on the function of p107, p130 and pocket proteins in general, please refer to Wirt and Sage, 2010, MacPherson 2008 and Cobrinik 2005 |
| R-HSA-2173796 | SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription. | After phosphorylated SMAD2 and/or SMAD3 form a heterotrimer with SMAD4, SMAD2/3:SMAD4 complex translocates to the nucleus (Xu et al. 2000, Kurisaki et al. 2001, Xiao et al. 2003). In the nucleus, linker regions of SMAD2 and SMAD3 within SMAD2/3:SMAD4 complex can be phosphorylated by CDK8 associated with cyclin C (CDK8:CCNC) or CDK9 associated with cyclin T (CDK9:CCNT). CDK8/CDK9-mediated phosphorylation of SMAD2/3 enhances transcriptional activity of SMAD2/3:SMAD4 complex, but also primes it for ubiquitination and consequent degradation (Alarcon et al. 2009). The transfer of SMAD2/3:SMAD4 complex to the nucleus can be assisted by other proteins, such as WWTR1. In human embryonic cells, WWTR1 (TAZ) binds SMAD2/3:SMAD4 heterotrimer and mediates TGF-beta-dependent nuclear accumulation of SMAD2/3:SMAD4. The complex of WWTR1 and SMAD2/3:SMAD4 binds promoters of SMAD7 and SERPINE1 (PAI-1 i.e. plasminogen activator inhibitor 1) genes and stimulates their transcription (Varelas et al. 2008). Stimulation of SMAD7 transcription by SMAD2/3:SMAD4 represents a negative feedback loop in TGF-beta receptor signaling. SMAD7 can be downregulated by RNF111 ubiquitin ligase (Arkadia), which binds and ubiquitinates SMAD7, targeting it for degradation (Koinuma et al. 2003). SMAD2/3:SMAD4 heterotrimer also binds the complex of RBL1 (p107), E2F4/5 and TFDP1/2 (DP1/2). The resulting complex binds MYC promoter and inhibits MYC transcription. Inhibition of MYC transcription contributes to anti-proliferative effect of TGF-beta (Chen et al. 2002). SMAD2/3:SMAD4 heterotrimer also associates with transcription factor SP1. SMAD2/3:SMAD4:SP1 complex stimulates transcription of a CDK inhibitor CDKN2B (p15-INK4B), also contributing to the anti-proliferative effect of TGF-beta (Feng et al. 2000). MEN1 (menin), a transcription factor tumor suppressor mutated in a familial cancer syndrome multiple endocrine neoplasia type 1, forms a complex with SMAD2/3:SMAD4 heterotrimer, but transcriptional targets of SMAD2/3:SMAD4:MEN1 have not been elucidated (Kaji et al. 2001, Sowa et al. 2004, Canaff et al. 2012). JUNB is also an established transcriptional target of SMAD2/3:SMAD4 complex (Wong et al. 1999) |
| R-HSA-539107 | Activation of E2F1 target genes at G1/S. | E2F1 binds to E2F binding sites on the genome activating the synthesis of the target proteins. For annotation purposes, the reactions regulated by E2F1 are grouped under this pathway and information about the target genes alone are displayed for annotation purposes.Cellular targets for activation by E2F1 include thymidylate synthase (TYMS) (DeGregori et al. 1995), Rir2 (RRM2) (DeGregori et al. 1995, Giangrande et al. 2004), Dihydrofolate reductase (DHFR) (DeGregori et al. 1995, Wells et al. 1997, Darbinian et al. 1999), Cdc2 (CDK1) (Furukawa et al. 1994, DeGregori et al. 1995, Zhu et al. 2004), Cyclin A1 (CCNA1) (DeGregori et al. 1995, Liu et al. 1998), CDC6 (DeGregori et al. 1995, Yan et al. 1998; Ohtani et al. 1998), CDT1 (Yoshida and Inoue 2004), CDC45 (Arata et al. 2000), Cyclin E (CCNE1) (Ohtani et al. 1995), Emi1 (FBXO5) (Hsu et al. 2002), and ORC1 (Ohtani et al. 1996, Ohtani et al. 1998). The activation of TK1 (Dnk1) (Dou et al. 1994, DeGregori et al. 1995, Giangrande et al. 2004) and CDC25A (DeGregori et al. 1995, Vigo et al. 1999) by E2F1 is conserved in Drosophila (Duronio and O'Farrell 1994, Reis and Edgar 2004).RRM2 protein is involved in dNTP level regulation and activation of this enzyme results in higher levels of dNTPs in anticipation of S phase. E2F activation of RRM2 has been shown also in Drosophila by Duronio and O'Farrell (1994). E2F1 activation of CDC45 is shown in mouse cells by using human E2F1 construct (Arata et al. 2000). Cyclin E is also transcriptionally regulated by E2F1. Cyclin E protein plays important role in the transition of G1 in S phase by associating with CDK2 (Ohtani et al. 1996). E2F1-mediated activation of PCNA has been demonstrated in Drosophila (Duronio and O'Farrell 1994) and in some human cells by using recombinant adenovirus constructs (DeGregori et al. 1995). E2F1-mediated activation of the DNA polymerase alpha subunit p180 (POLA1) has been demonstrated in some human cells. It has also been demonstrated in Drosophila by Ohtani and Nevins (1994). It has been observed in Drosophila that E2F1 induced expression of Orc1 stimulates ORC1 6 complex formation and binding to the origin of replication (Asano and Wharton 1999). ORC1 6 recruit CDC6 and CDT1 that are required to recruit the MCM2 7 replication helicases. E2F1 regulation incorporates a feedback mechanism wherein Geminin (GMNN) can inhibit MCM2 7 recruitment of ORC1 6 complex by interacting with CDC6/CDT1. The activation of CDC25A and TK1 (Dnk1) by E2F1 has been inferred from similar events in Drosophila (Duronio RJ and O'Farrell 1994; Reis and Edgar 2004). E2F1 activates string (CDC25) that in turn activates the complex of Cyclin B and CDK1. A similar phenomenon has been observed in mouse NIH 3T3 cells and in Rat1 cells |
| R-HSA-6804114 | TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest. | TP53 contributes to the establishment of G2 arrest by inducing transcription of GADD45A and SFN, and by inhibiting transcription of CDC25C. TP53 induces GADD45A transcription in cooperation with chromatin modifying enzymes EP300, PRMT1 and CARM1 (An et al. 2004). GADD45A binds Aurora kinase A (AURKA), inhibiting its catalytic activity and preventing AURKA-mediated G2/M transition (Shao et al. 2006, Sanchez et al. 2010). GADD45A also forms a complex with PCNA. PCNA is involved in both normal and repair DNA synthesis. The effect of GADD45 interaction with PCNA, if any, on S phase progression, G2 arrest and DNA repair is not known (Smith et al. 1994, Hall et al. 1995, Sanchez et al. 2010, Kim et al. 2013). SFN (14-3-3-sigma) is induced by TP53 (Hermeking et al. 1997) and contributes to G2 arrest by binding to the complex of CDK1 and CCNB1 (cyclin B1) and preventing its translocation to the nucleus. Phosphorylation of a number of nuclear proteins by the complex of CDK1 and CCNB1 is needed for G2/M transition (Chan et al. 1999). While promoting G2 arrest, SFN can simultaneously inhibit apoptosis by binding to BAX and preventing its translocation to mitochondria, a step involved in cytochrome C release (Samuel et al. 2001). TP53 binds the promoter of the CDC25C gene in cooperation with the transcriptional repressor E2F4 and represses CDC25C transcription, thus maintaining G2 arrest (St Clair et al. 2004, Benson et al. 2014). The zinc finger transcription factor ZNF385A (HZF) is a direct transcriptional target of TP53 that can form a complex with TP53 and facilitate TP53-mediated induction of SFN transcription (Das et al. 2007) |
| R-HSA-69231 | Cyclin D associated events in G1. | Three D-type cyclins are essential for progression from G1 to S-phase. These D cyclins bind to and activate both CDK4 and CDK6. The formation of all possible complexes between the D-type cyclins and CDK4/6 is promoted by the proteins, p21(CIP1/WAF1) and p27(KIP1). The cyclin-dependent kinases are then activated due to phosphorylation by CAK. The cyclin dependent kinases phosphorylate the RB1 protein and RB1-related proteins p107 (RBL1) and p130 (RBL2). Phosphorylation of RB1 leads to release of activating E2F transcription factors (E2F1, E2F2 and E2F3). After repressor E2Fs (E2F4 and E2F5) dissociate from phosphorylated RBL1 and RBL2, activating E2Fs bind to E2F promoter sites, stimulating transcription of cell cycle genes, which then results in proper G1/S transition. The binding and sequestration of p27Kip may also contribute to the activation of CDK2 cyclin E/CDK2 cyclin A complexes at the G1/S transition (Yew et al., 2001) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AOX1 | Two-hybrid | physical | 21988832, (Europe PMC) | NA | BioGRID |
| AR | Affinity Capture-Western | physical | 23853093, (Europe PMC) | NA | BioGRID |
| ARID4A | Affinity Capture-Western | physical | 10490602, (Europe PMC) | NA | BioGRID |
| BEGAIN | Affinity Capture-Western, Two-hybrid, pull down, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.51 | BioGRID, IntAct |
| BRCA1 | Co-localization, Reconstituted Complex | physical | 11521194, (Europe PMC) | NA | BioGRID |
| BRF1 | Affinity Capture-Western, Reconstituted Complex | physical | 10330166, (Europe PMC) | NA | BioGRID |
| C3orf62 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| CCNA1 | Reconstituted Complex | physical | 10022926, (Europe PMC) | NA | BioGRID |
| CCNA2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex | physical | 12439743, 26186194, 28514442, 8230483, 8798463, 9724724, (Europe PMC) | NA | BioGRID |
| CCNE1 | Affinity Capture-Western | physical | 9891079, (Europe PMC) | NA | BioGRID |
| CDK2 | Affinity Capture-MS, Biochemical Activity, Protein-peptide, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 11884610, 23455922, 23602568, 25852190, 26186194, 28514442, 9472014, 9891079, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CDK4 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 22094256, (Europe PMC) | 0.44 | BioGRID, IntAct |
| CDK6 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 22094256, (Europe PMC) | 0.44 | BioGRID, IntAct |
| CDKN1C | Affinity Capture-Western | physical | 12947099, (Europe PMC) | NA | BioGRID |
| CREG1 | Reconstituted Complex | physical | 9710587, (Europe PMC) | NA | BioGRID |
| CTBP1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DGKZ | Affinity Capture-Western, anti tag coimmunoprecipitation, pull down | physical, physical association | 16286473, (Europe PMC) | 0.52 | BioGRID, IntAct |
| DYRK1A | Affinity Capture-MS, Affinity Capture-Western, FRET, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, tandem affinity purification | association, physical, physical association | 23602568, (Europe PMC) | 0.57 | BioGRID, IntAct |
| DYRK1B | Affinity Capture-MS, Affinity Capture-Western, FRET, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, tandem affinity purification | association, physical, physical association | 23602568, (Europe PMC) | 0.57 | BioGRID, IntAct |
| E2F1 | Affinity Capture-Western, Reconstituted Complex, isothermal titration calorimetry | physical, physical association | 12096339, 16360038, 23853093, 8230483, 8657117, 9501179, (Europe PMC) | 0.40 | BioGRID, IntAct |
| E2F2 | Affinity Capture-Western | physical | 8657117, (Europe PMC) | NA | BioGRID |
| E2F3 | Affinity Capture-Western | physical | 22157815, 8657117, (Europe PMC) | NA | BioGRID |
| E2F4 | Affinity Capture-Western, Co-localization, isothermal titration calorimetry | physical, physical association | 12150994, 16360038, 17671431, 7958924, 7958925, 8657117, 8832394, 9501179, 9858615, (Europe PMC) | 0.40 | BioGRID, IntAct |
| E2F5 | Two-hybrid | physical | 7760804, (Europe PMC) | NA | BioGRID |
| EMD | Affinity Capture-MS | physical | 17620012, (Europe PMC) | NA | BioGRID |
| EPHA2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FN1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FOXK1 | Affinity Capture-MS | physical | 25609649, (Europe PMC) | NA | BioGRID |
| FOXO3 | Affinity Capture-MS | physical | 25609649, (Europe PMC) | NA | BioGRID |
| GOLGA2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HDAC1 | Affinity Capture-Western, Reconstituted Complex | physical | 10490602, 9724731, (Europe PMC) | NA | BioGRID |
| HDAC2 | Affinity Capture-Western | physical | 10490602, (Europe PMC) | NA | BioGRID |
| HDAC3 | Affinity Capture-Western | physical | 10490602, (Europe PMC) | NA | BioGRID |
| HELZ | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ID2 | Affinity Capture-Western | physical | 11034201, (Europe PMC) | NA | BioGRID |
| IRF3 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| KDM5A | Reconstituted Complex | physical | 7935440, (Europe PMC) | NA | BioGRID |
| LAMB2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LIN37 | Affinity Capture-MS, Affinity Capture-Western | physical | 17671431, (Europe PMC) | NA | BioGRID |
| LIN54 | Affinity Capture-Western | physical | 17671431, (Europe PMC) | NA | BioGRID |
| LIN9 | Affinity Capture-Western | physical | 17671431, (Europe PMC) | NA | BioGRID |
| MAGEA11 | Affinity Capture-Western | physical | 23853093, (Europe PMC) | NA | BioGRID |
| MAPK6 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MARF1 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| MCM7 | Reconstituted Complex | physical | 9566894, (Europe PMC) | NA | BioGRID |
| MYBL2 | Affinity Capture-Western, Reconstituted Complex | physical | 12439743, 12947099, 17671431, (Europe PMC) | NA | BioGRID |
| MYC | Affinity Capture-Western | physical | 8076603, (Europe PMC) | NA | BioGRID |
| NR4A1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUCB1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PHB | Affinity Capture-Western, Reconstituted Complex | physical | 10376528, (Europe PMC) | NA | BioGRID |
| PLSCR1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPP2R3A | Affinity Capture-Western | physical | 9927208, (Europe PMC) | NA | BioGRID |
| RBBP8 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, 9721205, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBBP9 | Affinity Capture-Western | physical | 9697699, (Europe PMC) | NA | BioGRID |
| RBL2 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 15467457, 17531812, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| RINT1 | Reconstituted Complex | physical | 16600870, (Europe PMC) | NA | BioGRID |
| SMAD3 | Affinity Capture-Western, Reconstituted Complex | physical | 12150994, (Europe PMC) | NA | BioGRID |
| SMAD4 | Affinity Capture-Western | physical | 12150994, (Europe PMC) | NA | BioGRID |
| SMARCA4 | Two-hybrid | physical | 12434308, (Europe PMC) | NA | BioGRID |
| SNRPD3 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SNW1 | Reconstituted Complex | physical | 12466551, (Europe PMC) | NA | BioGRID |
| SP1 | Affinity Capture-Western | physical | 7565695, (Europe PMC) | NA | BioGRID |
| SUV39H1 | Affinity Capture-Western | physical | 12588981, (Europe PMC) | NA | BioGRID |
| TAF1 | Affinity Capture-Western | physical | 9242374, (Europe PMC) | NA | BioGRID |
| TFDP1 | Affinity Capture-Western | physical | 7739537, (Europe PMC) | NA | BioGRID |
| TFDP2 | Affinity Capture-Western | physical | 7739537, (Europe PMC) | NA | BioGRID |
| TOP1 | Protein-peptide | physical | 12549820, (Europe PMC) | NA | BioGRID |
| TSC22D2 | Two-hybrid | physical | 27337956, (Europe PMC) | NA | BioGRID |
| TXNDC11 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| USP4 | Reconstituted Complex | physical | 11571651, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AOX1 | two hybrid | physical association | 21988832, (Europe PMC) | 0.37 | IntAct |
| BEGAIN | Affinity Capture-Western, Two-hybrid, pull down, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.51 | BioGRID, IntAct |
| CD2BP2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| CD320 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| CDK2 | Affinity Capture-MS, Biochemical Activity, Protein-peptide, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 11884610, 23455922, 23602568, 25852190, 26186194, 28514442, 9472014, 9891079, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CDK4 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 22094256, (Europe PMC) | 0.44 | BioGRID, IntAct |
| CDK6 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 22094256, (Europe PMC) | 0.44 | BioGRID, IntAct |
| DGKZ | Affinity Capture-Western, anti tag coimmunoprecipitation, pull down | physical, physical association | 16286473, (Europe PMC) | 0.52 | BioGRID, IntAct |
| DNPEP | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| DYNLL1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| DYRK1A | Affinity Capture-MS, Affinity Capture-Western, FRET, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, tandem affinity purification | association, physical, physical association | 23602568, (Europe PMC) | 0.57 | BioGRID, IntAct |
| DYRK1B | Affinity Capture-MS, Affinity Capture-Western, FRET, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, tandem affinity purification | association, physical, physical association | 23602568, (Europe PMC) | 0.57 | BioGRID, IntAct |
| E2F1 | Affinity Capture-Western, Reconstituted Complex, isothermal titration calorimetry | physical, physical association | 12096339, 16360038, 23853093, 8230483, 8657117, 9501179, (Europe PMC) | 0.40 | BioGRID, IntAct |
| E2F4 | Affinity Capture-Western, Co-localization, isothermal titration calorimetry | physical, physical association | 12150994, 16360038, 17671431, 7958924, 7958925, 8657117, 8832394, 9501179, 9858615, (Europe PMC) | 0.40 | BioGRID, IntAct |
| EPHA2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EPHB2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| FN1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FOXK1 | tandem affinity purification | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| FOXO3 | pull down, tandem affinity purification | association, physical association | 25609649, (Europe PMC) | 0.50 | IntAct, MINT |
| GOLGA2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HELZ | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| IRF3 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| LAMB2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAPK6 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MRFAP1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| NEK6 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| NEURL4 | anti tag coimmunoprecipitation | association | 29426014, (Europe PMC) | 0.35 | IntAct |
| NR4A1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NTHL1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| NUCB1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PLSCR1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPP2CA | coimmunoprecipitation, phosphatase assay | dephosphorylation reaction, physical association | 15467457, (Europe PMC) | 0.54 | IntAct, MINT |
| RBBP8 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, 9721205, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBL2 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 15467457, 17531812, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| SNRPD3 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TRIP6 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TSPAN7 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| YWHAZ | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| FOXO3 | pull down, tandem affinity purification | association, physical association | 25609649, (Europe PMC) | 0.50 | IntAct, MINT |
| MAPK6 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PPP2CA | coimmunoprecipitation, phosphatase assay | dephosphorylation reaction, physical association | 15467457, (Europe PMC) | 0.54 | IntAct, MINT |
| RBL2 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 15467457, 17531812, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACTR3B | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| AOX1 | Two-hybrid | physical | 21988832, (Europe PMC) | NA | BioGRID |
| AOX1 | two hybrid | physical association | 21988832, (Europe PMC) | 0.37 | IntAct |
| AR | Affinity Capture-Western | physical | 23853093, (Europe PMC) | NA | BioGRID |
| ARID4A | Affinity Capture-Western | physical | 10490602, (Europe PMC) | NA | BioGRID |
| BEGAIN | Affinity Capture-Western, Two-hybrid, pull down, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.51 | BioGRID, IntAct |
| BRCA1 | Co-localization, Reconstituted Complex | physical | 11521194, (Europe PMC) | NA | BioGRID |
| BRF1 | Affinity Capture-Western, Reconstituted Complex | physical | 10330166, (Europe PMC) | NA | BioGRID |
| C3orf62 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| CCNA1 | Reconstituted Complex | physical | 10022926, (Europe PMC) | NA | BioGRID |
| CCNA2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex | physical | 12439743, 26186194, 28514442, 8230483, 8798463, 9724724, (Europe PMC) | NA | BioGRID |
| CCNE1 | Affinity Capture-Western | physical | 9891079, (Europe PMC) | NA | BioGRID |
| CD2BP2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| CD320 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| CDK2 | Affinity Capture-MS, Biochemical Activity, Protein-peptide, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 11884610, 23455922, 23602568, 25852190, 26186194, 28514442, 9472014, 9891079, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CDK4 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 22094256, (Europe PMC) | 0.44 | BioGRID, IntAct |
| CDK6 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 22094256, (Europe PMC) | 0.44 | BioGRID, IntAct |
| CDKN1C | Affinity Capture-Western | physical | 12947099, (Europe PMC) | NA | BioGRID |
| CREG1 | Reconstituted Complex | physical | 9710587, (Europe PMC) | NA | BioGRID |
| CTBP1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DGKZ | Affinity Capture-Western, anti tag coimmunoprecipitation, pull down | physical, physical association | 16286473, (Europe PMC) | 0.52 | BioGRID, IntAct |
| DNPEP | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| DYNLL1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| DYRK1A | Affinity Capture-MS, Affinity Capture-Western, FRET, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, tandem affinity purification | association, physical, physical association | 23602568, (Europe PMC) | 0.57 | BioGRID, IntAct |
| DYRK1B | Affinity Capture-MS, Affinity Capture-Western, FRET, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, tandem affinity purification | association, physical, physical association | 23602568, (Europe PMC) | 0.57 | BioGRID, IntAct |
| E2F1 | Affinity Capture-Western, Reconstituted Complex, isothermal titration calorimetry | physical, physical association | 12096339, 16360038, 23853093, 8230483, 8657117, 9501179, (Europe PMC) | 0.40 | BioGRID, IntAct |
| E2F2 | Affinity Capture-Western | physical | 8657117, (Europe PMC) | NA | BioGRID |
| E2F3 | Affinity Capture-Western | physical | 22157815, 8657117, (Europe PMC) | NA | BioGRID |
| E2F4 | Affinity Capture-Western, Co-localization, isothermal titration calorimetry | physical, physical association | 12150994, 16360038, 17671431, 7958924, 7958925, 8657117, 8832394, 9501179, 9858615, (Europe PMC) | 0.40 | BioGRID, IntAct |
| E2F5 | Two-hybrid | physical | 7760804, (Europe PMC) | NA | BioGRID |
| EMD | Affinity Capture-MS | physical | 17620012, (Europe PMC) | NA | BioGRID |
| EPHA2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EPHB2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| FN1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FOXK1 | Affinity Capture-MS | physical | 25609649, (Europe PMC) | NA | BioGRID |
| FOXK1 | tandem affinity purification | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| FOXO3 | Affinity Capture-MS | physical | 25609649, (Europe PMC) | NA | BioGRID |
| FOXO3 | pull down, tandem affinity purification | association, physical association | 25609649, (Europe PMC) | 0.50 | IntAct, MINT |
| GOLGA2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HDAC1 | Affinity Capture-Western, Reconstituted Complex | physical | 10490602, 9724731, (Europe PMC) | NA | BioGRID |
| HDAC2 | Affinity Capture-Western | physical | 10490602, (Europe PMC) | NA | BioGRID |
| HDAC3 | Affinity Capture-Western | physical | 10490602, (Europe PMC) | NA | BioGRID |
| HELZ | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ID2 | Affinity Capture-Western | physical | 11034201, (Europe PMC) | NA | BioGRID |
| IRF3 | Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 21903422, (Europe PMC) | 0.50 | BioGRID, IntAct |
| KDM5A | Reconstituted Complex | physical | 7935440, (Europe PMC) | NA | BioGRID |
| LAMB2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LIN37 | Affinity Capture-MS, Affinity Capture-Western | physical | 17671431, (Europe PMC) | NA | BioGRID |
| LIN54 | Affinity Capture-Western | physical | 17671431, (Europe PMC) | NA | BioGRID |
| LIN9 | Affinity Capture-Western | physical | 17671431, (Europe PMC) | NA | BioGRID |
| MAGEA11 | Affinity Capture-Western | physical | 23853093, (Europe PMC) | NA | BioGRID |
| MAPK6 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MARF1 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| MCM7 | Reconstituted Complex | physical | 9566894, (Europe PMC) | NA | BioGRID |
| MRFAP1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| MYBL2 | Affinity Capture-Western, Reconstituted Complex | physical | 12439743, 12947099, 17671431, (Europe PMC) | NA | BioGRID |
| MYC | Affinity Capture-Western | physical | 8076603, (Europe PMC) | NA | BioGRID |
| NEK6 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| NEURL4 | anti tag coimmunoprecipitation | association | 29426014, (Europe PMC) | 0.35 | IntAct |
| NR4A1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NTHL1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUCB1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PHB | Affinity Capture-Western, Reconstituted Complex | physical | 10376528, (Europe PMC) | NA | BioGRID |
| PLSCR1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPP2CA | coimmunoprecipitation, phosphatase assay | dephosphorylation reaction, physical association | 15467457, (Europe PMC) | 0.54 | IntAct, MINT |
| PPP2R3A | Affinity Capture-Western | physical | 9927208, (Europe PMC) | NA | BioGRID |
| RBBP8 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, 9721205, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBBP9 | Affinity Capture-Western | physical | 9697699, (Europe PMC) | NA | BioGRID |
| RBL2 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 15467457, 17531812, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| RINT1 | Reconstituted Complex | physical | 16600870, (Europe PMC) | NA | BioGRID |
| SMAD3 | Affinity Capture-Western, Reconstituted Complex | physical | 12150994, (Europe PMC) | NA | BioGRID |
| SMAD4 | Affinity Capture-Western | physical | 12150994, (Europe PMC) | NA | BioGRID |
| SMARCA4 | Two-hybrid | physical | 12434308, (Europe PMC) | NA | BioGRID |
| SNRPD3 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SNW1 | Reconstituted Complex | physical | 12466551, (Europe PMC) | NA | BioGRID |
| SP1 | Affinity Capture-Western | physical | 7565695, (Europe PMC) | NA | BioGRID |
| SUV39H1 | Affinity Capture-Western | physical | 12588981, (Europe PMC) | NA | BioGRID |
| TAF1 | Affinity Capture-Western | physical | 9242374, (Europe PMC) | NA | BioGRID |
| TFDP1 | Affinity Capture-Western | physical | 7739537, (Europe PMC) | NA | BioGRID |
| TFDP2 | Affinity Capture-Western | physical | 7739537, (Europe PMC) | NA | BioGRID |
| TOP1 | Protein-peptide | physical | 12549820, (Europe PMC) | NA | BioGRID |
| TRIP6 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TSC22D2 | Two-hybrid | physical | 27337956, (Europe PMC) | NA | BioGRID |
| TSPAN7 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TXNDC11 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| USP4 | Reconstituted Complex | physical | 11571651, (Europe PMC) | NA | BioGRID |
| YWHAZ | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| Phosphorylating Kinases | Phosphoresidues | Detection Method | PubMed IDs | Source |
| CDK2 | S640_RRDMQPLsPISVHER, S650_SVHERYSsPTAGSAK, | NA | NA | PhosphoSitePlus, |
| CDK4 | S640_RRDMQPLsPISVHER, S650_SVHERYSsPTAGSAK, S964_MMDAPPLsPFPHIKQ, S975_HIKQQPGsPRRISQQ, T369_KRSFAPStPLTGRRY, | LTP, in vivo | 10069453, 11884610, 12006580, 19664994, 19664995,(Europe PMC) | HPRD, PhosphoELM, PhosphoSitePlus, |
| Unknown | S1009_LLYKFNGsPSKSLKD, S103_LSLIQFFsKMKKWMD, S1041_AIDSDAEsPAKRVCQ, S615_HLPLMPMsPLMHPRV, S640_RRDMQPLsPISVHER, S749_NQESKVKsPVSLTAH, S762_AHSLIGAsPKQTNLT, S93_SLTRILRsAKLSLIQ, S975_HIKQQPGsPRRISQQ, S984_RRISQQHsIYISPHK, S988_QQHSIYIsPHKNGSG, S994_ISPHKNGsGLTPRSA, T332_DAEEEIGtPRKFTRD, T340_PRKFTRDtPLGKLTA, T385_REKEAVItPVASATQ, T997_HKNGSGLtPRSALLY, Y986_ISQQHSIyISPHKNG, | LTP, in vivo | 12006580, 18491316, 19413330, 19664994,(Europe PMC) | HPRD, PhosphoELM, |