- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
CRK
Gene Name  | CRK (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 5UL6 |
| Synonyms | CRK | |
| Protein Name | CRK | |
| Alternative Name(s) | Adapter molecule crk;Proto-oncogene c-Crk;p38; | |
| Protein Family | Belongs to the CRK family | |
| EntrezGene ID | 1398 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P46108 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 33831 Dalton | |
| Protein Length | 304 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000167193 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG4792 | eggNOG - ENOG4110574 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Cell membrane Note=Translocated to the plasma membrane upon celladhesion | |||
| Function (UniProt annotation) | |||
| Isoform Crk-II: Regulates cell adhesion, spreading andmigration Mediates attachment-induced MAPK8 activation, membraneruffling and cell motility in a Rac-dependent manner Involved inphagocytosis of apoptotic cells and cell motility via itsinteraction with DOCK1 and DOCK4 May regulate the EFNA5-EPHA3signaling | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILR IRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000186 | P:activation of MAPKK activity |
| GO:0001784 | F:phosphotyrosine residue binding |
| GO:0001878 | P:response to yeast |
| GO:0005070 | F:SH3/SH2 adaptor activity |
| GO:0005159 | F:insulin-like growth factor receptor binding |
| GO:0005634 | C:nucleus |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0005886 | C:plasma membrane |
| GO:0006357 | P:regulation of transcription by RNA polymerase II |
| GO:0008092 | F:cytoskeletal protein binding |
| GO:0008360 | P:regulation of cell shape |
| GO:0009966 | P:regulation of signal transduction |
| GO:0014911 | P:positive regulation of smooth muscle cell migration |
| GO:0015629 | C:actin cytoskeleton |
| GO:0017124 | F:SH3 domain binding |
| GO:0019221 | P:cytokine-mediated signaling pathway |
| GO:0030307 | P:positive regulation of cell growth |
| GO:0032956 | P:regulation of actin cytoskeleton organization |
| GO:0032991 | C:protein-containing complex |
| GO:0035020 | P:regulation of Rac protein signal transduction |
| GO:0035728 | P:response to hepatocyte growth factor |
| GO:0038096 | P:Fc-gamma receptor signaling pathway involved in phagocytosis |
| GO:0042169 | F:SH2 domain binding |
| GO:0042542 | P:response to hydrogen peroxide |
| GO:0043087 | P:regulation of GTPase activity |
| GO:0043393 | P:regulation of protein binding |
| GO:0043621 | F:protein self-association |
| GO:0045121 | C:membrane raft |
| GO:0045309 | F:protein phosphorylated amino acid binding |
| GO:0045953 | P:negative regulation of natural killer cell mediated cytotoxicity |
| GO:0046875 | F:ephrin receptor binding |
| GO:0048010 | P:vascular endothelial growth factor receptor signaling pathway |
| GO:0048013 | P:ephrin receptor signaling pathway |
| GO:0061045 | P:negative regulation of wound healing |
| GO:0061847 | P:response to cholecystokinin |
| GO:0070062 | C:extracellular exosome |
| GO:0071538 | P:SH2 domain-mediated complex assembly |
| GO:0071560 | P:cellular response to transforming growth factor beta stimulus |
| GO:0071732 | P:cellular response to nitric oxide |
| GO:0097110 | F:scaffold protein binding |
| GO:1900026 | P:positive regulation of substrate adhesion-dependent cell spreading |
| GO:1990090 | P:cellular response to nerve growth factor stimulus |
| GO:1990314 | P:cellular response to insulin-like growth factor stimulus |
| GO:1990782 | F:protein tyrosine kinase binding |
| GO:1990859 | P:cellular response to endothelin |
| GO:2000146 | P:negative regulation of cell motility |
CRK is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in CRK (P46108) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PTPN1 | P18031 | NA | In vitro and in vivo | 12799422, | Europe PMC |  |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04010 | MAPK signaling pathway | The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli. |
| hsa04012 | ErbB signaling pathway | The ErbB family of receptor tyrosine kinases (RTKs) couples binding of extracellular growth factor ligands to intracellular signaling pathways regulating diverse biologic responses, including proliferation, differentiation, cell motility, and survival. Ligand binding to the four closely related members of this RTK family -epidermal growth factor receptor (EGFR, also known as ErbB-1 or HER1), ErbB-2 (HER2), ErbB-3 (HER3), and ErbB-4 (HER4)-induces the formation of receptor homo- and heterodimers and the activation of the intrinsic kinase domain, resulting in phosphorylation on specific tyrosine residues (pY) within the cytoplasmic tail. Signaling effectors containing binding pockets for pY-containing peptides are recruited to activated receptors and induce the various signaling pathways. The Shc- and/or Grb2-activated mitogen-activated protein kinase (MAPK) pathway is a common target downstream of all ErbB receptors. Similarly, the phosphatidylinositol-3-kinase (PI-3K) pathway is directly or indirectly activated by most ErbBs. Several cytoplasmic docking proteins appear to be recruited by specific ErbB receptors and less exploited by others. These include the adaptors Crk, Nck, the phospholipase C gamma (PLCgamma), the intracellular tyrosine kinase Src, or the Cbl E3 ubiquitin protein ligase. |
| hsa04015 | Rap1 signaling pathway | Rap1 is a small GTPase that controls diverse processes, such as cell adhesion, cell-cell junction formation and cell polarity. Like all G proteins, Rap1 cycles between an inactive GDP-bound and an active GTP-bound conformation. A variety of extracellular signals control this cycle through the regulation of several unique guanine nucleotide exchange factors (GEFs) and GTPase activating proteins (GAPs). Rap1 plays a dominant role in the control of cell-cell and cell-matrix interactions by regulating the function of integrins and other adhesion molecules in various cell types. Rap1 also regulates MAP kinase (MAPK) activity in a manner highly dependent on the context of cell types. |
| hsa04062 | Chemokine signaling pathway | Inflammatory immune response requires the recruitment of leukocytes to the site of inflammation upon foreign insult. Chemokines are small chemoattractant peptides that provide directional cues for the cell trafficking and thus are vital for protective host response. In addition, chemokines regulate plethora of biological processes of hematopoietic cells to lead cellular activation, differentiation and survival.The chemokine signal is transduced by chemokine receptors (G-protein coupled receptors) expressed on the immune cells. After receptor activation, the alpha- and beta-gamma-subunits of G protein dissociate to activate diverse downstream pathways resulting in cellular polarization and actin reorganization. Various members of small GTPases are involved in this process. Induction of nitric oxide and production of reactive oxygen species are as well regulated by chemokine signal via calcium mobilization and diacylglycerol production. |
| hsa04510 | Focal adhesion | Cell-matrix adhesions play essential roles in important biological processes including cell motility, cell proliferation, cell differentiation, regulation of gene expression and cell survival. At the cell-extracellular matrix contact points, specialized structures are formed and termed focal adhesions, where bundles of actin filaments are anchored to transmembrane receptors of the integrin family through a multi-molecular complex of junctional plaque proteins. Some of the constituents of focal adhesions participate in the structural link between membrane receptors and the actin cytoskeleton, while others are signalling molecules, including different protein kinases and phosphatases, their substrates, and various adapter proteins. Integrin signaling is dependent upon the non-receptor tyrosine kinase activities of the FAK and src proteins as well as the adaptor protein functions of FAK, src and Shc to initiate downstream signaling events. These signalling events culminate in reorganization of the actin cytoskeleton; a prerequisite for changes in cell shape and motility, and gene expression. Similar morphological alterations and modulation of gene expression are initiated by the binding of growth factors to their respective receptors, emphasizing the considerable crosstalk between adhesion- and growth factor-mediated signalling. |
| hsa04666 | Fc gamma R-mediated phagocytosis | Phagocytosis plays an essential role in host-defense mechanisms through the uptake and destruction of infectious pathogens. Specialized cell types including macrophages, neutrophils, and monocytes take part in this process in higher organisms. After opsonization with antibodies (IgG), foreign extracellular materials are recognized by Fc gamma receptors. Cross-linking of Fc gamma receptors initiates a variety of signals mediated by tyrosine phosphorylation of multiple proteins, which lead through the actin cytoskeleton rearrangements and membrane remodeling to the formation of phagosomes. Nascent phagosomes undergo a process of maturation that involves fusion with lysosomes. The acquisition of lysosomal proteases and release of reactive oxygen species are crucial for digestion of engulfed materials in phagosomes. |
| hsa04722 | Neurotrophin signaling pathway | Neurotrophins are a family of trophic factors involved in differentiation and survival of neural cells. The neurotrophin family consists of nerve growth factor (NGF), brain derived neurotrophic factor (BDNF), neurotrophin 3 (NT-3), and neurotrophin 4 (NT-4). Neurotrophins exert their functions through engagement of Trk tyrosine kinase receptors or p75 neurotrophin receptor (p75NTR). Neurotrophin/Trk signaling is regulated by connecting a variety of intracellular signaling cascades, which include MAPK pathway, PI-3 kinase pathway, and PLC pathway, transmitting positive signals like enhanced survival and growth. On the other hand, p75NTR transmits both positive and nagative signals. These signals play an important role for neural development and additional higher-order activities such as learning and memory. |
| hsa04810 | Regulation of actin cytoskeleton | |
| hsa04910 | Insulin signaling pathway | Insulin binding to its receptor results in the tyrosine phosphorylation of insulin receptor substrates (IRS) by the insulin receptor tyrosine kinase (INSR). This allows association of IRSs with the regulatory subunit of phosphoinositide 3-kinase (PI3K). PI3K activates 3-phosphoinositide-dependent protein kinase 1 (PDK1), which activates Akt, a serine kinase. Akt in turn deactivates glycogen synthase kinase 3 (GSK-3), leading to activation of glycogen synthase (GYS) and thus glycogen synthesis. Activation of Akt also results in the translocation of GLUT4 vesicles from their intracellular pool to the plasma membrane, where they allow uptake of glucose into the cell. Akt also leads to mTOR-mediated activation of protein synthesis by eIF4 and p70S6K. The translocation of GLUT4 protein is also elicited through the CAP/Cbl/TC10 pathway, once Cbl is phosphorylated by INSR.Other signal transduction proteins interact with IRS including GRB2. GRB2 is part of the cascade including SOS, RAS, RAF and MEK that leads to activation of mitogen-activated protein kinase (MAPK) and mitogenic responses in the form of gene transcription. SHC is another substrate of INSR. When tyrosine phosphorylated, SHC associates with GRB2 and can thus activate the RAS/MAPK pathway independently of IRS-1. |
| hsa05100 | Bacterial invasion of epithelial cells | Many pathogenic bacteria can invade phagocytic and non-phagocytic cells and colonize them intracellularly, then become disseminated to other cells. Invasive bacteria induce their own uptake by non-phagocytic host cells (e.g. epithelial cells) using two mechanisms referred to as zipper model and trigger model. Listeria, Staphylococcus, Streptococcus, and Yersinia are examples of bacteria that enter using the zipper model. These bacteria express proteins on their surfaces that interact with cellular receptors, initiating signalling cascades that result in close apposition of the cellular membrane around the entering bacteria. Shigella and Salmonella are the examples of bacteria entering cells using the trigger model. These bacteria use type III secretion systems to inject protein effectors that interact with the actin cytoskeleton. |
| hsa05131 | Shigellosis | Shigellosis, or bacillary dysentery, is an intestinal infection caused by Shigella, a genus of enterobacteria. Shigella are potential food-borne pathogens that are capable of colonizing the intestinal epithelium by exploiting epithelial-cell functions and circumventing the host innate immune response. During basolateral entry into the host-cell cytoplasm, Shigella deliver a subset of effectors into the host cells through the type III secretion system. The effectors induce membrane ruffling through the stimulation of the Rac1-WAVE-Arp2/3 pathway, enabling bacterial entry into the epithelial cells. During multiplication within the cells, Shigella secrete another subset of effectors. VirG induces actin polymerization at one pole of the bacteria, allowing the bacteria to spread intracellularly and to infect adjacent cells. OspF, OspG and IpaH(9.8) downregulate the production of proinflammatory cytokines such as IL-8, helping bacteria circumvent the innate immune response. |
| hsa05163 | Human cytomegalovirus infection | Human cytomegalovirus (HCMV) is an enveloped, double-stranded DNA virus that is a member of beta-herpesvirus family. HCMV is best known for causing significant morbidity and mortality in immunocompromised populations. As with other herpesviruses, HCMV gB and gH/gL envelope glycoproteins are essential for virus entry. HCMV gB could activate the PDGFRA, and induce activation of the oncogenic PI3-K/AKT pathway. Though it is unlikely that HCMV by itself can act as an oncogenic factor, HCMV may have an oncomodulatory role, to catalyze an oncogenic process that has already been initiated. US28, one of the four HCMV-encoded vGPCRs (US27, US28, UL33 and UL78), also has a specific role in the oncomodulatory properties. In addition, HCMV has developed numerous mechanisms for manipulating the host immune system. The virally encoded US2, US3, US6 and US11 gene products all interfere with major histocompatibility complex (MHC) class I antigen presentation. HCMV encodes several immediate early (IE) antiapoptotic proteins (IE1, IE2, vMIA and vICA). These proteins might avoid immune clearance of infected tumor cells by cytotoxic lymphocytes and NK cells. |
| hsa05170 | Human immunodeficiency virus 1 infection | Human immunodeficiency virus type 1 (HIV-1) , the causative agent of AIDS (acquired immunodeficiency syndrome), is a lentivirus belonging to the Retroviridae family. The primary cell surface receptor for HIV-1, the CD4 protein, and the co-receptor for HIV-1, either CCR5 or CXCR4, are found on macrophages and T lymphocytes. At the earliest step, sequential binding of virus envelope (Env) glycoprotein gp120 to CD4 and the co-receptor CCR5 or CXCR4 facilitates HIV-1 entry and has the potential to trigger critical signaling that may favor viral replication. At advanced stages of the disease, HIV-1 infection results in dramatic induction of T-cell (CD4+ T and CD8+ T cell) apoptosis both in infected and uninfected bystander T cells, a hallmark of HIV-1 pathogenesis. On the contrary, macrophages are resistant to the cytopathic effect of HIV-1 and produce virus for longer periods of time. |
| hsa05200 | Pathways in cancer | |
| hsa05206 | MicroRNAs in cancer | MicroRNA (miRNA) is a cluster of small non-encoding RNA molecules of 21 - 23 nucleotides in length, which controls gene expression post-transcriptionally either via the degradation of target mRNAs or the inhibition of protein translation. Using high-throughput profiling, dysregulation of miRNAs has been widely observed in different stages of cancer. The upregulation (overexpression) of specific miRNAs could lead to the repression of tumor suppressor gene expression, and conversely the downregulation of specific miRNAs could result in an increase of oncogene expression; both these situations induce subsequent malignant effects on cell proliferation, differentiation, and apoptosis that lead to tumor growth and progress. The miRNA signatures of cancer observed in various studies differ significantly. These inconsistencies occur due to the differences in the study populations and methodologies used. This pathway map shows the summarized results from various studies in 9 cancers, each of which is presented in a review article. |
| hsa05211 | Renal cell carcinoma | Renal cell cancer (RCC) accounts for ~3% of human malignancies and its incidence appears to be rising. Although most cases of RCC seem to occur sporadically, an inherited predisposition to renal cancer accounts for 1-4% of cases. RCC is not a single disease, it has several morphological subtypes. Conventional RCC (clear cell RCC) accounts for ~80% of cases, followed by papillary RCC (10-15%), chromophobe RCC (5%), and collecting duct RCC (<1%). Genes potentially involved in sporadic neoplasms of each particular type are VHL, MET, BHD, and FH respectively. In the absence of VHL, hypoxia-inducible factor alpha (HIF-alpha) accumulates, leading to production of several growth factors, including vascular endothelial growth factor and platelet-derived growth factor. Activated MET mediates a number of biological effects including motility, invasion of extracellular matrix, cellular transformation, prevention of apoptosis and metastasis formation. Loss of functional FH leads to accumulation of fumarate in the cell, triggering inhibition of HPH and preventing targeted pVHL-mediated degradation of HIF-alpha. BHD mutations cause the Birt-Hogg-Dube syndrome and its associated chromophobe, hybrid oncocytic, and conventional (clear cell) RCC. |
| hsa05220 | Chronic myeloid leukemia | Chronic myeloid leukemia (CML) is a clonal myeloproliferative disorder of a pluripotent stem cell. The natural history of CML has a triphasic clinical course comprising of an initial chronic phase (CP), which is characterized by expansion of functionally normal myeloid cells, followed by an accelerated phase (AP) and finally a more aggressive blast phase (BP), with loss of terminal differentiation capacity. On the cellular level, CML is associated with a specific chromosome abnormality, the t(9; 22) reciprocal translocation that forms the Philadelphia (Ph) chromosome. The Ph chromosome is the result of a molecular rearrangement between the c-ABL proto-oncogene on chromosome 9 and the BCR (breakpoint cluster region) gene on chromosome 22. The BCR/ABL fusion gene encodes p210 BCR/ABL, an oncoprotein, which, unlike the normal p145 c-Abl, has constitutive tyrosine kinase activity and is predominantly localized in the cytoplasm. While fusion of c-ABL and BCR is believed to be the primary cause of the chronic phase of CML, progression to blast crisis requires other molecular changes. Common secondary abnormalities include mutations in TP53, RB, and p16/INK4A, or overexpression of genes such as EVI1. Additional chromosome translocations are also observed,such as t(3;21)(q26;q22), which generates AML1-EVI1. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-170984 | ARMS-mediated activation. | ARMS (Ankyrin-Rich Membrane Spanning/Kidins 220) is a 220kD tetraspanning adaptor protein which becomes rapidly tyrosine phosphorylated by active Trk receptors. ARMS is another adaptor protein which is involved in the activation of Rap1 and the subsequent prolonged activation of the MAPK cascade |
| R-HSA-186763 | Downstream signal transduction. | The role of autophosphorylation sites on PDGF receptors are to provide docking sites for downstream signal transduction molecules which contain SH2 domains. The SH2 domain is a conserved motif of around 100 amino acids that can bind a phosphorylated tyrosine residue. These downstream molecules are activated upon binding to, or phosphorylated by, the receptor kinases intrinsic to PDGF receptors.Some of the dowstream molecules are themselves enzymes, such as phosphatidylinositol 3'-kinase (PI3K), phospholipase C (PLC-gamma), the Src family of tyrosine kinases, the tyrosine phosphatase SHP2, and a GTPase activating protein (GAP) for Ras. Others such as Grb2 are adaptor molecules which link the receptor with downstream catalytic molecules |
| R-HSA-2029482 | Regulation of actin dynamics for phagocytic cup formation. | The actin cytoskeleton is fundamental for phagocytosis and members of the Rho family GTPases RAC and CDC42 are involved in actin cytoskeletal regulation leading to pseudopod extension. Active RAC and CDC42 exert their action through the members of WASP family proteins (WASP/N-WASP/WAVE) and ARP2/3 complex. Actin filaments move from the bottom toward the top of the phagocytic cup during pseudopod extension |
| R-HSA-372708 | p130Cas linkage to MAPK signaling for integrins. | Integrin signaling is linked to the MAP kinase pathway by recruiting p130cas and Crk to the FAK/Src activation complex |
| R-HSA-4420097 | VEGFA-VEGFR2 Pathway. | Angiogenesis is the formation of new blood vessels from preexisting vasculature. One of the most important proangiogenic factors is vascular endothelial growth factor (VEGF). VEGF exerts its biologic effect through interaction with transmembrane tyrosine kinase receptors VEGFR, selectively expressed on vascular endothelial cells. VEGFA signaling through VEGFR2 is the major pathway that activates angiogenesis by inducing the proliferation, survival, sprouting and migration of endothelial cells (ECs), and also by increasing endothelial permeability (Lohela et al. 2009, Shibuya & Claesson-Welsh 2006, Claesson-Welsh & Welsh, 2013). The critical role of VEGFR2 in vascular development is highlighted by the fact that VEGFR2-/- mice die at E8.5-9.5 due to defective development of blood islands, endothelial cells and haematopoietic cells (Shalaby et al. 1995) |
| R-HSA-8849471 | PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases. | PTK6 promotes cell motility and migration by regulating the activity of RHO GTPases RAC1 (Chen et al. 2004) and RHOA (Shen et al. 2008). PTK6 inhibits RAS GTPase activating protein RASA1 (Shen et al. 2008) and may be involved in MAPK7 (ERK5) activation (Ostrander et al. 2007, Zheng et al |
| R-HSA-8875555 | MET activates RAP1 and RAC1. | The adapter protein GAB1 is involved in recruitment, through CRK and related CRKL proteins, of guanyl nucleotide exchange factors (GEFs) to the activated MET receptor. MET-associated GEFs, such as RAPGEF1 (C3G) and DOCK7, activate RAP1 and RAC1, respectively, leading to morphological changes that contribute to cell motility (Schaeper et al. 2000, Sakkab et al. 2000, Lamorte et al. 2002, Watanabe et al. 2006, Murray et al. 2014) |
| R-HSA-8875656 | MET receptor recycling. | Activated MET receptor is subject to recycling from the plasma membrane through the endosomal compartment and back to the plasma membrane (Peschard et al. 2001, Hammond et al. 2001, Petrelli et al. 2002). In the recycling process, activated MET receptor is endocytosed, and the GGA3 protein directs it, via a largely unknown mechanism, through the RAB4 positive endosomal compartments back to the plasma membrane (Parachoniak et al. 2011). Endosomal signaling by MET during the recycling process appears to play an important role in sustained activation of ERK1/ERK2 (MAPK3/MAPK1) and STAT3 downstream of MET (Kermorgant and Parker 2008) |
| R-HSA-912631 | Regulation of signaling by CBL. | Cbl is an E3 ubiquitin-protein ligase that negatively regulates signaling pathways by targeting proteins for ubiquitination and proteasomal degradation (Rao et al. 2002). Cbl negatively regulates PI3K via this mechanism (Dufour et al. 2008). The binding of Cbl to the p85 subunit of PI3K is mediated at least in part by tyrosine phosphorylation at Y731 (Dufour et al. 2008). Fyn and the related kinases Hck and Lyn are known to be associated with Cbl (Anderson et al. 1997, Hunter et al. 1999). Fyn is proven capable of Cbl Y731 phosphorylation (Hunter et al. 1999).The association of Fyn and Cbl has been described as constitutive (Hunter et al. 1999). CBL further associates with the p85 subunit of PI3K (Hartley et al. 1995, Anderson et al. 1997, Hunter et al. 1997), this also described as constitutive and mediated by the SH3 domain of p85. Binding of the SH2 domain of p85 to a specific phosphorylation site in Cbl is postulated to explain the the increase in Cbl/p85 association seen in activated cells (Panchamoorthy et al 1996) which negatively regulates PI3K activity (Fang et al. 2001). The negative effect of increased Cbl-PI3K interaction is mediated by Y731 of Cbl. Cbl binding increases PI3K ubiquitination and proteasome degradation (Dufour et al. 2008).Cbl is constitutively associated with Grb in resting hematopoietic cells (Anderson et al. 1997, Odai et al. 1995, Park et al. 1998, Panchamoorthy et al. 1996). Both the SH2 and SH3 domains of Grb2 are involved. Cbl has 2 distinct C-terminal domains, proximal and distal. The proximal domain binds Grb2 in resting and stimulated cells, and in stimulated cells also binds Shc. The distal domain binds the adaptor protein CRKL. Tyrosine phosphorylation of Cbl in response to IL-3 releases the SH3 domain of Grb2 which then is free to bind other molecules (Park et al. 1998). Cbl is tyrosine phosphorylated in response to many cytokines including IL-3, IL-2 (Gesbert et al. 1998) and IL-4 (Ueno et al. 1998) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABL2 | Affinity Capture-MS, Biochemical Activity, Reconstituted Complex, Two-hybrid, peptide array, protein kinase assay, tandem affinity purification, two hybrid array, validated two hybrid | association, phosphorylation reaction, physical, physical association | 15886098, 17474147, 19380743, 25814554, 8194526, (Europe PMC) | 0.49, 0.70 | BioGRID, IntAct |
| ACTB | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| AGO1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AGO2 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ANKZF1 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANLN | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AP2A1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AP2B1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| AP2M1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARHGAP17 | Reconstituted Complex | physical | 11431473, (Europe PMC) | NA | BioGRID |
| ARHGAP32 | Affinity Capture-Western, Reconstituted Complex | physical | 12454018, 12819203, (Europe PMC) | NA | BioGRID |
| ARPC1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ASAP1 | Affinity Capture-MS, Reconstituted Complex, peptide array | physical, physical association | 17474147, 19380743, 9819391, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ASAP3 | Affinity Capture-MS, bimolecular fluorescence complementation, tandem affinity purification, two hybrid array, two hybrid prey pooling approach, validated two hybrid | association, physical, physical association | 19380743, 26871637, (Europe PMC) | 0.70 | BioGRID, IntAct |
| ASB9 | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.51 | BioGRID, IntAct |
| ASCL4 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ATF3 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ATIC | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| ATXN1 | Affinity Capture-Western, Two-hybrid, pull down, two hybrid array, two hybrid prey pooling approach | physical, physical association | 16713569, 23275563, (Europe PMC) | 0.63 | BioGRID, IntAct |
| AVIL | Reconstituted Complex | physical | 11287316, (Europe PMC) | NA | BioGRID |
| BAG3 | Affinity Capture-Luminescence, Affinity Capture-MS | physical | 23824909, (Europe PMC) | NA | BioGRID |
| BATF3 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BCAR1 | Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down | association, physical, physical association | 10085298, 10329689, 10464310, 10747099, 10753828, 11278916, 11369773, 11839772, 12615911, 12799422, 14657239, 15492270, 15673687, 16267043, 17038317, 18835194, 19380743, 22974441, 9581808, 9920935, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| BCR | Affinity Capture-MS, Reconstituted Complex | physical | 19380743, 8943292, (Europe PMC) | NA | BioGRID |
| BEX5 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| BUB1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| C4orf17 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| C6orf141 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CASS4 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CAST | Co-fractionation, peptide array | physical, physical association | 17474147, 26344197, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CBL | Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down, tandem affinity purification, two hybrid array, validated two hybrid | association, physical, physical association | 10962563, 11792427, 12393469, 15581361, 16289966, 18835194, 19380743, 22974441, 25814554, 8524328, 8621483, 8626404, 8626543, 8662998, 8683103, 8943292, 9129019, 9178909, 9416834, 9461587, 9617486, 9988765, (Europe PMC) | 0.49, 0.88 | BioGRID, IntAct, MINT |
| CBLB | Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid | association, physical, physical association | 19380743, 25814554, (Europe PMC) | 0.49, 0.62 | BioGRID, IntAct |
| CBLC | Reconstituted Complex, Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 10362357, 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| CCP110 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDH1 | Proximity Label-MS | physical | 25468996, (Europe PMC) | NA | BioGRID |
| CEP128 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP19 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP89 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHTF18 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| CLNK | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CNDP2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| CORO1C | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CORO6 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| COX6C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSE1L | Affinity Capture-Western | physical | 8943292, (Europe PMC) | NA | BioGRID |
| DDX3X | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| DDX5 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| DDX6 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DHX9 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| DNAJA3 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| DOCK1 | Affinity Capture-Western, Co-fractionation, Reconstituted Complex, peptide array, pull down | association, physical, physical association | 10559471, 11369773, 12615911, 15673687, 17474147, 17515907, 26344197, 8657152, 8662907, (Europe PMC) | 0.35, 0.40 | BioGRID, IntAct |
| DOK1 | Protein-peptide | physical | 22974441, (Europe PMC) | NA | BioGRID |
| DOK2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| DOK3 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| DOK7 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| DPPA4 | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 16189514, 26871637, (Europe PMC) | 0.67 | BioGRID, IntAct |
| DSC1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| EDC4 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EEF1A1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| EFS | Far Western, peptide array | physical, physical association | 17474147, 8647432, (Europe PMC) | 0.40 | BioGRID, IntAct |
| EGFR | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, PCA, Protein-peptide, Two-hybrid, luminescence based mammalian interactome mapping, protein array, ubiquitin reconstruction | direct interaction, physical, physical association | 10595738, 16273093, 16729043, 24658140, 25402006, 9617486, 9642287, (Europe PMC) | 0.51, 0.59 | BioGRID, IntAct, MINT |
| ELK1 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| EPHA3 | Affinity Capture-Western | physical | 11870224, (Europe PMC) | NA | BioGRID |
| EPHB2 | Reconstituted Complex | physical | 10644995, (Europe PMC) | NA | BioGRID |
| EPHB3 | Reconstituted Complex | physical | 9674711, (Europe PMC) | NA | BioGRID |
| EPS15 | Affinity Capture-MS, Far Western, Reconstituted Complex, tandem affinity purification | association, physical | 19380743, 7797522, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EPYC | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| ERBB2 | Protein-peptide, protein array | direct interaction, physical | 16273093, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| ERBB3 | Protein-peptide, protein array | direct interaction, physical | 16273093, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| ERBB4 | Affinity Capture-MS | physical | 16729043, (Europe PMC) | NA | BioGRID |
| ESD | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EYA3 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| FASLG | Protein-peptide, phage display | direct interaction, physical | 19807924, (Europe PMC) | 0.44 | BioGRID, IntAct |
| FER | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FGFR1 | Affinity Capture-Western, Co-localization, Reconstituted Complex, affinity chromatography technology, proximity ligation assay | association, physical, physical association | 10464310, 25241761, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| FLNA | Co-localization, peptide array, proximity ligation assay | physical, physical association | 17474147, 25241761, (Europe PMC) | 0.59 | BioGRID, IntAct |
| FRS2 | Reconstituted Complex | physical | 10092678, (Europe PMC) | NA | BioGRID |
| FSTL1 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| FUBP1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| GAB1 | Affinity Capture-MS, fluorescence polarization spectroscopy | direct interaction, physical | 19380743, 24728074, (Europe PMC) | 0.44 | BioGRID, IntAct |
| GAB2 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| GABPB2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| GAREM1 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| GFPT1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GGA3 | Affinity Capture-Western | physical | 21664574, (Europe PMC) | NA | BioGRID |
| GRB2 | Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, tandem affinity purification | association, physical | 10962563, 10970810, 19380743, 8662907, 8810325, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HABP4 | Two-hybrid | physical | 25814554, (Europe PMC) | NA | BioGRID |
| HIST1H1D | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| HSH2D | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| HSP90AB1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA1B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA1L | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA5 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA6 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA8 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA9 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPB1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HSPBP1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HUWE1 | Affinity Capture-MS | physical | 25147182, (Europe PMC) | NA | BioGRID |
| IFT140 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| INF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| INO80E | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| INPPL1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IRS4 | Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down | association, physical | 11316748, 9614078, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| ISL1 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KAT6A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KCTD13 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| KCTD17 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KHDRBS1 | Reconstituted Complex | physical | 1545818, (Europe PMC) | NA | BioGRID |
| KIT | Two-hybrid, fluorescence polarization spectroscopy, pull down | association, direct interaction, physical | 12878163, 24728074, 9233773, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| KLF15 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KLHL20 | Two-hybrid | physical | 25814554, (Europe PMC) | NA | BioGRID |
| KRT1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT10 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT12 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT14 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT15 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT16 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT17 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT19 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT2 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT24 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT3 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT4 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT5 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT6A | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT6B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT73 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT76 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT77 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT78 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT79 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT8 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT9 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| LASP1 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| LHX8 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LMNA | Proximity Label-MS | physical | 22412018, (Europe PMC) | NA | BioGRID |
| LYZ | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| MAGEC3 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| MAP4K1 | Affinity Capture-Western, Reconstituted Complex, peptide array, pull down | physical, physical association | 11279207, 17474147, 9788432, 9891069, (Europe PMC) | 0.59 | BioGRID, IntAct |
| MAP4K5 | Affinity Capture-MS, Affinity Capture-Western, coimmunoprecipitation, pull down, tandem affinity purification | association, physical, physical association | 10648385, 19380743, 9788432, (Europe PMC) | 0.64 | BioGRID, IntAct |
| MAPK4 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAPK8 | Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay, pull down | physical, physical association | 11432831, 16982329, 25241761, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| MET | Affinity Capture-Western, fluorescence polarization spectroscopy | direct interaction, physical | 24728074, 24828152, (Europe PMC) | 0.44 | BioGRID, IntAct |
| MICAL1 | Reconstituted Complex | physical | 11827972, (Europe PMC) | NA | BioGRID |
| MNDA | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MPDZ | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MPG | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| MRPL48 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYLIP | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| MYOZ2 | Two-hybrid | physical | 25814554, (Europe PMC) | NA | BioGRID |
| NANS | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| NCKIPSD | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| NEDD9 | Affinity Capture-Western, Reconstituted Complex | physical | 8879209, 9295052, 9497377, (Europe PMC) | NA | BioGRID |
| NUFIP2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| NUMA1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| ODF2 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OFCC1 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| PAFAH1B2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| PDGFRA | Affinity Capture-Western, Co-localization, Reconstituted Complex, coimmunoprecipitation, enzymatic study, proximity ligation assay, pull down | association, physical, physical association | 10733900, 25241761, 9546424, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| PDGFRB | Affinity Capture-Western, Reconstituted Complex, pull down | association, physical | 10733900, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| PEAK1 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 19380743, 20534451, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PHC2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| PIK3C2B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| PIK3CA | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| PIK3CB | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| PIK3CD | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| PIK3R1 | Affinity Capture-MS, Affinity Capture-Western, Co-localization, Two-hybrid, proximity ligation assay, tandem affinity purification, two hybrid array, validated two hybrid | association, physical, physical association | 10962563, 11418612, 19380743, 25241761, 25814554, (Europe PMC) | 0.49, 0.56 | BioGRID, IntAct |
| PIK3R2 | Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid | association, physical, physical association | 19380743, 25814554, (Europe PMC) | 0.35, 0.49 | BioGRID, IntAct |
| PIK3R3 | Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid | association, physical, physical association | 19380743, 25814554, (Europe PMC) | 0.49, 0.62 | BioGRID, IntAct |
| PLSCR1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| POT1 | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPFIBP2 | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 19447967, 26871637, (Europe PMC) | 0.67 | BioGRID, IntAct |
| PPP1CA | Two-hybrid, two hybrid | physical, physical association | 22321011, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPP1R12A | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| PRKACA | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| PRRC2B | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PRRG2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| PSMC1 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMC6 | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 16189514, 26871637, (Europe PMC) | 0.76 | BioGRID, IntAct |
| PTK2 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array, validated two hybrid | physical, physical association | 10085298, 12615911, 25814554, 7561682, (Europe PMC) | 0.63 | BioGRID, IntAct |
| PTPN1 | Reconstituted Complex | physical | 8940134, (Europe PMC) | NA | BioGRID |
| PTPN11 | Affinity Capture-MS, Affinity Capture-Western | physical | 10464310, 19380743, (Europe PMC) | NA | BioGRID |
| PTPN4 | Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, confocal microscopy, two hybrid | colocalization, physical, physical association | 21988832, (Europe PMC) | 0.54 | BioGRID, IntAct |
| PTTG1 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PXN | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 10085298, 12198159, 12799422, 26656091, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| RAB2B | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| RAPGEF1 | Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, coimmunoprecipitation, peptide array, pull down, tandem affinity purification | association, physical, physical association | 10464310, 17474147, 17515907, 18835194, 19380743, 7512734, 7531694, 8621483, 8943292, (Europe PMC) | 0.35, 0.69 | BioGRID, IntAct, MINT |
| RET | Co-localization, Reconstituted Complex, proximity ligation assay | physical, physical association | 25241761, 9393871, (Europe PMC) | 0.40 | BioGRID, IntAct |
| RIN3 | Two-hybrid, peptide array, two hybrid array | physical, physical association | 17474147, 25814554, (Europe PMC) | 0.57 | BioGRID, IntAct |
| RNGTT | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| RPL23 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| RPS19 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| RPS25 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| RPS3 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| RPS5 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| RTCB | Two-hybrid | physical | 25814554, (Europe PMC) | NA | BioGRID |
| RYBP | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SAXO1 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SEMA4D | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| SEPT6 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SERPINB6 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| SERPINH1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SETD9 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SFN | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| SH2D2A | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| SH3BP1 | Reconstituted Complex | physical | 1379745, (Europe PMC) | NA | BioGRID |
| SH3KBP1 | Affinity Capture-Western | physical | 11071869, (Europe PMC) | NA | BioGRID |
| SHB | Affinity Capture-Western | physical | 10964504, (Europe PMC) | NA | BioGRID |
| SHC1 | Affinity Capture-MS, Affinity Capture-Western, proximity ligation assay, tandem affinity purification | association, physical, physical association | 10464310, 19380743, 23397142, 9617486, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SLC25A13 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SOCS1 | Reconstituted Complex, Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 10022833, 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| SOCS6 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| SOS1 | Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, peptide array, proximity ligation assay, tandem affinity purification | association, physical, physical association | 17474147, 19380743, 25241761, 8810325, 8943292, (Europe PMC) | 0.69 | BioGRID, IntAct |
| SOS2 | Affinity Capture-MS, peptide array, tandem affinity purification | association, physical, physical association | 17474147, 19380743, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SPR | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SPRR2A | Reconstituted Complex, protein array | direct interaction, physical | 18155796, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| SRC | Affinity Capture-Western, proximity ligation assay | physical, physical association | 10962563, 12615911, 23397142, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SRCIN1 | Affinity Capture-Western | physical | 14657239, (Europe PMC) | NA | BioGRID |
| SRM | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| STAT4 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| STAT5A | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| STRN4 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SYN1 | Affinity Capture-Western | physical | 10899172, (Europe PMC) | NA | BioGRID |
| TCAP | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| TDG | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TERF2IP | Two-hybrid, bimolecular fluorescence complementation, pull down | physical, physical association | 21044950, (Europe PMC) | 0.51 | BioGRID, IntAct |
| TM4SF19 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| TP53 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TRIM15 | Affinity Capture-Western, PCA | physical | 25450970, (Europe PMC) | NA | BioGRID |
| TSG101 | Affinity Capture-Western, Co-localization | physical | 27764233, (Europe PMC) | NA | BioGRID |
| TUBA1A | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| TUBA1C | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TUBA4B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| TUBB | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| TUBB2A | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| TUBB3 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| TUBB4B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| TWIST2 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| UBASH3A | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UBASH3B | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UBC | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| VAC14 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| WDR83 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| WEE1 | Affinity Capture-Western | physical | 11839808, (Europe PMC) | NA | BioGRID |
| XPO1 | Two-hybrid | physical | 11839808, (Europe PMC) | NA | BioGRID |
| YWHAG | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| YWHAQ | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| ZAP70 | Reconstituted Complex, pull down | association, physical | 10419455, 16339550, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| ZKSCAN7 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZNF557 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABI1 | array technology | direct interaction | 20598684, (Europe PMC) | 0.44 | IntAct, MINT |
| ABL1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, nuclear magnetic resonance, peptide array, protein kinase assay, pull down | association, phosphorylation reaction, physical, physical association | 12097319, 12384576, 15696159, 17474147, 17515907, 18619508, 18835194, 19380743, 24412932, 8194526, 9747873, (Europe PMC) | 0.35, 0.44, 0.56 | BioGRID, IntAct, MINT |
| ABL2 | Affinity Capture-MS, Biochemical Activity, Reconstituted Complex, Two-hybrid, peptide array, protein kinase assay, tandem affinity purification, two hybrid array, validated two hybrid | association, phosphorylation reaction, physical, physical association | 15886098, 17474147, 19380743, 25814554, 8194526, (Europe PMC) | 0.49, 0.70 | BioGRID, IntAct |
| AFF2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| AGO1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AGO2 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AGPAT4 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| AIRE | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| AKAP2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| AKAP6 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| ALS2CR12 | two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical association | 26871637, (Europe PMC) | 0.56 | IntAct |
| ANKZF1 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANLN | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AP2A1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AP2M1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| APOL5 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| AR | fluorescence polarization spectroscopy | direct interaction | 24728074, (Europe PMC) | 0.44 | IntAct |
| ARHGEF11 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| ARPC1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ASAP1 | Affinity Capture-MS, Reconstituted Complex, peptide array | physical, physical association | 17474147, 19380743, 9819391, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ASAP2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| ASAP3 | Affinity Capture-MS, bimolecular fluorescence complementation, tandem affinity purification, two hybrid array, two hybrid prey pooling approach, validated two hybrid | association, physical, physical association | 19380743, 26871637, (Europe PMC) | 0.70 | BioGRID, IntAct |
| ASB9 | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.51 | BioGRID, IntAct |
| ASCL4 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ATF3 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ATXN1 | Affinity Capture-Western, Two-hybrid, pull down, two hybrid array, two hybrid prey pooling approach | physical, physical association | 16713569, 23275563, (Europe PMC) | 0.63 | BioGRID, IntAct |
| BATF3 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BCAR1 | Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down | association, physical, physical association | 10085298, 10329689, 10464310, 10747099, 10753828, 11278916, 11369773, 11839772, 12615911, 12799422, 14657239, 15492270, 15673687, 16267043, 17038317, 18835194, 19380743, 22974441, 9581808, 9920935, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| BEX5 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| BICRA | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| BMX | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| BRD4 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| BUB1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| C1orf94 | two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical association | 26871637, (Europe PMC) | 0.56 | IntAct |
| C4orf17 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| C6orf141 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CASS4 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CAST | Co-fractionation, peptide array | physical, physical association | 17474147, 26344197, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CBL | Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down, tandem affinity purification, two hybrid array, validated two hybrid | association, physical, physical association | 10962563, 11792427, 12393469, 15581361, 16289966, 18835194, 19380743, 22974441, 25814554, 8524328, 8621483, 8626404, 8626543, 8662998, 8683103, 8943292, 9129019, 9178909, 9416834, 9461587, 9617486, 9988765, (Europe PMC) | 0.49, 0.88 | BioGRID, IntAct, MINT |
| CBLB | Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid | association, physical, physical association | 19380743, 25814554, (Europe PMC) | 0.49, 0.62 | BioGRID, IntAct |
| CBLC | Reconstituted Complex, Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 10362357, 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| CCP110 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CD93 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| CDH11 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| CELSR2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| CEP128 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP19 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP89 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHTF18 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| CLNK | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CNDP2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| CNTFR | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| CNTNAP1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| CORO6 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| COX6C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSMD2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DDX41 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DDX6 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DKKL1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DLGAP1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DLGAP2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DLGAP3 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DLGAP4 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DLX4 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DNM2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DOCK1 | Affinity Capture-Western, Co-fractionation, Reconstituted Complex, peptide array, pull down | association, physical, physical association | 10559471, 11369773, 12615911, 15673687, 17474147, 17515907, 26344197, 8657152, 8662907, (Europe PMC) | 0.35, 0.40 | BioGRID, IntAct |
| DOCK3 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DOK2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| DOK3 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| DOK7 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| DPPA4 | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 16189514, 26871637, (Europe PMC) | 0.67 | BioGRID, IntAct |
| DTX1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DUSP15 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| EDC4 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EFS | Far Western, peptide array | physical, physical association | 17474147, 8647432, (Europe PMC) | 0.40 | BioGRID, IntAct |
| EGFR | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, PCA, Protein-peptide, Two-hybrid, luminescence based mammalian interactome mapping, protein array, ubiquitin reconstruction | direct interaction, physical, physical association | 10595738, 16273093, 16729043, 24658140, 25402006, 9617486, 9642287, (Europe PMC) | 0.51, 0.59 | BioGRID, IntAct, MINT |
| ELK1 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| ELK3 | bimolecular fluorescence complementation, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical association | 26871637, (Europe PMC) | 0.60 | IntAct |
| EPB41L3 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| EPS15 | Affinity Capture-MS, Far Western, Reconstituted Complex, tandem affinity purification | association, physical | 19380743, 7797522, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EPYC | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| ERBB2 | Protein-peptide, protein array | direct interaction, physical | 16273093, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| ERBB3 | Protein-peptide, protein array | direct interaction, physical | 16273093, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| ESD | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EXTL3 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| EYA3 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| F2RL2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| FANCA | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| FASLG | Protein-peptide, phage display | direct interaction, physical | 19807924, (Europe PMC) | 0.44 | BioGRID, IntAct |
| FASTK | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| FCGR2B | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| FCGR2C | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| FER | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FGFR1 | Affinity Capture-Western, Co-localization, Reconstituted Complex, affinity chromatography technology, proximity ligation assay | association, physical, physical association | 10464310, 25241761, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| FLNA | Co-localization, peptide array, proximity ligation assay | physical, physical association | 17474147, 25241761, (Europe PMC) | 0.59 | BioGRID, IntAct |
| FLNB | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| FLNC | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| FLT1 | proximity ligation assay | physical association | 23397142, (Europe PMC) | 0.40 | IntAct |
| FSTL1 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| FYB1 | pull down | association | 22074159, (Europe PMC) | 0.35 | IntAct |
| GAB1 | Affinity Capture-MS, fluorescence polarization spectroscopy | direct interaction, physical | 19380743, 24728074, (Europe PMC) | 0.44 | BioGRID, IntAct |
| GABBR1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| GABPB2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| GAREM1 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| GCFC2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| GHR | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| GP9 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| GRB2 | Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, tandem affinity purification | association, physical | 10962563, 10970810, 19380743, 8662907, 8810325, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GRIN2D | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| GRIP2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| HABP4 | two hybrid array | physical association | 25814554, (Europe PMC) | 0.37 | IntAct |
| HEXA | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| HIST1H1E | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| HLA-B | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| HNRNPR | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| HSH2D | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| ID4 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| IFT140 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IGF1R | two hybrid | physical association | 15522217, (Europe PMC) | 0.37 | IntAct |
| IKZF3 | barcode fusion genetics two hybrid, validated two hybrid | physical association | 27107012, (Europe PMC) | 0.49 | IntAct |
| INF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| INO80E | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| INPPL1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| INSR | two hybrid | physical association | 15522217, (Europe PMC) | 0.37 | IntAct |
| IRS4 | Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down | association, physical | 11316748, 9614078, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| ISG20L2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| ISL1 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KAT6A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KCTD13 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| KCTD17 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KDR | proximity ligation assay | physical association | 23397142, (Europe PMC) | 0.40 | IntAct |
| KHDRBS1 | pull down | physical association | 11278465, 7537265, (Europe PMC) | 0.40 | IntAct |
| KIF22 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| KIT | Two-hybrid, fluorescence polarization spectroscopy, pull down | association, direct interaction, physical | 12878163, 24728074, 9233773, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| KLF15 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KMT2B | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| LASP1 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| LCOR | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| LHX8 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LIG3 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| LNX2 | barcode fusion genetics two hybrid, validated two hybrid | physical association | 27107012, (Europe PMC) | 0.49 | IntAct |
| MAGEC3 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| MAP4K1 | Affinity Capture-Western, Reconstituted Complex, peptide array, pull down | physical, physical association | 11279207, 17474147, 9788432, 9891069, (Europe PMC) | 0.59 | BioGRID, IntAct |
| MAP4K5 | Affinity Capture-MS, Affinity Capture-Western, coimmunoprecipitation, pull down, tandem affinity purification | association, physical, physical association | 10648385, 19380743, 9788432, (Europe PMC) | 0.64 | BioGRID, IntAct |
| MAPK4 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAPK8 | Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay, pull down | physical, physical association | 11432831, 16982329, 25241761, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| MEPE | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| MET | Affinity Capture-Western, fluorescence polarization spectroscopy | direct interaction, physical | 24728074, 24828152, (Europe PMC) | 0.44 | BioGRID, IntAct |
| MNDA | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MPDZ | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MPG | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| MRPL48 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYLIP | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| MYO18B | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| MYOZ2 | two hybrid array, validated two hybrid | physical association | 25814554, (Europe PMC) | 0.49 | IntAct |
| NFASC | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| NKX2-1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| NR5A1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| NUFIP2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| NUMA1 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| NXPH3 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| ODF2 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OFCC1 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| OGN | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| OPTC | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PAFAH1B2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| PAG1 | anti bait coimmunoprecipitation | association | 18070987, (Europe PMC) | 0.35 | IntAct, MINT |
| PAX7 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PCDHA1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PCDHA10 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PCDHA11 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PCDHA12 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PCDHA2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PCDHA3 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PCDHA5 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PCDHA6 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PCDHA7 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PCDHA8 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PCDHA9 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PDGFRA | Affinity Capture-Western, Co-localization, Reconstituted Complex, coimmunoprecipitation, enzymatic study, proximity ligation assay, pull down | association, physical, physical association | 10733900, 25241761, 9546424, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| PDGFRB | Affinity Capture-Western, Reconstituted Complex, pull down | association, physical | 10733900, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| PDIA2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PEAK1 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 19380743, 20534451, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PHACTR2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PHC2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| PIK3R1 | Affinity Capture-MS, Affinity Capture-Western, Co-localization, Two-hybrid, proximity ligation assay, tandem affinity purification, two hybrid array, validated two hybrid | association, physical, physical association | 10962563, 11418612, 19380743, 25241761, 25814554, (Europe PMC) | 0.49, 0.56 | BioGRID, IntAct |
| PIK3R2 | Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid | association, physical, physical association | 19380743, 25814554, (Europe PMC) | 0.35, 0.49 | BioGRID, IntAct |
| PIK3R3 | Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid | association, physical, physical association | 19380743, 25814554, (Europe PMC) | 0.49, 0.62 | BioGRID, IntAct |
| PLSCR1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PNMA2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| POT1 | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPFIBP2 | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 19447967, 26871637, (Europe PMC) | 0.67 | BioGRID, IntAct |
| PPIA | fluorescent resonance energy transfer, isothermal titration calorimetry, nuclear magnetic resonance | direct interaction, physical association | 26656091, (Europe PMC) | 0.61 | IntAct |
| PPP1CA | Two-hybrid, two hybrid | physical, physical association | 22321011, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPP1R12A | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| PRICKLE3 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PRKACA | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| PRRC2B | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PRRG2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| PRX | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| PSMC1 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMC6 | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 16189514, 26871637, (Europe PMC) | 0.76 | BioGRID, IntAct |
| PTK2 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array, validated two hybrid | physical, physical association | 10085298, 12615911, 25814554, 7561682, (Europe PMC) | 0.63 | BioGRID, IntAct |
| PTPN4 | Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, confocal microscopy, two hybrid | colocalization, physical, physical association | 21988832, (Europe PMC) | 0.54 | BioGRID, IntAct |
| PTTG1 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PXN | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 10085298, 12198159, 12799422, 26656091, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| RAB2B | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| RAG1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| RAPGEF1 | Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, coimmunoprecipitation, peptide array, pull down, tandem affinity purification | association, physical, physical association | 10464310, 17474147, 17515907, 18835194, 19380743, 7512734, 7531694, 8621483, 8943292, (Europe PMC) | 0.35, 0.69 | BioGRID, IntAct, MINT |
| RET | Co-localization, Reconstituted Complex, proximity ligation assay | physical, physical association | 25241761, 9393871, (Europe PMC) | 0.40 | BioGRID, IntAct |
| RGS20 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| RGS7 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| RIN3 | Two-hybrid, peptide array, two hybrid array | physical, physical association | 17474147, 25814554, (Europe PMC) | 0.57 | BioGRID, IntAct |
| RPP38 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| RRAS | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| RTCB | two hybrid array, validated two hybrid | physical association | 25814554, (Europe PMC) | 0.49 | IntAct |
| RYBP | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SAXO1 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SEMA4D | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| SEPT6 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SETD9 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SH2D2A | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| SHANK2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| SHANK3 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| SHC1 | Affinity Capture-MS, Affinity Capture-Western, proximity ligation assay, tandem affinity purification | association, physical, physical association | 10464310, 19380743, 23397142, 9617486, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SLC25A13 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SNX17 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| SNX3 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| SNX7 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| SOCS1 | Reconstituted Complex, Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 10022833, 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| SOCS6 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| SOS1 | Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, peptide array, proximity ligation assay, tandem affinity purification | association, physical, physical association | 17474147, 19380743, 25241761, 8810325, 8943292, (Europe PMC) | 0.69 | BioGRID, IntAct |
| SOS2 | Affinity Capture-MS, peptide array, tandem affinity purification | association, physical, physical association | 17474147, 19380743, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SP1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| SPEN | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| SPRR2A | Reconstituted Complex, protein array | direct interaction, physical | 18155796, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| SRC | Affinity Capture-Western, proximity ligation assay | physical, physical association | 10962563, 12615911, 23397142, (Europe PMC) | 0.40 | BioGRID, IntAct |
| STAT4 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| STAT5A | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| STRN4 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SUV39H2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| TAL1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| TCAP | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| TDG | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TERF2IP | Two-hybrid, bimolecular fluorescence complementation, pull down | physical, physical association | 21044950, (Europe PMC) | 0.51 | BioGRID, IntAct |
| TGOLN2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| THOC2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| TM4SF19 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| TNK2 | anti bait coimmunoprecipitation | physical association | 17038317, (Europe PMC) | 0.40 | IntAct, MINT |
| TP53 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TP53BP2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| TPX2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| TRIM39 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| TTBK2 | tandem affinity purification | association | 19380743, (Europe PMC) | 0.35 | IntAct |
| TUBA1C | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TWIST2 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| UBASH3A | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UBASH3B | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| USP53 | barcode fusion genetics two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical association | 26871637, 27107012, (Europe PMC) | 0.78 | IntAct |
| VAC14 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| VAV1 | coimmunoprecipitation | physical association | 8621483, (Europe PMC) | 0.40 | IntAct, MINT |
| WASL | coimmunoprecipitation | physical association | 15834156, (Europe PMC) | 0.40 | IntAct, MINT |
| WDR83 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZAP70 | Reconstituted Complex, pull down | association, physical | 10419455, 16339550, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| ZKSCAN7 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZNF557 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABL1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, nuclear magnetic resonance, peptide array, protein kinase assay, pull down | association, phosphorylation reaction, physical, physical association | 12097319, 12384576, 15696159, 17474147, 17515907, 18619508, 18835194, 19380743, 24412932, 8194526, 9747873, (Europe PMC) | 0.35, 0.44, 0.56 | BioGRID, IntAct, MINT |
| BCAR1 | Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down | association, physical, physical association | 10085298, 10329689, 10464310, 10747099, 10753828, 11278916, 11369773, 11839772, 12615911, 12799422, 14657239, 15492270, 15673687, 16267043, 17038317, 18835194, 19380743, 22974441, 9581808, 9920935, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| CBL | Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down, tandem affinity purification, two hybrid array, validated two hybrid | association, physical, physical association | 10962563, 11792427, 12393469, 15581361, 16289966, 18835194, 19380743, 22974441, 25814554, 8524328, 8621483, 8626404, 8626543, 8662998, 8683103, 8943292, 9129019, 9178909, 9416834, 9461587, 9617486, 9988765, (Europe PMC) | 0.49, 0.88 | BioGRID, IntAct, MINT |
| EGFR | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, PCA, Protein-peptide, Two-hybrid, luminescence based mammalian interactome mapping, protein array, ubiquitin reconstruction | direct interaction, physical, physical association | 10595738, 16273093, 16729043, 24658140, 25402006, 9617486, 9642287, (Europe PMC) | 0.51, 0.59 | BioGRID, IntAct, MINT |
| ERBB2 | Protein-peptide, protein array | direct interaction, physical | 16273093, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| ERBB3 | Protein-peptide, protein array | direct interaction, physical | 16273093, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| FGFR1 | Affinity Capture-Western, Co-localization, Reconstituted Complex, affinity chromatography technology, proximity ligation assay | association, physical, physical association | 10464310, 25241761, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| IRS4 | Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down | association, physical | 11316748, 9614078, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| KIT | Two-hybrid, fluorescence polarization spectroscopy, pull down | association, direct interaction, physical | 12878163, 24728074, 9233773, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| MAPK8 | Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay, pull down | physical, physical association | 11432831, 16982329, 25241761, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| PAG1 | anti bait coimmunoprecipitation | association | 18070987, (Europe PMC) | 0.35 | IntAct, MINT |
| PDGFRA | Affinity Capture-Western, Co-localization, Reconstituted Complex, coimmunoprecipitation, enzymatic study, proximity ligation assay, pull down | association, physical, physical association | 10733900, 25241761, 9546424, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| PDGFRB | Affinity Capture-Western, Reconstituted Complex, pull down | association, physical | 10733900, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| PXN | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 10085298, 12198159, 12799422, 26656091, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| RAPGEF1 | Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, coimmunoprecipitation, peptide array, pull down, tandem affinity purification | association, physical, physical association | 10464310, 17474147, 17515907, 18835194, 19380743, 7512734, 7531694, 8621483, 8943292, (Europe PMC) | 0.35, 0.69 | BioGRID, IntAct, MINT |
| SPRR2A | Reconstituted Complex, protein array | direct interaction, physical | 18155796, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| TNK2 | anti bait coimmunoprecipitation | physical association | 17038317, (Europe PMC) | 0.40 | IntAct, MINT |
| VAV1 | coimmunoprecipitation | physical association | 8621483, (Europe PMC) | 0.40 | IntAct, MINT |
| WASL | coimmunoprecipitation | physical association | 15834156, (Europe PMC) | 0.40 | IntAct, MINT |
| ZAP70 | Reconstituted Complex, pull down | association, physical | 10419455, 16339550, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABI1 | array technology | direct interaction | 20598684, (Europe PMC) | 0.44 | IntAct, MINT |
| ABL1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, nuclear magnetic resonance, peptide array, protein kinase assay, pull down | association, phosphorylation reaction, physical, physical association | 12097319, 12384576, 15696159, 17474147, 17515907, 18619508, 18835194, 19380743, 24412932, 8194526, 9747873, (Europe PMC) | 0.35, 0.44, 0.56 | BioGRID, IntAct, MINT |
| ABL2 | Affinity Capture-MS, Biochemical Activity, Reconstituted Complex, Two-hybrid, peptide array, protein kinase assay, tandem affinity purification, two hybrid array, validated two hybrid | association, phosphorylation reaction, physical, physical association | 15886098, 17474147, 19380743, 25814554, 8194526, (Europe PMC) | 0.49, 0.70 | BioGRID, IntAct |
| ACTB | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| AFF2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| AGO1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AGO2 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AGPAT4 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| AIRE | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| AKAP2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| AKAP6 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| ALS2CR12 | two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical association | 26871637, (Europe PMC) | 0.56 | IntAct |
| ANKZF1 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ANLN | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| AP2A1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AP2B1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| AP2M1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| APOL5 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| AR | fluorescence polarization spectroscopy | direct interaction | 24728074, (Europe PMC) | 0.44 | IntAct |
| ARHGAP17 | Reconstituted Complex | physical | 11431473, (Europe PMC) | NA | BioGRID |
| ARHGAP32 | Affinity Capture-Western, Reconstituted Complex | physical | 12454018, 12819203, (Europe PMC) | NA | BioGRID |
| ARHGEF11 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| ARPC1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ASAP1 | Affinity Capture-MS, Reconstituted Complex, peptide array | physical, physical association | 17474147, 19380743, 9819391, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ASAP2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| ASAP3 | Affinity Capture-MS, bimolecular fluorescence complementation, tandem affinity purification, two hybrid array, two hybrid prey pooling approach, validated two hybrid | association, physical, physical association | 19380743, 26871637, (Europe PMC) | 0.70 | BioGRID, IntAct |
| ASB9 | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.51 | BioGRID, IntAct |
| ASCL4 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ATF3 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ATIC | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| ATXN1 | Affinity Capture-Western, Two-hybrid, pull down, two hybrid array, two hybrid prey pooling approach | physical, physical association | 16713569, 23275563, (Europe PMC) | 0.63 | BioGRID, IntAct |
| AVIL | Reconstituted Complex | physical | 11287316, (Europe PMC) | NA | BioGRID |
| BAG3 | Affinity Capture-Luminescence, Affinity Capture-MS | physical | 23824909, (Europe PMC) | NA | BioGRID |
| BATF3 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BCAR1 | Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down | association, physical, physical association | 10085298, 10329689, 10464310, 10747099, 10753828, 11278916, 11369773, 11839772, 12615911, 12799422, 14657239, 15492270, 15673687, 16267043, 17038317, 18835194, 19380743, 22974441, 9581808, 9920935, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| BCR | Affinity Capture-MS, Reconstituted Complex | physical | 19380743, 8943292, (Europe PMC) | NA | BioGRID |
| BEX5 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| BICRA | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| BMX | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| BRD4 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| BUB1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| C1orf94 | two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical association | 26871637, (Europe PMC) | 0.56 | IntAct |
| C4orf17 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| C6orf141 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CASS4 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CAST | Co-fractionation, peptide array | physical, physical association | 17474147, 26344197, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CBL | Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down, tandem affinity purification, two hybrid array, validated two hybrid | association, physical, physical association | 10962563, 11792427, 12393469, 15581361, 16289966, 18835194, 19380743, 22974441, 25814554, 8524328, 8621483, 8626404, 8626543, 8662998, 8683103, 8943292, 9129019, 9178909, 9416834, 9461587, 9617486, 9988765, (Europe PMC) | 0.49, 0.88 | BioGRID, IntAct, MINT |
| CBLB | Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid | association, physical, physical association | 19380743, 25814554, (Europe PMC) | 0.49, 0.62 | BioGRID, IntAct |
| CBLC | Reconstituted Complex, Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 10362357, 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| CCP110 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CD93 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| CDH1 | Proximity Label-MS | physical | 25468996, (Europe PMC) | NA | BioGRID |
| CDH11 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| CELSR2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| CEP128 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP19 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP89 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHTF18 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| CLNK | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CNDP2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| CNTFR | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| CNTNAP1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| CORO1C | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CORO6 | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| COX6C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSE1L | Affinity Capture-Western | physical | 8943292, (Europe PMC) | NA | BioGRID |
| CSMD2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DDX3X | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| DDX41 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DDX5 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| DDX6 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DHX9 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| DKKL1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DLGAP1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DLGAP2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DLGAP3 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DLGAP4 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DLX4 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DNAJA3 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| DNM2 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DOCK1 | Affinity Capture-Western, Co-fractionation, Reconstituted Complex, peptide array, pull down | association, physical, physical association | 10559471, 11369773, 12615911, 15673687, 17474147, 17515907, 26344197, 8657152, 8662907, (Europe PMC) | 0.35, 0.40 | BioGRID, IntAct |
| DOCK3 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DOK1 | Protein-peptide | physical | 22974441, (Europe PMC) | NA | BioGRID |
| DOK2 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| DOK3 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| DOK7 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| DPPA4 | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 16189514, 26871637, (Europe PMC) | 0.67 | BioGRID, IntAct |
| DSC1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| DTX1 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| DUSP15 | peptide array | physical association | 17474147, (Europe PMC) | 0.40 | IntAct |
| EDC4 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) |