- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
EZR
Gene Name  | EZR (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 4RMA |
| Synonyms | EZR, VIL2 | |
| Protein Name | EZR | |
| Alternative Name(s) | Ezrin;Cytovillin;Villin-2;p81; | |
| Protein Family | noSimilarity_annotations | |
| EntrezGene ID | 7430 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P15311 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 69413 Dalton | |
| Protein Length | 586 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000092820 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG3529 | eggNOG - ENOG410XQFP | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Apical cell membrane Cell projection Cell projection, microvillusmembrane Cell projection, ruffle membrane Cytoplasm, cell cortex Cytoplasm, cytoskeleton Cell projection, microvillus Note=Localization to the apicalmembrane of parietal cells depends on the interaction with MPP5Localizes to cell extensions and peripheral processes ofastrocytes (By similarity) Microvillar peripheral membraneprotein (cytoplasmic side) | |||
| Function (UniProt annotation) | |||
| Probably involved in connections of major cytoskeletalstructures to the plasma membrane In epithelial cells, requiredfor the formation of microvilli and membrane ruffles on the apicalpole Along with PLEKHG6, required for normal macropinocytosis | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKF RAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQ HKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLER QQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAK EELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP VSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQ GRDKYKTLRQIRQGNTKQRIDEFEAL | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| MOD_CDK_SPK_2 | 232-DKLTPK-237 | CDK Phosphorylation Site | ...([ST])P[RK] |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000122 | P:negative regulation of transcription by RNA polymerase II |
| GO:0001650 | C:fibrillar center |
| GO:0001726 | C:ruffle |
| GO:0001772 | C:immunological synapse |
| GO:0001931 | C:uropod |
| GO:0001951 | P:intestinal D-glucose absorption |
| GO:0003376 | P:sphingosine-1-phosphate receptor signaling pathway |
| GO:0003723 | F:RNA binding |
| GO:0003779 | F:actin binding |
| GO:0005615 | C:extracellular space |
| GO:0005737 | C:cytoplasm |
| GO:0005768 | C:endosome |
| GO:0005829 | C:cytosol |
| GO:0005884 | C:actin filament |
| GO:0005886 | C:plasma membrane |
| GO:0005902 | C:microvillus |
| GO:0005903 | C:brush border |
| GO:0005925 | C:focal adhesion |
| GO:0007016 | P:cytoskeletal anchoring at plasma membrane |
| GO:0007159 | P:leukocyte cell-cell adhesion |
| GO:0007411 | P:axon guidance |
| GO:0008017 | F:microtubule binding |
| GO:0008022 | F:protein C-terminus binding |
| GO:0008360 | P:regulation of cell shape |
| GO:0010628 | P:positive regulation of gene expression |
| GO:0010737 | P:protein kinase A signaling |
| GO:0015629 | C:actin cytoskeleton |
| GO:0016020 | C:membrane |
| GO:0016323 | C:basolateral plasma membrane |
| GO:0016324 | C:apical plasma membrane |
| GO:0019898 | C:extrinsic component of membrane |
| GO:0019904 | F:protein domain specific binding |
| GO:0022614 | P:membrane to membrane docking |
| GO:0030033 | P:microvillus assembly |
| GO:0030175 | C:filopodium |
| GO:0030315 | C:T-tubule |
| GO:0030863 | C:cortical cytoskeleton |
| GO:0030953 | P:astral microtubule organization |
| GO:0031528 | C:microvillus membrane |
| GO:0031532 | P:actin cytoskeleton reorganization |
| GO:0031623 | P:receptor internalization |
| GO:0031982 | C:vesicle |
| GO:0032532 | P:regulation of microvillus length |
| GO:0032587 | C:ruffle membrane |
| GO:0032991 | C:protein-containing complex |
| GO:0034236 | F:protein kinase A catalytic subunit binding |
| GO:0034237 | F:protein kinase A regulatory subunit binding |
| GO:0034629 | P:cellular protein-containing complex localization |
| GO:0035088 | P:establishment or maintenance of apical/basal cell polarity |
| GO:0036064 | C:ciliary basal body |
| GO:0040018 | P:positive regulation of multicellular organism growth |
| GO:0042802 | F:identical protein binding |
| GO:0042995 | C:cell projection |
| GO:0043209 | C:myelin sheath |
| GO:0043622 | P:cortical microtubule organization |
| GO:0044297 | C:cell body |
| GO:0044393 | C:microspike |
| GO:0044548 | F:S100 protein binding |
| GO:0044853 | C:plasma membrane raft |
| GO:0045177 | C:apical part of cell |
| GO:0045296 | F:cadherin binding |
| GO:0046847 | P:filopodium assembly |
| GO:0048015 | P:phosphatidylinositol-mediated signaling |
| GO:0048471 | C:perinuclear region of cytoplasm |
| GO:0050714 | P:positive regulation of protein secretion |
| GO:0050839 | F:cell adhesion molecule binding |
| GO:0050860 | P:negative regulation of T cell receptor signaling pathway |
| GO:0051015 | F:actin filament binding |
| GO:0051017 | P:actin filament bundle assembly |
| GO:0051018 | F:protein kinase A binding |
| GO:0051117 | F:ATPase binding |
| GO:0051286 | C:cell tip |
| GO:0051660 | P:establishment of centrosome localization |
| GO:0061028 | P:establishment of endothelial barrier |
| GO:0070062 | C:extracellular exosome |
| GO:0070373 | P:negative regulation of ERK1 and ERK2 cascade |
| GO:0071320 | P:cellular response to cAMP |
| GO:0071437 | C:invadopodium |
| GO:0071944 | C:cell periphery |
| GO:0072659 | P:protein localization to plasma membrane |
| GO:0072697 | P:protein localization to cell cortex |
| GO:0097449 | C:astrocyte projection |
| GO:0097454 | C:Schwann cell microvillus |
| GO:0097718 | F:disordered domain specific binding |
| GO:0098592 | C:cytoplasmic side of apical plasma membrane |
| GO:1900041 | P:negative regulation of interleukin-2 secretion |
| GO:1902115 | P:regulation of organelle assembly |
| GO:1902896 | P:terminal web assembly |
| GO:1902966 | P:positive regulation of protein localization to early endosome |
| GO:1903078 | P:positive regulation of protein localization to plasma membrane |
| GO:1903364 | P:positive regulation of cellular protein catabolic process |
| GO:1903753 | P:negative regulation of p38MAPK cascade |
| GO:2000643 | P:positive regulation of early endosome to late endosome transport |
EZR is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in EZR (P15311) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PTP4A3 | O75365 | Thr-567_RDKYKtLRQIR, | In vitro and in vivo | 18078820, | Europe PMC |  |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04530 | Tight junction | Tight junctions (TJs) are essential for establishing a selectively permeable barrier to diffusion through the paracellular space between neighboring cells. TJs are composed of at least three types of transmembrane protein -occludin, claudin and junctional adhesion molecules (JAMs)- and a cytoplasmic 'plaque' consisting of many different proteins that form large complexes. These are proposed to be involved in junction assembly, barrier regulation, cell polarity, gene transcription, and other pathways. |
| hsa04670 | Leukocyte transendothelial migration | Leukocyte migaration from the blood into tissues is vital for immune surveillance and inflammation. During this diapedesis of leukocytes, the leukocytes bind to endothelial cell adhesion molecules (CAM) and then migrate across the vascular endothelium. A leukocyte adherent to CAMs on the endothelial cells moves forward by leading-edge protrusion and retraction of its tail. In this process, alphaL /beta2 integrin activates through Vav1, RhoA, which subsequently activates the kinase p160ROCK. ROCK activation leads to MLC phosphorylation, resulting in retraction of the actin cytoskeleton. Moreover, Leukocytes activate endothelial cell signals that stimulate endothelial cell retraction during localized dissociation of the endothelial cell junctions. ICAM-1-mediated signals activate an endothelial cell calcium flux and PKC, which are required for ICAM-1 dependent leukocyte migration. VCAM-1 is involved in the opening of the endothelial passagethrough which leukocytes can extravasate. In this regard, VCAM-1 ligation induces NADPH oxidase activation and the production of reactive oxygen species (ROS) in a Rac-mediated manner, with subsequent activation of matrix metallopoteinases and loss of VE-cadherin-mediated adhesion. |
| hsa04810 | Regulation of actin cytoskeleton | |
| hsa04971 | Gastric acid secretion | Gastric acid is a key factor in normal upper gastrointestinal functions, including protein digestion and calcium and iron absorption, as well as providing some protection against bacterial infections. The principal stimulants of acid secretion at the level of the parietal cell are histamine (paracrine), gastrin (hormonal), and acetycholine (ACh; neurocrine). Stimulation of acid secretion typically involves an initial elevation of intracellular calcium and cAMP, followed by activation of protein kinase cascades, which trigger the translocation of the proton pump, H+,K+-ATPase, from cytoplasmic tubulovesicles to the apical plasma membrane and thereby H+ secretion into the stomach lumen. |
| hsa05130 | Pathogenic Escherichia coli infection | Enteropathogenic E. coli (EPEC) and enterohemorrhagic E. coli (EHEC) are closely related pathogenic strains of Escherichia coli. The hallmark of EPEC/EHEC infections [DS:H00278 H00277] is induction of attaching and effacing (A/E) lesions that damage intestinal epithelial cells. The capacity to form A/E lesions is encoded mainly by the locus of enterocyte effacement (LEE) pathogenicity island. Tir, Map, EspF, EspG are known LEE-encoded effector proteins secreted via the type III secretion system, which is also LEE-encoded, into the host cell. EPEC and EHEC Tir's link the extracellular bacterium to the cell cytoskeleton. Map and EspF are involved in mitochondrion membrane permeabilization. EspG interacts with tubulins and stimulates microtubule destabilization. LEE-encoded adhesin or intimin (Eae) is exported via the general secretory pathway to the periplasm, where it is inserted into the outer membrane. In addition to Tir, two potential host cell-carried intimin receptors, beta1 integrin (ITGB1) and nucleolin (NCL), have so far been identified. The distinguishing feature of EHEC is the elaboration of Shiga-like toxin (Stx). Stx cleaves ribosomal RNA, thereby disrupting protein synthesis and killing the intoxicated epithelial or endothelial cells. |
| hsa05205 | Proteoglycans in cancer | Many proteoglycans (PGs) in the tumor microenvironment have been shown to be key macromolecules that contribute to biology of various types of cancer including proliferation, adhesion, angiogenesis and metastasis, affecting tumor progress. The four main types of proteoglycans include hyaluronan (HA), which does not occur as a PG but in free form, heparan sulfate proteoglycans (HSPGs), chondroitin sulfate proteoglycans (CSPGs), dematan sulfate proteoglycans (DSPG) and keratan sulfate proteoglycans (KSPGs) [BR:00535]. Among these proteoglycans such as HA, acting with CD44, promotes tumor cell growth and migration, whereas other proteoglycans such as syndecans (-1~-4), glypican (-1, -3) and perlecan may interact with growth factors, cytokines, morphogens and enzymes through HS chains [BR: 00536], also leading to tumor growth and invasion. In contrast, some of the small leucine-rich proteolgycans, such as decorin and lumican, can function as tumor repressors, and modulate the signaling pathways by the interaction of their core proteins and multiple receptors. |
| hsa05206 | MicroRNAs in cancer | MicroRNA (miRNA) is a cluster of small non-encoding RNA molecules of 21 - 23 nucleotides in length, which controls gene expression post-transcriptionally either via the degradation of target mRNAs or the inhibition of protein translation. Using high-throughput profiling, dysregulation of miRNAs has been widely observed in different stages of cancer. The upregulation (overexpression) of specific miRNAs could lead to the repression of tumor suppressor gene expression, and conversely the downregulation of specific miRNAs could result in an increase of oncogene expression; both these situations induce subsequent malignant effects on cell proliferation, differentiation, and apoptosis that lead to tumor growth and progress. The miRNA signatures of cancer observed in various studies differ significantly. These inconsistencies occur due to the differences in the study populations and methodologies used. This pathway map shows the summarized results from various studies in 9 cancers, each of which is presented in a review article. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-373752 | Netrin-1 signaling. | Netrins are secreted proteins that play a crucial role in neuronal migration and in axon guidance during the development of the nervous system. To date, several Netrins have been described in mouse and humans: Netrin-1, -3/NTL2, -4/h and G-Netrins. Netrin-1 is the most studied member of the family and has been shown to play a crucial role in neuronal navigation during nervous system development mainly through its interaction with its receptors DCC and UNC5. Members of the Deleted in colorectal cancer (DCC) family- which includes DCC and Neogenin in vertebrates- mediate netrin-induced axon attraction, whereas the C. elegans UNC5 receptor and its four vertebrate homologs Unc5a-Unc5d mediate repulsion |
| R-HSA-437239 | Recycling pathway of L1. | L1 functions in many aspects of neuronal development including axon outgrowth and neuronal migration. These functions require coordination between L1 and the actin cytoskeleton. F-actin continuously moves in a retrograde direction from the P-(peripheral) domain of the growth cone towards the growth cone's C-(central) domain. L1, attached to the actin cytoskeleton via membrane cytoskeletal linkers (MCKs) such as ankyrins (Ankyrin-G, -B and -R) and members of the ERMs (ezrin, radixin, and moesin) family, link this retrograde F-actin flow with extracellular immobile ligands.Forward translocation of growth cone requires not only the CAM-actin linkage but also a gradient of cell substrate adhesion (strong adhesion at the front and weak adhesion at the rear) so that the cytoskeletal machinery is able to pull the cell forward as attachments at the rear are released. This asymmetry is achieved in part by internalizing L1 molecules as they are moved to the rear of the growth cone coupled to retrograde F-actin flow and recycling them to the leading edge plasma membrane.L1 internalization is mediated by phosphorylation and dephosphorylation. The L1 cytoplasmic domain (L1CD) carries an endocytic or sorting motif, YRSLE, that is recognized by the clathrin associated adaptor protein-2 (AP-2). AP-2 binds the YRSLE motif only when its tyrosine is not phosphorylated and triggers L1 endocytosis. SRC kinase associated with lipid rafts in the P-domain membrane phosphorylates L1 molecules on tyrosine-1176, stabilizing them in the plasma membrane. L1 endocytosis is triggered by the dephosphorylation of Y1176 within the C domain. Some of these internalized L1 molecules are transported in an anterograde direction along microtubules for reuse in the leading edge |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACTN1 | Co-fractionation, pull down | association, physical | 22939629, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ADORA2B | Affinity Capture-Western | physical | 12080047, (Europe PMC) | NA | BioGRID |
| AHNAK | Affinity Capture-MS, pull down | association, physical | 14625392, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AKR1B1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ARHGDIA | Co-fractionation, Co-purification, anti bait coimmunoprecipitation, fluorescence microscopy | colocalization, physical, physical association | 15659383, 20711218, 26344197, (Europe PMC) | 0.46 | BioGRID, IntAct |
| ARPC3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| ASB6 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| AURKA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| B4GALT7 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BAG3 | Affinity Capture-MS | physical | 23824909, (Europe PMC) | NA | BioGRID |
| BID | Co-purification | physical | 15659383, (Europe PMC) | NA | BioGRID |
| BRCA1 | Affinity Capture-MS, Affinity Capture-Western | physical | 21282464, 26831064, (Europe PMC) | NA | BioGRID |
| CALR | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CASP10 | Co-purification | physical | 15659383, (Europe PMC) | NA | BioGRID |
| CASP8 | Co-purification | physical | 15659383, (Europe PMC) | NA | BioGRID |
| CD44 | Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 12032545, 20711218, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CDH1 | Affinity Capture-Western, Proximity Label-MS | physical | 10462524, 25468996, (Europe PMC) | NA | BioGRID |
| CFTR | Affinity Capture-MS, Affinity Capture-Western | physical | 10893422, 26618866, (Europe PMC) | NA | BioGRID |
| CLIC4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CLIC5 | Reconstituted Complex | physical | 10793131, (Europe PMC) | NA | BioGRID |
| CROCC | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CTNNB1 | Affinity Capture-Western | physical | 10462524, (Europe PMC) | NA | BioGRID |
| CUL7 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| DCC | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 20434207, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DGKQ | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| DLG1 | Reconstituted Complex | physical | 11726633, (Europe PMC) | NA | BioGRID |
| DNM1L | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ECE2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EGFR | PCA, ubiquitin reconstruction | physical, physical association | 24658140, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EIF5A2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EIF5AL1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| ENO1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ENO2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ERBB2 | Co-localization, FRET, ubiquitin reconstruction | physical, physical association | 24658140, 27029001, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EZR | Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid | association, physical, physical association | 11285285, 21988832, 29568061, 9501018, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| FABP5 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| FADD | Affinity Capture-MS, Co-localization, Co-purification, proximity ligation assay | physical, physical association | 15659383, 21183682, 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| FAS | Co-purification | physical | 15659383, (Europe PMC) | NA | BioGRID |
| FASLG | Affinity Capture-Western, Co-purification | physical | 11013215, 15659383, (Europe PMC) | NA | BioGRID |
| FBXO6 | Affinity Capture-MS | physical | 22268729, (Europe PMC) | NA | BioGRID |
| FH | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| FKBP9 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| FN1 | Affinity Capture-MS | physical | 19738201, (Europe PMC) | NA | BioGRID |
| FOXA1 | Affinity Capture-MS | physical | 27926873, (Europe PMC) | NA | BioGRID |
| GABARAPL2 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| GDI2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GNPDA1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| GPX4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GTF3C4 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| GZMM | Biochemical Activity | physical | 18523284, (Europe PMC) | NA | BioGRID |
| H2AFZ | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| HEXA | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| HEXB | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| HEY1 | Affinity Capture-MS | physical | 27129302, (Europe PMC) | NA | BioGRID |
| HLA-B | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| HSD17B10 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HSPA4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HSPA4L | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HSPE1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HSPH1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ICAM1 | Affinity Capture-Western, Reconstituted Complex | physical | 9705328, (Europe PMC) | NA | BioGRID |
| ICAM2 | Affinity Capture-Western, Reconstituted Complex | physical | 9705328, (Europe PMC) | NA | BioGRID |
| ICAM3 | Affinity Capture-Western, Reconstituted Complex | physical | 11784723, 9705328, (Europe PMC) | NA | BioGRID |
| IPO5 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| IQGAP1 | Reconstituted Complex | physical | 10793131, (Europe PMC) | NA | BioGRID |
| ISG15 | Affinity Capture-MS | physical | 16009940, (Europe PMC) | NA | BioGRID |
| ISYNA1 | Co-fractionation, proximity-dependent biotin identification | association, physical | 26344197, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| L1CAM | Affinity Capture-Western, Reconstituted Complex | physical | 12070130, 22846990, (Europe PMC) | NA | BioGRID |
| LASP1 | Affinity Capture-MS | physical | 25982273, (Europe PMC) | NA | BioGRID |
| LCP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MAPK10 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAPK8 | Co-purification | physical | 15659383, (Europe PMC) | NA | BioGRID |
| MC1R | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| MCC | Affinity Capture-MS, anti bait coimmunoprecipitation, pull down | physical, physical association | 17353931, 19555689, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MDM2 | Reconstituted Complex, display technology, tandem affinity purification | physical, physical association | 20195357, (Europe PMC) | 0.52 | BioGRID, IntAct |
| MISP | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MPP3 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MRPL12 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MSN | Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex | physical | 15659383, 26496610, 7579708, 8248180, (Europe PMC) | NA | BioGRID |
| NF2 | Affinity Capture-Western, Far Western, Reconstituted Complex | physical | 10036239, 17891137, (Europe PMC) | NA | BioGRID |
| NOLC1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| OAT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| OBSL1 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| OGFOD1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| P4HB | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PALLD | Far Western, Reconstituted Complex, Two-hybrid | physical | 11598191, (Europe PMC) | NA | BioGRID |
| PDCD10 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PDCD6IP | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PDXK | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PGD | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PHLPP2 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PIK3R1 | Affinity Capture-Western, Reconstituted Complex, pull down | association, physical | 10377409, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| PLS1 | Co-fractionation, proximity-dependent biotin identification | association, physical | 26344197, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PLS3 | Co-fractionation, proximity-dependent biotin identification | association, physical | 26344197, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPA2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PPL | Affinity Capture-MS | physical | 14625392, (Europe PMC) | NA | BioGRID |
| PPME1 | Affinity Capture-MS | physical | 26499835, (Europe PMC) | NA | BioGRID |
| PRKAB1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PRKCA | Affinity Capture-Western | physical | 11387207, (Europe PMC) | NA | BioGRID |
| PRX | Affinity Capture-MS | physical | 14625392, (Europe PMC) | NA | BioGRID |
| PTK2 | Reconstituted Complex | physical | 11468295, (Europe PMC) | NA | BioGRID |
| PTPRQ | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PTTG1 | Synthetic Growth Defect | genetic | 24104479, (Europe PMC) | NA | BioGRID |
| PYGL | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| RCN1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| RDX | Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach | association, physical, physical association | 22939629, 23414517, 26496610, 29568061, (Europe PMC) | 0.70 | BioGRID, IntAct |
| RHOA | Co-purification | physical | 15659383, (Europe PMC) | NA | BioGRID |
| RIC8A | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| S100P | Affinity Capture-MS, Reconstituted Complex | physical | 12808036, (Europe PMC) | NA | BioGRID |
| SCARNA22 | Affinity Capture-RNA | physical | 22751105, (Europe PMC) | NA | BioGRID |
| SCYL3 | Two-hybrid, confocal microscopy, two hybrid | physical, physical association | 12651155, (Europe PMC) | 0.46 | BioGRID, IntAct |
| SDC2 | Affinity Capture-Western, Reconstituted Complex | physical | 10704377, (Europe PMC) | NA | BioGRID |
| SELL | Reconstituted Complex | physical | 11706008, (Europe PMC) | NA | BioGRID |
| SELP | Reconstituted Complex | physical | 10733515, (Europe PMC) | NA | BioGRID |
| SHMT2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SLC9A3R1 | Affinity Capture-Western, Co-fractionation, Reconstituted Complex, affinity chromatography technology, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach | association, physical, physical association | 11285285, 11684085, 15020681, 23414517, 26344197, 29568061, 9314537, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| SLC9A3R2 | Affinity Capture-Western, Reconstituted Complex, two hybrid fragment pooling approach | physical, physical association | 12080047, 23414517, 9748260, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SPN | Affinity Capture-Western, Reconstituted Complex | physical | 9616160, (Europe PMC) | NA | BioGRID |
| SPTA1 | Affinity Capture-MS | physical | 14625392, (Europe PMC) | NA | BioGRID |
| STIP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TAGLN2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TIMM13 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TKT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TNFRSF10B | Co-purification | physical | 15659383, (Europe PMC) | NA | BioGRID |
| TNFRSF1A | Co-purification | physical | 15659383, (Europe PMC) | NA | BioGRID |
| TPD52 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TPD52L2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TRNT1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| TSC1 | Affinity Capture-Western | physical | 10806479, (Europe PMC) | NA | BioGRID |
| TSPAN33 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| TXNRD2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| U2AF2 | Affinity Capture-MS | physical | 26641092, (Europe PMC) | NA | BioGRID |
| UBA1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| UBE2R2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| UCHL3 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| VCAM1 | Affinity Capture-Western, Reconstituted Complex | physical | 12082081, (Europe PMC) | NA | BioGRID |
| VPS11 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 21148287, (Europe PMC) | NA | BioGRID |
| WDR1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| WFDC1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| WWP1 | Affinity Capture-Western | physical | 22629406, (Europe PMC) | NA | BioGRID |
| XPNPEP1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABCF2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ABI1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ABI2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ABR | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ACTN1 | Co-fractionation, pull down | association, physical | 22939629, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ACTR10 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ADD3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| AFDN | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| AHCYL2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| AHNAK | Affinity Capture-MS, pull down | association, physical | 14625392, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AKAP12 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| AKAP2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ANK2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ANK3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| AP2A1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ARFGAP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ARHGAP35 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ARHGDIA | Co-fractionation, Co-purification, anti bait coimmunoprecipitation, fluorescence microscopy | colocalization, physical, physical association | 15659383, 20711218, 26344197, (Europe PMC) | 0.46 | BioGRID, IntAct |
| ASAP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| B4GALT7 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BAIAP2L1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| BCL11A | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| BCR | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| C1orf198 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| C6orf132 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CAPN1 | protease assay | cleavage reaction | 22805611, (Europe PMC) | 0.44 | IntAct, MINT |
| CAPN6 | pull down | physical association | 11285285, (Europe PMC) | 0.40 | IntAct, MINT |
| CASK | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CAST | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CCDC124 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CD44 | Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 12032545, 20711218, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CNOT8 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| COBL | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| COBLL1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CTNND1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CYFIP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CYFIP2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CYLD | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DCC | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 20434207, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX18 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DDX6 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DIP2B | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DLG1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DNM1L | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DOCK7 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DSG2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DST | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DVL3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EBI-1059081 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| ECD | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EEF2K | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EFHD1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EGFR | PCA, ubiquitin reconstruction | physical, physical association | 24658140, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EGLN1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EHBP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EIF2A | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EIF4G3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ELP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ELP3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ENAH | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EPB41 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EPB41L1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EPHA2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ERBB2 | Co-localization, FRET, ubiquitin reconstruction | physical, physical association | 24658140, 27029001, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ERBIN | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EZR | Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid | association, physical, physical association | 11285285, 21988832, 29568061, 9501018, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| FADD | Affinity Capture-MS, Co-localization, Co-purification, proximity ligation assay | physical, physical association | 15659383, 21183682, 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| FAM129B | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| FAM135A | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| FAM207A | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| FARSB | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| FCHO2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| FERMT2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| FES | anti bait coimmunoprecipitation, coimmunoprecipitation, fluorescence microscopy, pull down, two hybrid | association, colocalization, direct interaction, physical association | 18046454, (Europe PMC) | 0.68 | IntAct, MINT |
| FTSJ3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| GAB1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL2 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| GOLGB1 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| GPRIN1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| HAUS6 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| HDAC1 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| HGS | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| HLA-B | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| HSPA1A | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| HTT | two hybrid | physical association | 17500595, (Europe PMC) | 0.37 | IntAct |
| ICAM5 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| IKBKE | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| ISYNA1 | Co-fractionation, proximity-dependent biotin identification | association, physical | 26344197, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ITSN1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ITSN2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KARS | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| KIAA1211 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| KIF5C | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| KLC4 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| LIMCH1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| LIN7C | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| LRBA | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| LSM1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| LYAR | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| LZTFL1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MACROD2 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MAP3K7 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MAPK10 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAPT | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MCC | Affinity Capture-MS, anti bait coimmunoprecipitation, pull down | physical, physical association | 17353931, 19555689, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| MDM2 | Reconstituted Complex, display technology, tandem affinity purification | physical, physical association | 20195357, (Europe PMC) | 0.52 | BioGRID, IntAct |
| MGEA5 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MPP3 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MPRIP | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MSN | anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down | association | 26496610, 29568061, (Europe PMC) | 0.60 | IntAct |
| MTMR1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MYH13 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MYO1B | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MYO6 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| NCKAP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| NDRG1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| NMT1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| NOLC1 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| NOTCH2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| NUMB | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| NUMBL | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| NUP107 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| OCRL | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| OTUB1 | anti tag coimmunoprecipitation | association | 26752685, (Europe PMC) | 0.35 | IntAct |
| PACSIN2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PAK4 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PALM2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PALMD | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PARG | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PCBP2 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PDLIM1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PEAK1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PGAM5 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PHACTR4 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PHLPP2 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PIK3R1 | Affinity Capture-Western, Reconstituted Complex, pull down | association, physical | 10377409, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| PINX1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| PKN2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PLCB3 | pull down | physical association | 11285285, (Europe PMC) | 0.40 | IntAct, MINT |
| PLEKHA1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| PLS1 | Co-fractionation, proximity-dependent biotin identification | association, physical | 26344197, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PLS3 | Co-fractionation, proximity-dependent biotin identification | association, physical | 26344197, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| POLDIP3 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PPP1R9B | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PRKAB1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PRMT7 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PTPRQ | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| R3HCC1L | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| RABEP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| RAI14 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| RDX | Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach | association, physical, physical association | 22939629, 23414517, 26496610, 29568061, (Europe PMC) | 0.70 | BioGRID, IntAct |
| RFLNB | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| RIPK2 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| RPA3 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| RPL32 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| RPS13 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SCRIB | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SCYL3 | Two-hybrid, confocal microscopy, two hybrid | physical, physical association | 12651155, (Europe PMC) | 0.46 | BioGRID, IntAct |
| SEC16A | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SEL1L2 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SEPT6 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SEPT8 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SGK1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| SH2D4A | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SH3GLB2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SHC1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SIRT2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SKA2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SLC12A2 | anti bait coimmunoprecipitation | physical association | 22570591, 24555568, (Europe PMC) | 0.59 | IntAct |
| SLC25A5 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SLC9A3R1 | Affinity Capture-Western, Co-fractionation, Reconstituted Complex, affinity chromatography technology, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach | association, physical, physical association | 11285285, 11684085, 15020681, 23414517, 26344197, 29568061, 9314537, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| SLC9A3R2 | Affinity Capture-Western, Reconstituted Complex, two hybrid fragment pooling approach | physical, physical association | 12080047, 23414517, 9748260, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SNTB1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SNTB2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SNX6 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SORBS1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SRGAP2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SRP68 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SRP72 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SVIL | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SWAP70 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SYAP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TAB1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TBC1D10A | imaging technique | colocalization | 11285285, (Europe PMC) | 0.27 | IntAct, MINT |
| TBR1 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TCHH | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TIE1 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TIMM13 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TIMM44 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TNIK | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TNKS1BP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TRAF6 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TRAPPC1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TRAPPC10 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TRAPPC9 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TRIOBP | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TRMT112 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| USP1 | two hybrid fragment pooling approach | physical association | 23414517, (Europe PMC) | 0.37 | IntAct |
| USP47 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| UTRN | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| VHL | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| WASF2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| WASHC2A | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| WASHC5 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| WDR44 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| WDR45 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| WFDC1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAZ | pull down | physical association | 15161933, (Europe PMC) | 0.40 | IntAct, MINT |
| ZC3H15 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| CAPN6 | pull down | physical association | 11285285, (Europe PMC) | 0.40 | IntAct, MINT |
| EZR | Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid | association, physical, physical association | 11285285, 21988832, 29568061, 9501018, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| FES | anti bait coimmunoprecipitation, coimmunoprecipitation, fluorescence microscopy, pull down, two hybrid | association, colocalization, direct interaction, physical association | 18046454, (Europe PMC) | 0.68 | IntAct, MINT |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| MCC | Affinity Capture-MS, anti bait coimmunoprecipitation, pull down | physical, physical association | 17353931, 19555689, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| PIK3R1 | Affinity Capture-Western, Reconstituted Complex, pull down | association, physical | 10377409, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| PLCB3 | pull down | physical association | 11285285, (Europe PMC) | 0.40 | IntAct, MINT |
| SLC9A3R1 | Affinity Capture-Western, Co-fractionation, Reconstituted Complex, affinity chromatography technology, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach | association, physical, physical association | 11285285, 11684085, 15020681, 23414517, 26344197, 29568061, 9314537, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| TBC1D10A | imaging technique | colocalization | 11285285, (Europe PMC) | 0.27 | IntAct, MINT |
| YWHAZ | pull down | physical association | 15161933, (Europe PMC) | 0.40 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABCF2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ABI1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ABI2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ABR | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ACAA2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ACTN1 | Co-fractionation, pull down | association, physical | 22939629, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ACTR10 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ADD3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ADORA2B | Affinity Capture-Western | physical | 12080047, (Europe PMC) | NA | BioGRID |
| AFDN | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| AHCYL2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| AHNAK | Affinity Capture-MS, pull down | association, physical | 14625392, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AKAP12 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| AKAP2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| AKR1B1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ANK2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ANK3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| AP2A1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ARFGAP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ARHGAP35 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ARHGDIA | Co-fractionation, Co-purification, anti bait coimmunoprecipitation, fluorescence microscopy | colocalization, physical, physical association | 15659383, 20711218, 26344197, (Europe PMC) | 0.46 | BioGRID, IntAct |
| ARPC3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| ASAP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ASB6 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| AURKA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| B4GALT7 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BAG3 | Affinity Capture-MS | physical | 23824909, (Europe PMC) | NA | BioGRID |
| BAIAP2L1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| BCL11A | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| BCR | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| BID | Co-purification | physical | 15659383, (Europe PMC) | NA | BioGRID |
| BRCA1 | Affinity Capture-MS, Affinity Capture-Western | physical | 21282464, 26831064, (Europe PMC) | NA | BioGRID |
| C1orf198 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| C6orf132 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CALR | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CAPN1 | protease assay | cleavage reaction | 22805611, (Europe PMC) | 0.44 | IntAct, MINT |
| CAPN6 | pull down | physical association | 11285285, (Europe PMC) | 0.40 | IntAct, MINT |
| CASK | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CASP10 | Co-purification | physical | 15659383, (Europe PMC) | NA | BioGRID |
| CASP8 | Co-purification | physical | 15659383, (Europe PMC) | NA | BioGRID |
| CAST | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CCDC124 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CD44 | Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 12032545, 20711218, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CDH1 | Affinity Capture-Western, Proximity Label-MS | physical | 10462524, 25468996, (Europe PMC) | NA | BioGRID |
| CFTR | Affinity Capture-MS, Affinity Capture-Western | physical | 10893422, 26618866, (Europe PMC) | NA | BioGRID |
| CLIC4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CLIC5 | Reconstituted Complex | physical | 10793131, (Europe PMC) | NA | BioGRID |
| CNOT8 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| COBL | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| COBLL1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CROCC | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CTNNB1 | Affinity Capture-Western | physical | 10462524, (Europe PMC) | NA | BioGRID |
| CTNND1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CUL7 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CYFIP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CYFIP2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CYLD | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DCC | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical | 20434207, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX18 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DDX6 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DGKQ | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| DIP2B | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DLG1 | Reconstituted Complex | physical | 11726633, (Europe PMC) | NA | BioGRID |
| DLG1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DNM1L | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DOCK7 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DSG2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DST | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DVL3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EBI-1059081 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| ECD | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ECE2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EEF2K | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EFHD1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EGFR | PCA, ubiquitin reconstruction | physical, physical association | 24658140, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EGLN1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EHBP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EIF2A | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EIF4G3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EIF5A2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EIF5AL1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| ELP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ELP3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ENAH | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ENO1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ENO2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EPB41 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EPB41L1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EPHA2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ERBB2 | Co-localization, FRET, ubiquitin reconstruction | physical, physical association | 24658140, 27029001, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ERBIN | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| EZR | Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid | association, physical, physical association | 11285285, 21988832, 29568061, 9501018, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| FABP5 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| FADD | Affinity Capture-MS, Co-localization, Co-purification, proximity ligation assay | physical, physical association | 15659383, |