- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
NFATC2
Gene Name  | NFATC2 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 1PZU |
| Synonyms | NFATC2, NFAT1, NFATP | |
| Protein Name | NFATC2 | |
| Alternative Name(s) | Nuclear factor of activated T-cells, cytoplasmic 2;NF-ATc2;NFATc2;NFAT pre-existing subunit;NF-ATp;T-cell transcription factor NFAT1; | |
| Protein Family | noSimilarity_annotations | |
| EntrezGene ID | 4773 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q13469 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 100146 Dalton | |
| Protein Length | 925 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000101096 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - ENOG410IHFR | eggNOG - ENOG41105U2 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Nucleus Note=Cytoplasmic for thephosphorylated form and nuclear after activation that iscontrolled by calcineurin-mediated dephosphorylation Rapidnuclear exit of NFATC is thought to be one mechanism by whichcells distinguish between sustained and transient calcium signalsThe subcellular localization of NFATC plays a key role in theregulation of gene transcription | |||
| Function (UniProt annotation) | |||
| Plays a role in the inducible expression of cytokinegenes in T-cells, especially in the induction of the IL-2, IL-3,IL-4, TNF-alpha or GM-CSF Promotes invasive migration through theactivation of GPC6 expression and WNT5A signaling pathway | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSG EPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEG YREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPR PASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPP KMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWP LSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRIT GKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSL QTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFV EIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSC LVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHP SPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPP VSDQKEVLPAGVTIKQEQNLDQTYLDDVNEIIRKEFSGPPARNQT | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| DOC_PP2B_LxvP_1 | 369-LLVP-372 | Calcineurin (PP2B)-docking motif LxvP | L.[LIVAPM]P |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000790 | C:nuclear chromatin |
| GO:0000978 | F:RNA polymerase II proximal promoter sequence-specific DNA binding |
| GO:0000981 | F:RNA polymerase II transcription factor activity |
| GO:0001077 | sequence-specific DNA binding |
| GO:0001078 | F:transcriptional activator activity |
| GO:0001816 | RNA polymerase II proximal promoter sequence-specific DNA binding |
| GO:0003677 | F:transcriptional repressor activity |
| GO:0003682 | RNA polymerase II proximal promoter sequence-specific DNA binding |
| GO:0003700 | P:cytokine production |
| GO:0005634 | F:DNA binding |
| GO:0005654 | F:chromatin binding |
| GO:0005737 | F:DNA-binding transcription factor activity |
| GO:0005829 | C:nucleus |
| GO:0006355 | C:nucleoplasm |
| GO:0006974 | C:cytoplasm |
| GO:0008134 | C:cytosol |
| GO:0014904 | P:regulation of transcription |
| GO:0016477 | DNA-templated |
| GO:0019902 | P:cellular response to DNA damage stimulus |
| GO:0030890 | F:transcription factor binding |
| GO:0033173 | P:myotube cell development |
| GO:0038095 | P:cell migration |
| GO:0042493 | F:phosphatase binding |
| GO:0044798 | P:positive regulation of B cell proliferation |
| GO:0045589 | P:calcineurin-NFAT signaling cascade |
| GO:0045893 | P:Fc-epsilon receptor signaling pathway |
| GO:0050853 | P:response to drug |
| GO:1901741 | C:nuclear transcription factor complex |
| GO:1905064 | P:regulation of regulatory T cell differentiation |
| GO:1990904 | P:positive regulation of transcription |
NFATC2 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in NFATC2 (Q13469) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PPP3CA | Q08209 | five serines of Ser-168_N/A, Ser-171_, Ser-172_, Ser-174_, Ser-175_, Ser-177_, and Ser-180; Ser-213_, Ser-217_, Ser-221_, Ser-268_, Ser-274_, Ser-276_, Ser-280_, Ser-326 in isoform C_, | In vitro and in vivo | 9660947, 11030334, | Europe PMC |  |
| PPP3CB | P16298 | five serines of Ser-168_N/A, Ser-171_, Ser-172_, Ser-174_, Ser-175_, Ser-177_, and Ser-180; Ser-213_, Ser-217_, Ser-221_, Ser-268_, Ser-274_, Ser-276_, Ser-280_, Ser-326 in isoform C_, | In vitro and in vivo | 9660947, 11030334, | Europe PMC | |
| PPP3CC | P48454 | five serines of Ser-168_N/A, Ser-171_, Ser-172_, Ser-174_, Ser-175_, Ser-177_, and Ser-180; Ser-213_, Ser-217_, Ser-221_, Ser-268_, Ser-274_, Ser-276_, Ser-280_, Ser-326 in isoform C_, | In vitro and in vivo | 9660947, 11030334, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04022 | cGMP-PKG signaling pathway | Cyclic GMP (cGMP) is the intracellular second messenger that mediates the action of nitric oxide (NO) and natriuretic peptides (NPs), regulating a broad array of physiologic processes. The elevated intracellular cGMP level exerts its physiological action through two forms of cGMP-dependent protein kinase (PKG), cGMP-regulated phosphodiesterases (PDE2, PDE3) and cGMP-gated cation channels, among which PKGs might be the primary mediator. PKG1 isoform-specific activation of established substrates leads to reduction of cytosolic calcium concentration and/or decrease in the sensitivity of myofilaments to Ca2+ (Ca2+-desensitization), resulting in smooth muscle relaxation. In cardiac myocyte, PKG directly phosphorylates a member of the transient potential receptor canonical channel family, TRPC6, suppressing this nonselective ion channel's Ca2+ conductance, G-alpha-q agonist-induced NFAT activation, and myocyte hypertrophic responses. PKG also opens mitochondrial ATP-sensitive K+ (mitoKATP) channels and subsequent release of ROS triggers cardioprotection. |
| hsa04218 | Cellular senescence | Cellular senescence is a state of irreversible cellular arrest and can be triggered by a number of factors, such as telomere shortening, oncogene activation, irradiation, DNA damage and oxidative stress. It is characterized by enlarged flattened morphology, senescence-associated beta-galactosidase (SA-b-gal) activity, secretion of inflammatory cytokines, growth factors and matrix metalloproteinases, as part of the senescence-associated secretory phenotype (SASP). Cellular senescence is functionally associated with many biological processes including aging, tumor suppression, placental biology, embryonic development, and wound healing. |
| hsa04310 | Wnt signaling pathway | Wnt proteins are secreted morphogens that are required for basic developmental processes, such as cell-fate specification, progenitor-cell proliferation and the control of asymmetric cell division, in many different species and organs. There are at least three different Wnt pathways: the canonical pathway, the planar cell polarity (PCP) pathway and the Wnt/Ca2+ pathway. In the canonical Wnt pathway, the major effect of Wnt ligand binding to its receptor is the stabilization of cytoplasmic beta-catenin through inhibition of the bea-catenin degradation complex. Beta-catenin is then free to enter the nucleus and activate Wnt-regulated genes through its interaction with TCF (T-cell factor) family transcription factors and concomitant recruitment of coactivators. Planar cell polarity (PCP) signaling leads to the activation of the small GTPases RHOA (RAS homologue gene-family member A) and RAC1, which activate the stress kinase JNK (Jun N-terminal kinase) and ROCK (RHO-associated coiled-coil-containing protein kinase 1) and leads to remodelling of the cytoskeleton and changes in cell adhesion and motility. WNT-Ca2+ signalling is mediated through G proteins and phospholipases and leads to transient increases in cytoplasmic free calcium that subsequently activate the kinase PKC (protein kinase C) and CAMKII (calcium calmodulin mediated kinase II) and the phosphatase calcineurin. |
| hsa04360 | Axon guidance | Axon guidance represents a key stage in the formation of neuronal network. Axons are guided by a variety of guidance factors, such as netrins, ephrins, Slits, and semaphorins. These guidance cues are read by growth cone receptors, and signal transduction pathways downstream of these receptors converge onto the Rho GTPases to elicit changes in cytoskeletal organization that determine which way the growth cone will turn. |
| hsa04370 | VEGF signaling pathway | There is now much evidence that VEGFR-2 is the major mediator of VEGF-driven responses in endothelial cells and it is considered to be a crucial signal transducer in both physiologic and pathologic angiogenesis. The binding of VEGF to VEGFR-2 leads to a cascade of different signaling pathways, resulting in the up-regulation of genes involved in mediating the proliferation and migration of endothelial cells and promoting their survival and vascular permeability. For example, the binding of VEGF to VEGFR-2 leads to dimerization of the receptor, followed by intracellular activation of the PLCgamma;PKC-Raf kinase-MEK-mitogen-activated protein kinase (MAPK) pathway and subsequent initiation of DNA synthesis and cell growth, whereas activation of the phosphatidylinositol 3' -kinase (PI3K)-Akt pathway leads to increased endothelial-cell survival. Activation of PI3K, FAK, and p38 MAPK is implicated in cell migration signaling. |
| hsa04380 | Osteoclast differentiation | The osteoclasts, multinucleared cells originating from the hematopoietic monocyte-macrophage lineage, are responsible for bone resorption. Osteoclastogenesis is mainly regulated by signaling pathways activated by RANK and immune receptors, whose ligands are expressed on the surface of osteoblasts. Signaling from RANK changes gene expression patterns through transcription factors like NFATc1 and characterizes the active osteoclast. |
| hsa04625 | C-type lectin receptor signaling pathway | C-type lectin receptors (CLRs) are a large superfamily of proteins characterized by the presence of one or more C-type lectin-like domains (CTLDs). CLRs function as pattern-recognition receptors (PRRs) for pathogen-derived ligands in dendric cells, macrophages, neutrophils, etc., such as Dectin-1 and Dectin-2 for recognition of fungi-derived B-glucan and high mannose-type carbohydrates. Upon ligand binding, CLRs stimulate intracellular signaling cascades that induce the production of inflammatory cytokines and chemokines, consequently triggering innate and adaptive immunity to pathogens. |
| hsa04650 | Natural killer cell mediated cytotoxicity | Natural killer (NK) cells are lymphocytes of the innate immune system that are involved in early defenses against both allogeneic (nonself) cells and autologous cells undergoing various forms of stress, such as infection with viruses, bacteria, or parasites or malignant transformation. Although NK cells do not express classical antigen receptors of the immunoglobulin gene family, such as the antibodies produced by B cells or the T cell receptor expressed by T cells, they are equipped with various receptors whose engagement allows them to discriminate between target and nontarget cells. Activating receptors bind ligands on the target cell surface and trigger NK cell activation and target cell lysis. However Inhibitory receptors recognize MHC class I molecules (HLA) and inhibit killing by NK cells by overruling the actions of the activating receptors. This inhibitory signal is lost when the target cells do not express MHC class I and perhaps also in cells infected with virus, which might inhibit MHC class I exprssion or alter its conformation. The mechanism of NK cell killing is the same as that used by the cytotoxic T cells generated in an adaptive immune response; cytotoxic granules are released onto the surface of the bound target cell, and the effector proteins they contain penetrate the cell membrane and induce programmed cell death. |
| hsa04658 | Th1 and Th2 cell differentiation | Immunity to different classes of microorganisms is orchestrated by separate lineages of effector T helper (TH)-cells, which differentiate from naive CD4+ precursor cells in response to cues provided by antigen presenting cells (APC) and include T helper type 1 (Th1) and Th2. Th1 cells are characterized by the transcription factor T-bet and signal transducer and activator of transcription (STAT) 4, and the production of IFN-gamma. These cells stimulate strong cell-mediated immune responses, particularly against intracellular pathogens. On the other hand, transcription factors like GATA-3 and STAT6 drive the generation of Th2 cells that produce IL-4, IL-5 and IL-13 and are necessary for inducing the humoral response to combat parasitic helminths (type 2 immunity) and isotype switching to IgG1 and IgE. The balance between Th1/Th2 subsets determines the susceptibility to disease states, where the improper development of Th2 cells can lead to allergy, while an overactive Th1 response can lead to autoimmunity. |
| hsa04659 | Th17 cell differentiation | Interleukin (IL)-17-producing helper T (Th17) cells serve as a subset of CD4+ T cells involved in epithelial cell- and neutrophil mediated immune responses against extracellular microbes and in the pathogenesis of autoimmune diseases. In vivo, Th17 differentiation requires antigen presentation and co-stimulation, and activation of antigen presenting-cells (APCs) to produce TGF-beta, IL-6, IL-1, IL-23 and IL-21. This initial activation results in the activation and up-regulation of STAT3, ROR(gamma)t and other transcriptional factors in CD4+ T cells, which bind to the promoter regions of the IL-17, IL-21 and IL-22 genes and induce IL-17, IL-21 and IL-22. In contrast, the differentiation of Th17 cells and their IL-17 expression are negatively regulated by IL-2, Th2 cytokine IL-4, IL-27 and Th1 cytokine IFN-gamma through STAT5, STAT6 and STAT1 activation, respectively. Retinoid acid and the combination of IL-2 and TGF-beta upregulate Foxp3, which also downregulates cytokines like IL-17 and IL-21. The inhibition of Th17 differentiation may serve as a protective strategy to 'fine-tune' the expression IL-17 so it does not cause excessive inflammation. Thus, balanced differentiation of Th cells is crucial for immunity and host protection. |
| hsa04660 | T cell receptor signaling pathway | Activation of T lymphocytes is a key event for an efficient response of the immune system. It requires the involvement of the T-cell receptor (TCR) as well as costimulatory molecules such as CD28. Engagement of these receptors through the interaction with a foreign antigen associated with major histocompatibility complex molecules and CD28 counter-receptors B7.1/B7.2, respectively, results in a series of signaling cascades. These cascades comprise an array of protein-tyrosine kinases, phosphatases, GTP-binding proteins and adaptor proteins that regulate generic and specialised functions, leading to T-cell proliferation, cytokine production and differentiation into effector cells. |
| hsa04662 | B cell receptor signaling pathway | B cells are an important component of adaptive immunity. They produce and secrete millions of different antibody molecules, each of which recognizes a different (foreign) antigen. The B cell receptor (BCR) is an integral membrane protein complex that is composed of two immunoglobulin (Ig) heavy chains, two Ig light chains and two heterodimers of Ig-alpha and Ig-beta. After BCR ligation by antigen, three main protein tyrosine kinases (PTKs) -the SRC-family kinase LYN, SYK and the TEC-family kinase BTK- are activated. Phosphatidylinositol 3-kinase (PI3K) and phospholipase C-gamma 2 (PLC-gamma 2) are important downstream effectors of BCR signalling. This signalling ultimately results in the expression of immediate early genes that further activate the expression of other genes involved in B cell proliferation, differentiation and Ig production as well as other processes. |
| hsa04921 | Oxytocin signaling pathway | Oxytocin (OT) is a nonapeptide synthesized by the magno-cellular neurons located in the supraoptic (SON) and paraventricular (PVN) nuclei of the hypothalamus. It exerts a wide variety of central and peripheral effects. However, its best-known and most well-established roles are stimulation of uterine contractions during parturition and milk release during lactation. Oxytocin also influences cardiovascular regulation and various social behaviors. The actions of OT are all mediated by one type of OT receptor (OTR). This is a transmembrane receptor belonging to the G-protein-coupled receptor superfamily. The main signaling pathway is the Gq/PLC/Ins3 pathway, but the MAPK and the RhoA/Rho kinase pathways are also activated, contributing to increased prostaglandin production and direct contractile effect on myometrial cells. In the cardiovascular system, OTR is associated with the ANP-cGMP and NO-cGMP pathways, which reduce the force and rate of contraction and increase vasodilatation. |
| hsa05161 | Hepatitis B | Hepatitis B virus (HBV) is an enveloped virus and contains a partially double-stranded relaxed circular DNA (RC-DNA) genome. After entry into hepatocytes, HBV RC-DNA is transported to the nucleus and converted into a covalently closed circular molecule cccDNA. The cccDNA is the template for transcription of all viral RNAs including the pregenomic RNA (pgRNA), encoding for 7 viral proteins: large, middle, and small envelope proteins (LHBs, MHBs, and SHBs) that form the surface antigen (HBsAg), the core antigen (HBcAg), the e antigen (HBeAg), the HBV polymerase, and the regulatory protein X (HBx). The pgRNA interacts with the viral polymerase protein to initiate the encapsidation into the core particles. Through endoplasmic reticulum, the core particles finish assembling with the envelope proteins and are released. HBV infection leads to a wide spectrum of liver diseases raging from chronic hepatitis, cirrhosis to hepatocellular carcinoma. The mechanism of liver injury is still not clear. However, HBV proteins target host proteins, involved in a variety of functions, thus regulating transcription, cellular signaling cascades, proliferation, differentiation, and apoptosis. |
| hsa05163 | Human cytomegalovirus infection | Human cytomegalovirus (HCMV) is an enveloped, double-stranded DNA virus that is a member of beta-herpesvirus family. HCMV is best known for causing significant morbidity and mortality in immunocompromised populations. As with other herpesviruses, HCMV gB and gH/gL envelope glycoproteins are essential for virus entry. HCMV gB could activate the PDGFRA, and induce activation of the oncogenic PI3-K/AKT pathway. Though it is unlikely that HCMV by itself can act as an oncogenic factor, HCMV may have an oncomodulatory role, to catalyze an oncogenic process that has already been initiated. US28, one of the four HCMV-encoded vGPCRs (US27, US28, UL33 and UL78), also has a specific role in the oncomodulatory properties. In addition, HCMV has developed numerous mechanisms for manipulating the host immune system. The virally encoded US2, US3, US6 and US11 gene products all interfere with major histocompatibility complex (MHC) class I antigen presentation. HCMV encodes several immediate early (IE) antiapoptotic proteins (IE1, IE2, vMIA and vICA). These proteins might avoid immune clearance of infected tumor cells by cytotoxic lymphocytes and NK cells. |
| hsa05166 | Human T-cell leukemia virus 1 infection | Human T-cell leukemia virus type 1 (HTLV-1) is a pathogenic retrovirus that is associated with adult T-cell leukemia/lymphoma (ATL). It is also strongly implicated in non-neoplastic chronic inflammatory diseases such as HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP). Expression of Tax, a viral regulatory protein is critical to the pathogenesis. Tax is a transcriptional co-factor that interfere several signaling pathways related to anti-apoptosis or cell proliferation. The modulation of the signaling by Tax involve its binding to transcription factors like CREB/ATF, NF-kappa B, SRF, and NFAT. |
| hsa05167 | Kaposi sarcoma-associated herpesvirus infection | Kaposi sarcoma-associated herpesvirus (KSHV), also known as human herpesvirus 8 (HHV-8), is the most recently identified human tumor virus, and is associated with the pathogenesis of Kaposi's sarcoma (KS), primary effusion lymphoma (PEL), and Multicentric Castleman's disease (MCD). Like all other herpesviruses, KSHV displays two modes of life cycle, latency and lytic replication, which are characterized by the patterns of viral gene expression. Genes expressed in latency (LANA, v-cyclin, v-FLIP, Kaposins A, B and C and viral miRNAs) are mainly thought to facilitate the establishment of life long latency in its host and survival against the host innate, and adaptive immune surveillance mechanisms. Among the viral proteins shown to be expressed during lytic replication are potent signaling molecules such as vGPCR, vIL6, vIRFs, vCCLs, K1 and K15, which have been implicated experimentally in the angiogenic and inflammatory phenotype observed in KS lesions. Several of these latent viral and lytic proteins are known to transform host cells, linking KSHV with the development of severe human malignancies. |
| hsa05170 | Human immunodeficiency virus 1 infection | Human immunodeficiency virus type 1 (HIV-1) , the causative agent of AIDS (acquired immunodeficiency syndrome), is a lentivirus belonging to the Retroviridae family. The primary cell surface receptor for HIV-1, the CD4 protein, and the co-receptor for HIV-1, either CCR5 or CXCR4, are found on macrophages and T lymphocytes. At the earliest step, sequential binding of virus envelope (Env) glycoprotein gp120 to CD4 and the co-receptor CCR5 or CXCR4 facilitates HIV-1 entry and has the potential to trigger critical signaling that may favor viral replication. At advanced stages of the disease, HIV-1 infection results in dramatic induction of T-cell (CD4+ T and CD8+ T cell) apoptosis both in infected and uninfected bystander T cells, a hallmark of HIV-1 pathogenesis. On the contrary, macrophages are resistant to the cytopathic effect of HIV-1 and produce virus for longer periods of time. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-2025928 | Calcineurin activates NFAT. | Signaling by the B cell receptor and the T cell receptor stimulate transcription by NFAT factors via calcium (reviewed in Gwack et al. 2007). Cytosolic calcium from intracellular stores and extracellular sources binds calmodulin and activates the protein phosphatase calcineurin. Activated calcineurin dephosphorylates NFATs in the cytosol, exposing nuclear localization sequences on the NFATs and causing the NFATs to be imported into the nucleus where they regulate transcription of target genes in complexes with other transcription factors such as AP-1 and JUN. Calcineurin in the target of the immunosuppressive drugs cyclosporin A and FK-506 (reviewed in Lee and Park 2006) |
| R-HSA-2871809 | FCERI mediated Ca+2 mobilization. | Increase of intracellular calcium in mast cells is most crucial for mast cell degranulation. Elevation of intracellular calcium is achieved by activation of PLC-gamma. Mast cells express both PLC-gamma1 and PLC-gamma2 isoforms and activation of these enzymes leads to conversion of phosphatidylinositol 4,5-bisphosphate (PIP2) into inositol triphosphate (IP3) and diacylglycerol (DAG). The production of IP3 leads to mobilization of intracellular Ca+2, which later results in a sustained Ca+2 flux response that is maintained by an influx of extracellular Ca+2. In addition to degranulation, an increase in intracellular calcium concentration also activates the Ca2+/calmodulin-dependent serine phosphatase calcineurin. Calcineurin dephosphorylates the nuclear factor for T cell activation (NFAT) which exposes nuclear-localization signal sequence triggering translocation of the dephosphorylated NFAT-CaN complex to the nucleus. Once in the nucleus, NFAT regulates the transcription of several cytokine genes (Kambayashi et al. 2007, Hoth & Penner 1992, Ebinu et al. 2000, Siraganian et al) |
| R-HSA-5607763 | CLEC7A (Dectin-1) induces NFAT activation. | CLEC7A (Dectin-1) signals through the classic calcineurin/NFAT pathway through Syk activation phospholipase C-gamma 2 (PLCG2) leading to increased soluble IP3 (inositol trisphosphate). IP3 is able to bind endoplasmic Ca2+ channels, resulting in an influx of Ca2+ into the cytoplasm. This increase in calcium concentration induces calcineurin activation and consequently, dephosphorylation of NFAT and its translocation into the nucleus, triggering gene transcription and extracellular release of Interleukin-2 (Plato et al. 2013, Goodridge et al. 2007, Mourao-Sa et al. 2011) |
| R-HSA-8877330 | RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs). | The complex of CBFB and RUNX1 (AML1) controls transcription of the FOXP3 gene. FOXP3 is a transcription factor that acts as a key regulator of development and function of regulatory T lymphocytes (Tregs). Tregs are CD25+CD4+ T lymphocytes involved in suppression of aberrant immune responses seen in autoimmune diseases and allergies. FOXP3 can bind to RUNX1 and control transcriptional activity of the RUNX1:CBFB complex. RUNX1 stimulates transcription of IL2 and IFNG1 (IFN-gamma), and the expression of these two genes is repressed upon binding of FOXP3 to RUNX1. The complex of FOXP3 and RUNX1, on the other hand, stimulates transcription of cell surface markers of Tregs, such as CD25, CTLA-4 and GITR. In the absence of FOXP3, RUNX1 represses transcription of these genes (Shevach 2000, Maloy and Powrie 2001, Sakaguchi 2004, Ono et al. 2007, Kitoh et al. 2009).The RUNX1:CBFB complex directly stimulates transcription of the CR1 gene, encoding Complement receptor type 1 (CD35) (Kim et al. 1999, Rho et al. 2002). Expression of CR1 on the surface of activated T cells contributes to generation of Tregs (Torok et al. 2015) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ADNP | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| AIFM1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ALDH18A1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ARID1A | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ATF7 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| BCL11B | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| BEND3 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| BTAF1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CABIN1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CACYBP | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CAD | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CBX1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CBX3 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CBX5 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CEBPE | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CHAF1B | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CHAMP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CHD4 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CHEK1 | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CNP | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CREB1 | Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification | association, physical, physical association | 25609649, 27637333, (Europe PMC) | 0.50 | BioGRID, IntAct, MINT |
| CREBBP | Reconstituted Complex, pull down | direct interaction, physical | 19060202, 9625762, (Europe PMC) | 0.44 | BioGRID, IntAct |
| CSE1L | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 21983832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSNK1D | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CSTF1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CTBP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| DCAF7 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| DEK | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| DNAJA1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| DPF2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| EEF2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| EGR1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| EMD | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| EP300 | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, 9625762, (Europe PMC) | NA | BioGRID |
| ERAL1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ERCC3 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ETV6 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| FOS | Affinity Capture-MS, Affinity Capture-Western, fluorescent resonance energy transfer | physical, physical association | 18172215, 27637333, (Europe PMC) | 0.40 | BioGRID, IntAct |
| FOXK1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| FOXP3 | Co-localization | physical | 19564342, (Europe PMC) | NA | BioGRID |
| GATAD2A | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| GATAD2B | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| GNB2 | Affinity Capture-Western | physical | 23326349, (Europe PMC) | NA | BioGRID |
| GSK3B | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| GTF2H2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| GTF2H2C | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| GTF2H2C_2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| GTF3C4 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| GTF3C5 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| H2AFY | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HADHA | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HDAC1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HIRA | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HLTF | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HNRNPA1 | Affinity Capture-MS | physical | 22446626, (Europe PMC) | NA | BioGRID |
| HSPA1A | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HSPA5 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HSPA8 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HSPA9 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HSPH1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| IDH3A | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| IDH3B | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| IFI16 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| IKZF1 | Affinity Capture-MS, Affinity Capture-Western, Co-localization | physical | 27637333, (Europe PMC) | NA | BioGRID |
| IKZF2 | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| IQGAP1 | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 21983832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IRF2BP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| IRF2BP2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 21576369, 27637333, (Europe PMC) | NA | BioGRID |
| IRF4 | Affinity Capture-Western | physical | 11956291, (Europe PMC) | NA | BioGRID |
| JUN | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, pull down, tandem affinity purification | association, direct interaction, physical, physical association | 20557936, 25609649, 27637333, (Europe PMC) | 0.35, 0.59 | BioGRID, IntAct, MINT |
| JUNB | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| JUND | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| KDM1A | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| KIF2C | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| KIF4A | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| KPNB1 | Affinity Capture-Western | physical | 21278340, (Europe PMC) | NA | BioGRID |
| LEF1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| LIG3 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| LRRC47 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| LRRK2 | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical, physical association | 21983832, (Europe PMC) | 0.56 | BioGRID, IntAct |
| MAFG | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MAFK | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MAPK8 | Affinity Capture-Western | physical | 15184502, (Europe PMC) | NA | BioGRID |
| MAPK9 | Affinity Capture-Western | physical | 15184502, 15958558, (Europe PMC) | NA | BioGRID |
| MBD3 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MCM2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MCRS1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MED31 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MEF2D | Affinity Capture-Western, Reconstituted Complex | physical | 10944115, (Europe PMC) | NA | BioGRID |
| MRE11 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MRPL17 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MRPL39 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MTA1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MTA2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MTHFD2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| NFATC1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| NFATC2 | Co-crystal Structure, Reconstituted Complex, electrophoretic mobility shift assay, x-ray crystallography | direct interaction, physical, physical association | 12949493, 18462673, 19060202, (Europe PMC) | 0.40, 0.44 | BioGRID, IntAct |
| NFYB | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| NFYC | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| NUDC | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| PARP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| PIN1 | Reconstituted Complex | physical | 11356192, (Europe PMC) | NA | BioGRID |
| PLK1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| PMPCB | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| POGZ | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| POLDIP2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| POLG | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| POLR1C | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| PPP1CA | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| PPP2R1A | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 21983832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRDM15 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| PRKCZ | Affinity Capture-Western, Biochemical Activity | physical | 12021260, (Europe PMC) | NA | BioGRID |
| PRKDC | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RAD50 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RANBP2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RANBP9 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RB1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RBBP4 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RCOR1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RFC2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RFC3 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RFC4 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RFC5 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RNGTT | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RPA1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RPA2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RPA3 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RPL23 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RPTOR | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RUNX1 | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SATB1 | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SCAI | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SDHA | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SMARCA4 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SMARCA5 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SMARCC1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SMARCC2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SMARCD1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SMARCD2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SMARCE1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SSBP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SSRP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SUCLA2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SUPT5H | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SUPT6H | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SUV39H1 | Affinity Capture-Western | physical | 22079596, (Europe PMC) | NA | BioGRID |
| TAF9 | Reconstituted Complex | physical | 10821850, (Europe PMC) | NA | BioGRID |
| TCF12 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TCP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TFAM | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TFAP4 | Affinity Capture-MS, Affinity Capture-Western | physical | 19505873, (Europe PMC) | NA | BioGRID |
| TIMM50 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TLK1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TLK2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TNPO1 | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 21983832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TP53BP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TRRAP | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TUBA1A | Affinity Capture-Western | physical | 21278340, (Europe PMC) | NA | BioGRID |
| TUFM | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| UBE2S | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| UHRF1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| UQCRC2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| USP22 | Affinity Capture-Western, anti tag coimmunoprecipitation | physical, physical association | 24561192, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| VAPA | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| VAPB | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| VIM | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| WDR26 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| WDR48 | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| XRCC1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| XRCC5 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| XRCC6 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| YWHAB | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| YWHAE | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| YWHAG | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| YWHAQ | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| YWHAZ | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ZMYM2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ZNF131 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ZNF148 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ZNF217 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ZNF24 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ZNF384 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| CREBBP | Reconstituted Complex, pull down | direct interaction, physical | 19060202, 9625762, (Europe PMC) | 0.44 | BioGRID, IntAct |
| CSE1L | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 21983832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EBI-11291786 | pull down | physical association | 16517728, (Europe PMC) | 0.40 | IntAct |
| EBI-11291799 | pull down | physical association | 16517728, (Europe PMC) | 0.40 | IntAct |
| EBI-2694074 | pull down | association | 19505873, (Europe PMC) | 0.35 | IntAct |
| ENSG00000049768 | chromatin immunoprecipitation assay | association | 16517728, (Europe PMC) | 0.35 | IntAct |
| ENSG00000109471 | chromatin immunoprecipitation assay | association | 18769450, 20557936, (Europe PMC) | 0.53 | IntAct |
| FOS | Affinity Capture-MS, Affinity Capture-Western, fluorescent resonance energy transfer | physical, physical association | 18172215, 27637333, (Europe PMC) | 0.40 | BioGRID, IntAct |
| IQGAP1 | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 21983832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JUN | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, pull down, tandem affinity purification | association, direct interaction, physical, physical association | 20557936, 25609649, 27637333, (Europe PMC) | 0.35, 0.59 | BioGRID, IntAct, MINT |
| LRRK2 | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical, physical association | 21983832, (Europe PMC) | 0.56 | BioGRID, IntAct |
| MED31 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NFATC2 | Co-crystal Structure, Reconstituted Complex, electrophoretic mobility shift assay, x-ray crystallography | direct interaction, physical, physical association | 12949493, 18462673, 19060202, (Europe PMC) | 0.40, 0.44 | BioGRID, IntAct |
| PPP2R1A | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 21983832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP3CA | fluorescence polarization spectroscopy, surface plasmon resonance | direct interaction | 24954618, (Europe PMC) | 0.56 | IntAct |
| RIPK2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TNPO1 | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 21983832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| USP22 | Affinity Capture-Western, anti tag coimmunoprecipitation | physical, physical association | 24561192, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| VIM | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| VRK2 | anti tag coimmunoprecipitation, protein kinase assay, pull down | direct interaction, phosphorylation reaction, physical association | 23105117, (Europe PMC) | 0.61 | IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| JUN | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, pull down, tandem affinity purification | association, direct interaction, physical, physical association | 20557936, 25609649, 27637333, (Europe PMC) | 0.35, 0.59 | BioGRID, IntAct, MINT |
| USP22 | Affinity Capture-Western, anti tag coimmunoprecipitation | physical, physical association | 24561192, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ADNP | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| AIFM1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ALDH18A1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ARID1A | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ATF7 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| BCL11B | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| BEND3 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| BTAF1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CABIN1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CACYBP | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CAD | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CBX1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CBX3 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CBX5 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CEBPE | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CHAF1B | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CHAMP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CHD4 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CHEK1 | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CNP | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CREB1 | Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification | association, physical, physical association | 25609649, 27637333, (Europe PMC) | 0.50 | BioGRID, IntAct, MINT |
| CREBBP | Reconstituted Complex, pull down | direct interaction, physical | 19060202, 9625762, (Europe PMC) | 0.44 | BioGRID, IntAct |
| CSE1L | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 21983832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSNK1D | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CSTF1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| CTBP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| DCAF7 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| DEK | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| DNAJA1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| DPF2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| EBI-11291786 | pull down | physical association | 16517728, (Europe PMC) | 0.40 | IntAct |
| EBI-11291799 | pull down | physical association | 16517728, (Europe PMC) | 0.40 | IntAct |
| EBI-2694074 | pull down | association | 19505873, (Europe PMC) | 0.35 | IntAct |
| EEF2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| EGR1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| EMD | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ENSG00000049768 | chromatin immunoprecipitation assay | association | 16517728, (Europe PMC) | 0.35 | IntAct |
| ENSG00000109471 | chromatin immunoprecipitation assay | association | 18769450, 20557936, (Europe PMC) | 0.53 | IntAct |
| EP300 | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, 9625762, (Europe PMC) | NA | BioGRID |
| ERAL1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ERCC3 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ETV6 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| FOS | Affinity Capture-MS, Affinity Capture-Western, fluorescent resonance energy transfer | physical, physical association | 18172215, 27637333, (Europe PMC) | 0.40 | BioGRID, IntAct |
| FOXK1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| FOXP3 | Co-localization | physical | 19564342, (Europe PMC) | NA | BioGRID |
| GATAD2A | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| GATAD2B | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| GNB2 | Affinity Capture-Western | physical | 23326349, (Europe PMC) | NA | BioGRID |
| GSK3B | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| GTF2H2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| GTF2H2C | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| GTF2H2C_2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| GTF3C4 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| GTF3C5 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| H2AFY | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HADHA | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HDAC1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HIRA | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HLTF | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HNRNPA1 | Affinity Capture-MS | physical | 22446626, (Europe PMC) | NA | BioGRID |
| HSPA1A | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HSPA5 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HSPA8 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HSPA9 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| HSPH1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| IDH3A | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| IDH3B | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| IFI16 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| IKZF1 | Affinity Capture-MS, Affinity Capture-Western, Co-localization | physical | 27637333, (Europe PMC) | NA | BioGRID |
| IKZF2 | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| IQGAP1 | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 21983832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IRF2BP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| IRF2BP2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 21576369, 27637333, (Europe PMC) | NA | BioGRID |
| IRF4 | Affinity Capture-Western | physical | 11956291, (Europe PMC) | NA | BioGRID |
| JUN | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, pull down, tandem affinity purification | association, direct interaction, physical, physical association | 20557936, 25609649, 27637333, (Europe PMC) | 0.35, 0.59 | BioGRID, IntAct, MINT |
| JUNB | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| JUND | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| KDM1A | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| KIF2C | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| KIF4A | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| KPNB1 | Affinity Capture-Western | physical | 21278340, (Europe PMC) | NA | BioGRID |
| LEF1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| LIG3 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| LRRC47 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| LRRK2 | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical, physical association | 21983832, (Europe PMC) | 0.56 | BioGRID, IntAct |
| MAFG | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MAFK | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MAPK8 | Affinity Capture-Western | physical | 15184502, (Europe PMC) | NA | BioGRID |
| MAPK9 | Affinity Capture-Western | physical | 15184502, 15958558, (Europe PMC) | NA | BioGRID |
| MBD3 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MCM2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MCRS1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MED31 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MEF2D | Affinity Capture-Western, Reconstituted Complex | physical | 10944115, (Europe PMC) | NA | BioGRID |
| MRE11 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MRPL17 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MRPL39 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MTA1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MTA2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| MTHFD2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| NFATC1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| NFATC2 | Co-crystal Structure, Reconstituted Complex, electrophoretic mobility shift assay, x-ray crystallography | direct interaction, physical, physical association | 12949493, 18462673, 19060202, (Europe PMC) | 0.40, 0.44 | BioGRID, IntAct |
| NFYB | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| NFYC | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| NUDC | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| PARP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| PIN1 | Reconstituted Complex | physical | 11356192, (Europe PMC) | NA | BioGRID |
| PLK1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| PMPCB | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| POGZ | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| POLDIP2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| POLG | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| POLR1C | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| PPP1CA | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| PPP2R1A | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 21983832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP3CA | fluorescence polarization spectroscopy, surface plasmon resonance | direct interaction | 24954618, (Europe PMC) | 0.56 | IntAct |
| PRDM15 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| PRKCZ | Affinity Capture-Western, Biochemical Activity | physical | 12021260, (Europe PMC) | NA | BioGRID |
| PRKDC | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RAD50 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RANBP2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RANBP9 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RB1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RBBP4 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RCOR1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RFC2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RFC3 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RFC4 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RFC5 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RIPK2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| RNGTT | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RPA1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RPA2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RPA3 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RPL23 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RPTOR | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| RUNX1 | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SATB1 | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SCAI | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SDHA | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SMARCA4 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SMARCA5 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SMARCC1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SMARCC2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SMARCD1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SMARCD2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SMARCE1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SSBP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SSRP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SUCLA2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SUPT5H | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SUPT6H | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| SUV39H1 | Affinity Capture-Western | physical | 22079596, (Europe PMC) | NA | BioGRID |
| TAF9 | Reconstituted Complex | physical | 10821850, (Europe PMC) | NA | BioGRID |
| TCF12 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TCP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TFAM | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TFAP4 | Affinity Capture-MS, Affinity Capture-Western | physical | 19505873, (Europe PMC) | NA | BioGRID |
| TIMM50 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TLK1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TLK2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TNPO1 | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 21983832, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TP53BP1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TRRAP | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| TUBA1A | Affinity Capture-Western | physical | 21278340, (Europe PMC) | NA | BioGRID |
| TUFM | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| UBE2S | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| UHRF1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| UQCRC2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| USP22 | Affinity Capture-Western, anti tag coimmunoprecipitation | physical, physical association | 24561192, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| VAPA | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| VAPB | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| VIM | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| VRK2 | anti tag coimmunoprecipitation, protein kinase assay, pull down | direct interaction, phosphorylation reaction, physical association | 23105117, (Europe PMC) | 0.61 | IntAct |
| WDR26 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| WDR48 | Affinity Capture-MS, Affinity Capture-Western | physical | 27637333, (Europe PMC) | NA | BioGRID |
| XRCC1 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| XRCC5 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| XRCC6 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| YWHAB | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| YWHAE | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| YWHAG | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| YWHAQ | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| YWHAZ | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ZMYM2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ZNF131 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ZNF148 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ZNF217 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ZNF24 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| ZNF384 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |