Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
SSH1
Gene Name  | SSH1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | SSH1, KIAA1298, SSH1L | |
| Protein Name | SSH1 |
|
| Alternative Name(s) |
Protein phosphatase Slingshot homolog 1;3.1.3.16;3.1.3.48;SSH-like protein 1;SSH-1L;hSSH-1L; | |
| EntrezGene ID | 54434 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q8WYL5 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 115511 Dalton | |
| Protein Length | 1049 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000084112 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class I Cys-based PTPs --> Family: DSP | Historic class: Class I Cys-based PTPs --> VH1-like or DSPs --> Slingshots | CATH ID: 3.90.190.10 | SCOP Fold: CC1 | |
| Phosphatase activity | active | Catalytic signature motif: HCKMGVSR | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm, cytoskeleton Cell projection,lamellipodium Cleavage furrow Midbody Note=Also recruited toactin rich membrane protrusions such as lamellipodia, which mayallow local control of actin dynamics at sites of cell locomotionAlso localized to the cleavage furrow and the midbody duringcytokinesis | |||
| Function (UniProt annotation) | |||
| Protein phosphatase which regulates actin filamentdynamics Dephosphorylates and activates the actinbinding/depolymerizing factor cofilin, which subsequently binds toactin filaments and stimulates their disassembly Inhibitoryphosphorylation of cofilin is mediated by LIMK1, which may also bedephosphorylated and inactivated by this protein | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MALVTLQRSPTPSAASSSASNSELEAGSEEDRKLNLSLSESFFMVKGAALFLQQGSSPQGQRSLQHPHKHAGDLPQHLQV MINLLRCEDRIKLAVRLESAWADRVRYMVVVYSSGRQDTEENILLGVDFSSKESKSCTIGMVLRLWSDTKIHLDGDGGFS VSTAGRMHIFKPVSVQAMWSALQVLHKACEVARRHNYFPGGVALIWATYYESCISSEQSCINEWNAMQDLESTRPDSPAL FVDKPTEGERTERLIKAKLRSIMMSQDLENVTSKEIRNELEKQMNCNLKELKEFIDNEMLLILGQMDKPSLIFDHLYLGS EWNASNLEELQGSGVDYILNVTREIDNFFPGLFAYHNIRVYDEETTDLLAHWNEAYHFINKAKRNHSKCLVHCKMGVSRS ASTVIAYAMKEFGWPLEKAYNYVKQKRSITRPNAGFMRQLSEYEGILDASKQRHNKLWRQQTDSSLQQPVDDPAGPGDFL PETPDGTPESQLPFLDDAAQPGLGPPLPCCFRRLSDPLLPSPEDETGSLVHLEDPEREALLEEAAPPAEVHRPARQPQQG SGLCEKDVKKKLEFGSPKGRSGSLLQVEETEREEGLGAGRWGQLPTQLDQNLLNSENLNNNSKRSCPNGMEDDAIFGILN KVKPSYKSCADCMYPTASGAPEASRERCEDPNAPAICTQPAFLPHITSSPVAHLASRSRVPEKPASGPTEPPPFLPPAGS RRADTSGPGAGAALEPPASLLEPSRETPKVLPKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKP TTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPAPPSRDGPASRLEASIPEESQDPAALHELGPLVMPSQAGSD EKSEAAPASLEGGSLKSPPPFFYRLDHTSSFSKDFLKTICYTPTSSSMSSNLTRSSSSDSIHSVRGKPGLVKQRTQEIET RLRLAGLTVSSPLKRSHSLAKLGSLTFSTEDLSSEADPSTVADSQDTTLSESSFLHEPQGTPRDPAATSKPSGKPAPENL KSPSWMSKS |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000902 | P:cell morphogenesis |
| GO:0003779 | F:actin binding |
| GO:0004721 | F:phosphoprotein phosphatase activity |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0005856 | C:cytoskeleton |
| GO:0005886 | C:plasma membrane |
| GO:0006470 | P:protein dephosphorylation |
| GO:0008064 | P:regulation of actin polymerization or depolymerization |
| GO:0008138 | F:protein tyrosine/serine/threonine phosphatase activity |
| GO:0010591 | P:regulation of lamellipodium assembly |
| GO:0030027 | C:lamellipodium |
| GO:0030036 | P:actin cytoskeleton organization |
| GO:0030426 | C:growth cone |
| GO:0030496 | C:midbody |
| GO:0031915 | P:positive regulation of synaptic plasticity |
| GO:0032154 | C:cleavage furrow |
| GO:0032268 | P:regulation of cellular protein metabolic process |
| GO:0050770 | P:regulation of axonogenesis |
| GO:0071318 | P:cellular response to ATP |
| GO:0098976 | P:excitatory chemical synaptic transmission |
| GO:1901216 | P:positive regulation of neuron death |
| GO:1904719 | P:positive regulation of AMPA glutamate receptor clustering |
| GO:1904754 | P:positive regulation of vascular associated smooth muscle cell migration |
| GO:2000463 | P:positive regulation of excitatory postsynaptic potential |
