Top
CFL1
Localization (UniProt annotation) Nucleus matrix Cytoplasm, cytoskeleton Cell projection, ruffle membrane Cell projection, lamellipodiummembrane Cell projection, lamellipodium Note=Colocalizes with the actincytoskeleton in membrane ruffles and lamellipodia Detected at thecleavage furrow and contractile ring during cytokinesis Almostcompletely in nucleus in cells exposed to heat shock or 10%dimethyl sulfoxide Function (UniProt annotation) Binds to F-actin and exhibits pH-sensitive F-actindepolymerizing activity Regulates actin cytoskeleton dynamicsImportant for normal progress through mitosis and normalcytokinesis Plays a role in the regulation of cell morphology andcytoskeletal organization Required for the up-regulation ofatypical chemokine receptor ACKR2 from endosomal compartment tocell membrane, increasing its efficiency in chemokine uptake anddegradation (PubMed:11812157, PubMed:15580268, PubMed:21834987,PubMed:23633677) Required for neural tube morphogenesis andneural crest cell migration (By similarity) Catalytic Activity (UniProt annotation) N/A Protein Sequence MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDC
RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVIS
LEGKPL
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
CFL1 is dephosphorylated by following phosphatases:
Phosphatase Gene Name Phosphatase UniProt_AC DephosphoSite and sequence (+/-5) in CFL1 (P23528) Bioassay Type PubMed ID View in Europe PMC Reliability of the interaction PDXP Q96GD0 Ser-3_---MAsGVMVS , In vitro and in vivo 15580268 , Europe PMC SSH1 Q8WYL5 Ser-3_---MAsGVAVS , In vitro and in vivo 11832213 , 14531860 , Europe PMC SSH2 Q76I76 Ser-3_---MAsGVAVS , In vitro and in vivo 11832213 , 14531860 , Europe PMC SSH3 Q8TE77 Ser-3_---MAsGVAVS , In vitro and in vivo 14531860 , Europe PMC
Pathway ID Pathway Name Pathway Description (KEGG) hsa04360 Axon guidance Axon guidance represents a key stage in the formation of neuronal network. Axons are guided by a variety of guidance factors, such as netrins, ephrins, Slits, and semaphorins. These guidance cues are read by growth cone receptors, and signal transduction pathways downstream of these receptors converge onto the Rho GTPases to elicit changes in cytoskeletal organization that determine which way the growth cone will turn. hsa04666 Fc gamma R-mediated phagocytosis Phagocytosis plays an essential role in host-defense mechanisms through the uptake and destruction of infectious pathogens. Specialized cell types including macrophages, neutrophils, and monocytes take part in this process in higher organisms. After opsonization with antibodies (IgG), foreign extracellular materials are recognized by Fc gamma receptors. Cross-linking of Fc gamma receptors initiates a variety of signals mediated by tyrosine phosphorylation of multiple proteins, which lead through the actin cytoskeleton rearrangements and membrane remodeling to the formation of phagosomes. Nascent phagosomes undergo a process of maturation that involves fusion with lysosomes. The acquisition of lysosomal proteases and release of reactive oxygen species are crucial for digestion of engulfed materials in phagosomes. hsa04810 Regulation of actin cytoskeleton hsa05133 Pertussis Pertussis, also known as whooping cough, is an acute respiratory infectious disease caused by a bacteria called Bordetella Pertussis. The characteristic symptoms are paroxysmal cough, inspiratory wheezing and post-tussive vomiting.Following the inhalation of respiratory secretions from an infected individual, bacteria enter the upper respiratory tract and adhere to epithelial cells. Several adhesion factors have been implicated: the filamentous hemagglutinin (FHA), fimbriae, and pertactin (Prn).Pertussis toxin (Ptx) and adenylate cyclase toxin (ACT) have been identified so far as major protein toxins of B. pertussis. PTX is a hexameric AB5-type exotoxin. Catalytic A subunit catalyzes the ADP-ribosylation of the Gi subunits of the heterotrimeric G protein, then inhibits multiple downstream pathways. ACT is able to penetrate the cytoplasmic membrane of host cells and becomes activated through the cleavage and the binding of calmodulin (CaM). Activated ACT converts ATP to cyclic AMP and subverts cellular signaling pathways. hsa05170 Human immunodeficiency virus 1 infection Human immunodeficiency virus type 1 (HIV-1) , the causative agent of AIDS (acquired immunodeficiency syndrome), is a lentivirus belonging to the Retroviridae family. The primary cell surface receptor for HIV-1, the CD4 protein, and the co-receptor for HIV-1, either CCR5 or CXCR4, are found on macrophages and T lymphocytes. At the earliest step, sequential binding of virus envelope (Env) glycoprotein gp120 to CD4 and the co-receptor CCR5 or CXCR4 facilitates HIV-1 entry and has the potential to trigger critical signaling that may favor viral replication. At advanced stages of the disease, HIV-1 infection results in dramatic induction of T-cell (CD4+ T and CD8+ T cell) apoptosis both in infected and uninfected bystander T cells, a hallmark of HIV-1 pathogenesis. On the contrary, macrophages are resistant to the cytopathic effect of HIV-1 and produce virus for longer periods of time.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-114608 Platelet degranulation. Platelets function as exocytotic cells, secreting a plethora of effector molecules at sites of vascular injury. Platelets contain a number of distinguishable storage granules including alpha granules, dense granules and lysosomes. On activation platelets release a variety of proteins, largely from storage granules but also as the result of apparent cell lysis. These act in an autocrine or paracrine fashion to modulate cell signaling. Alpha granules contain mainly polypeptides such as fibrinogen, von Willebrand factor, growth factors and protease inhibitors that that supplement thrombin generation at the site of injury. Dense granules contain small molecules, particularly adenosine diphosphate (ADP), adenosine triphosphate (ATP), serotonin and calcium, all recruit platelets to the site of injury. \n\nThe molecular mechanism which facilitates granule release involves soluble NSF attachment protein receptors (SNAREs), which assemble into complexes to form a universal membrane fusion apparatus. Although all cells use SNAREs for membrane fusion, different cells possess different SNARE isoforms. Platelets and chromaffin cells use many of the same chaperone proteins to regulate SNARE-mediated secretion (Fitch-Tewfik & Flaumenhaft 2013) R-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation. The actin cytoskeleton is fundamental for phagocytosis and members of the Rho family GTPases RAC and CDC42 are involved in actin cytoskeletal regulation leading to pseudopod extension. Active RAC and CDC42 exert their action through the members of WASP family proteins (WASP/N-WASP/WAVE) and ARP2/3 complex. Actin filaments move from the bottom toward the top of the phagocytic cup during pseudopod extension R-HSA-3928662 EPHB-mediated forward signaling. Multiple EPHB receptors contribute directly to dendritic spine development and morphogenesis. These are more broadly involved in post-synaptic development through activation of focal adhesion kinase (FAK) and Rho family GTPases and their GEFs. Dendritic spine morphogenesis is a vital part of the process of synapse formation and maturation during CNS development. Dendritic spine morphogenesis is characterized by filopodia shortening followed by the formation of mature mushroom-shaped spines (Moeller et al. 2006). EPHBs control neuronal morphology and motility by modulation of the actin cytoskeleton. EPHBs control dendritic filopodia motility, enabling synapse formation. EPHBs exert these effects through interacting with the guanine exchange factors (GEFs) such as intersectin and kalirin. The intersectin-CDC42-WASP-actin and kalirin-RAC-PAK-actin pathways have been proposed to regulate the EPHB receptor mediated morphogenesis and maturation of dendritic spines in cultured hippocampal and cortical neurons (Irie & Yamaguchi 2002, Penzes et al. 2003). EPHBs are also involved in the regulation of dendritic spine morphology through FAK which activates the RHOA-ROCK-LIMK-1 pathway to suppress cofilin activity and inhibit cofilin-mediated dendritic spine remodeling (Shi et al. 2009) R-HSA-399954 Sema3A PAK dependent Axon repulsion. Activated Rac1 bound to plexin-A might modulate actin dynamics through the sequential phosphorylation and activation of PAK, LIMK1 and cofilin R-HSA-5627117 RHO GTPases Activate ROCKs. RHO associated, coiled-coil containing protein kinases ROCK1 and ROCK2 consist of a serine/threonine kinase domain, a coiled-coil region, a RHO-binding domain and a plekstrin homology (PH) domain interspersed with a cysteine-rich region. The PH domain inhibits the kinase activity of ROCKs by an intramolecular fold. ROCKs are activated by binding of the GTP-bound RHO GTPases RHOA, RHOB and RHOC to the RHO binding domain of ROCKs (Ishizaki et al. 1996, Leung et al. 1996), which disrupts the autoinhibitory fold. Once activated, ROCK1 and ROCK2 phosphorylate target proteins, many of which are involved in the stabilization of actin filaments and generation of actin-myosin contractile force. ROCKs phosphorylate LIM kinases LIMK1 and LIMK2, enabling LIMKs to phosphorylate cofilin, an actin depolymerizing factor, and thereby regulate the reorganization of the actin cytoskeleton (Ohashi et al. 2000, Sumi et al. 2001). ROCKs phosphorylate MRLC (myosin regulatory light chain), which stimulates the activity of non-muscle myosin II (NMM2), an actin-based motor protein involved in cell migration, polarity formation and cytokinesis (Amano et al. 1996, Riento and Ridley 2003, Watanabe et al. 2007, Amano et al. 2010). ROCKs also phosphorylate the myosin phosphatase targeting subunit (MYPT1) of MLC phosphatase, inhibiting the phosphatase activity and preventing dephosphorylation of MRLC. This pathway acts synergistically with phosphorylation of MRLC by ROCKs towards stimulation of non-muscle myosin II activity (Kimura et al. 1996, Amano et al. 2010) R-HSA-8950505 Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation. Experiments using human cord blood CD4(+) T cells show 22 protein spots and 20 protein spots, upregulated and downregulated proteins respectively, following Interleukin-12 stimulation (Rosengren et.al, 2005).\n The identified upregulated proteins are: BOLA2, PSME2, MTAP, CA1, GSTA2, RALA, CNN2, CFL1, TCP1, HNRNPDL, MIF, AIP, SOD1, PPIA and PDCD4.And the identified downregulated proteins are:ANXA2, RPLP0, CAPZA1, SOD2, SNRPA1, LMNB1, LCP1, HSPA9, SERPINB2, HNRNPF, TALDO1, PAK2, TCP1, HNRNPA2B1, MSN, PITPNA, ARF1, SOD2, ANXA2, CDC42, RAP1B and GSTO1
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACAA2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ACTA1 Affinity Capture-MS, Reconstituted Complex physical 11950878 , 21723825 , (Europe PMC )NA BioGRID ACTB Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 25416956 , (Europe PMC )0.76 BioGRID, IntAct ACTBL2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ACTG1 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 25416956 , (Europe PMC )0.76 BioGRID, IntAct ACTR2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AKR1A1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ALDH4A1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ALDOA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ANLN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct APP Two-hybrid physical 21163940 , (Europe PMC )NA BioGRID ARF4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ARRB1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy association, colocalization, physical 17500066 , 17620599 , (Europe PMC )0.58 BioGRID, IntAct ARRB2 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy association, colocalization, physical 17500066 , 17620599 , (Europe PMC )0.58 BioGRID, IntAct ATF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22304920 , (Europe PMC )0.35 BioGRID, IntAct ATXN1 Affinity Capture-Western, Two-hybrid, pull down, two hybrid physical, physical association 16713569 , (Europe PMC )0.51 BioGRID, IntAct CAP1 Affinity Capture-MS physical 11950878 , 26186194 , 28514442 , (Europe PMC )NA BioGRID CAP2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CAPG Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CAPZA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CD81 Affinity Capture-MS physical 23463506 , (Europe PMC )NA BioGRID CDC73 Affinity Capture-MS physical 27462432 , (Europe PMC )NA BioGRID CDK2 Affinity Capture-MS physical 21319273 , (Europe PMC )NA BioGRID CFL2 Two-hybrid, two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.37 BioGRID, IntAct, MINT CFTR Affinity Capture-MS physical 17110338 , (Europe PMC )NA BioGRID CKS2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID COTL1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID COX17 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CRIP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CSRP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID DAZAP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID DBN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DBNL Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID DCAF4L2 Affinity Capture-MS physical 27158335 , (Europe PMC )NA BioGRID DUT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID DYNLL1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ECT2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID EED Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID EGFR PCA, ubiquitin reconstruction physical, physical association 20029029 , 24658140 , (Europe PMC )0.55 BioGRID, IntAct EIF4B Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EIF6 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ENO1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ESR1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT FAHD1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID FBXO25 Affinity Capture-MS physical 20473970 , (Europe PMC )NA BioGRID FLNA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct FUS Affinity Capture-MS physical 25192599 , (Europe PMC )NA BioGRID G3BP1 Affinity Capture-MS physical 26777405 , (Europe PMC )NA BioGRID GAPDH Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GPT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GPT2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GRK5 Affinity Capture-MS physical 22952844 , (Europe PMC )NA BioGRID H2AFX Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, confocal microscopy association, colocalization, physical 20000738 , (Europe PMC )0.43 BioGRID, IntAct HECW2 Affinity Capture-MS physical 24163370 , (Europe PMC )NA BioGRID HNRNPA1 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID HSPA9 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPE1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPH1 Reconstituted Complex, Two-hybrid physical 14733918 , (Europe PMC )NA BioGRID IGSF8 Affinity Capture-MS physical 23463506 , (Europe PMC )NA BioGRID IQGAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ISG15 Affinity Capture-MS, Affinity Capture-Western physical 16009940 , 16815975 , (Europe PMC )NA BioGRID ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID JPT1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KYNU Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID LDHA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID LDHAL6A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID LDHB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID LIMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LIMK1 Biochemical Activity, anti bait coimmunoprecipitation, protein kinase assay phosphorylation reaction, physical, physical association 10436159 , 12963706 , 15220930 , 16278681 , 17500066 , 17853892 , 19424295 , 20133759 , (Europe PMC )0.72 BioGRID, IntAct, MINT LIMK2 Affinity Capture-Western physical 10436159 , (Europe PMC )NA BioGRID LYPLA2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MAPK6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAPK8IP2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MCM2 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MCM5 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MDH2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MTAP Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID MYCBP Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct MYH9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO18A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO19 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NME1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NME1-NME2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NME2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NPM1 Affinity Capture-MS physical 23402259 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NUP214 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PAN2 Affinity Capture-MS physical 23398456 , (Europe PMC )NA BioGRID PCBP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PEBP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PFN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PIN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PIR Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PKM Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID POLR1C Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID POT1 Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct PPIA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPP1CB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PRDX1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PRDX5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PRKCZ Affinity Capture-Western physical 23402259 , (Europe PMC )NA BioGRID PSEN1 Two-hybrid, two hybrid physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct PTEN Reconstituted Complex physical 26561776 , (Europe PMC )NA BioGRID PTGR1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PUDP Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RAB10 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RAB7A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RAD21 Two-hybrid physical 22145905 , (Europe PMC )NA BioGRID ROCK1 Affinity Capture-Western physical 10436159 , (Europe PMC )NA BioGRID RPS6KA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RPS6KB2 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID RTN4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SERPINH1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SMURF1 Affinity Capture-MS physical 23184937 , (Europe PMC )NA BioGRID SOD1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SRC Biochemical Activity physical 19802004 , (Europe PMC )NA BioGRID SRXN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STYX Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID SUGT1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SYNPO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TAB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TAGLN Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct TAGLN2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TANGO2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TERF1 Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct TES Affinity Capture-MS physical 28378594 , (Europe PMC )NA BioGRID TKT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TPI1 Affinity Capture-Western physical 12359716 , (Europe PMC )NA BioGRID TRAP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TRIM15 PCA physical 25450970 , (Europe PMC )NA BioGRID TXNDC17 Affinity Capture-MS physical 14607843 , (Europe PMC )NA BioGRID U2AF2 Affinity Capture-MS physical 26641092 , (Europe PMC )NA BioGRID UBA52 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID UCHL5 Reconstituted Complex physical 21800051 , (Europe PMC )NA BioGRID UFD1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UFM1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct WDR1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID WWP2 Affinity Capture-MS physical 25071155 , (Europe PMC )NA BioGRID YWHAQ Reconstituted Complex physical 15161933 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTG1 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 25416956 , (Europe PMC )0.76 BioGRID, IntAct ACTR2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ANLN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARRB1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy association, colocalization, physical 17500066 , 17620599 , (Europe PMC )0.58 BioGRID, IntAct ARRB2 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy association, colocalization, physical 17500066 , 17620599 , (Europe PMC )0.58 BioGRID, IntAct ATF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22304920 , (Europe PMC )0.35 BioGRID, IntAct ATXN1 Affinity Capture-Western, Two-hybrid, pull down, two hybrid physical, physical association 16713569 , (Europe PMC )0.51 BioGRID, IntAct CAPZA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CFL2 Two-hybrid, two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.37 BioGRID, IntAct, MINT DBN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct EBI-1059270 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EGFR PCA, ubiquitin reconstruction physical, physical association 20029029 , 24658140 , (Europe PMC )0.55 BioGRID, IntAct ERBB4 ubiquitin reconstruction physical association 24658140 , (Europe PMC )0.37 IntAct ESR1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT FLNA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct GABARAPL1 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GRB2 pull down association 12577067 , (Europe PMC )0.35 IntAct H2AFX Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, confocal microscopy association, colocalization, physical 20000738 , (Europe PMC )0.43 BioGRID, IntAct HUNK anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical association 20133759 , (Europe PMC )0.52 IntAct IQGAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LIMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LIMK1 Biochemical Activity, anti bait coimmunoprecipitation, protein kinase assay phosphorylation reaction, physical, physical association 10436159 , 12963706 , 15220930 , 16278681 , 17500066 , 17853892 , 19424295 , 20133759 , (Europe PMC )0.72 BioGRID, IntAct, MINT MAP1LC3A anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct MAPK6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAPK8IP2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MYC tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MYCBP Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct MYH9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO18A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO19 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NFKB1 tandem affinity purification association 25609649 , (Europe PMC )0.35 IntAct, MINT OCRL anti tag coimmunoprecipitation association 25107275 , (Europe PMC )0.35 IntAct, MINT PLD1 anti bait coimmunoprecipitation, fluorescence microscopy, pull down colocalization, direct interaction, physical association 17853892 , (Europe PMC )0.57 IntAct, MINT PLD2 anti bait coimmunoprecipitation, pull down direct interaction, physical association 17853892 , (Europe PMC )0.54 IntAct, MINT PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct POT1 Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct PPP1CB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP2CA anti bait coimmunoprecipitation physical association 20133759 , (Europe PMC )0.40 IntAct PSEN1 Two-hybrid, two hybrid physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct PTBP3 anti bait coimmunoprecipitation association 22575643 , (Europe PMC )0.35 IntAct, MINT RAB7A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RPS6KA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SSH1 pull down physical association 21525957 , (Europe PMC )0.40 IntAct, MINT SYNPO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TAB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TAGLN Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct TERF1 Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct YWHAG pull down association, physical association 15598710 , (Europe PMC )0.50 IntAct, MINT YWHAZ affinity chromatography technology, pull down physical association 12361576 , 15161933 , (Europe PMC )0.66 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ESR1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LIMK1 Biochemical Activity, anti bait coimmunoprecipitation, protein kinase assay phosphorylation reaction, physical, physical association 10436159 , 12963706 , 15220930 , 16278681 , 17500066 , 17853892 , 19424295 , 20133759 , (Europe PMC )0.72 BioGRID, IntAct, MINT MAPK6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAPK8IP2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NFKB1 tandem affinity purification association 25609649 , (Europe PMC )0.35 IntAct, MINT OCRL anti tag coimmunoprecipitation association 25107275 , (Europe PMC )0.35 IntAct, MINT PLD1 anti bait coimmunoprecipitation, fluorescence microscopy, pull down colocalization, direct interaction, physical association 17853892 , (Europe PMC )0.57 IntAct, MINT PLD2 anti bait coimmunoprecipitation, pull down direct interaction, physical association 17853892 , (Europe PMC )0.54 IntAct, MINT PTBP3 anti bait coimmunoprecipitation association 22575643 , (Europe PMC )0.35 IntAct, MINT RPS6KA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SSH1 pull down physical association 21525957 , (Europe PMC )0.40 IntAct, MINT TAB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT YWHAG pull down association, physical association 15598710 , (Europe PMC )0.50 IntAct, MINT YWHAZ affinity chromatography technology, pull down physical association 12361576 , 15161933 , (Europe PMC )0.66 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACAA2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ACTA1 Affinity Capture-MS, Reconstituted Complex physical 11950878 , 21723825 , (Europe PMC )NA BioGRID ACTB Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 25416956 , (Europe PMC )0.76 BioGRID, IntAct ACTBL2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ACTG1 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 25416956 , (Europe PMC )0.76 BioGRID, IntAct ACTR2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AKR1A1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ALDH4A1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ALDOA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ANLN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct APP Two-hybrid physical 21163940 , (Europe PMC )NA BioGRID ARF4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ARRB1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy association, colocalization, physical 17500066 , 17620599 , (Europe PMC )0.58 BioGRID, IntAct ARRB2 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy association, colocalization, physical 17500066 , 17620599 , (Europe PMC )0.58 BioGRID, IntAct ATF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22304920 , (Europe PMC )0.35 BioGRID, IntAct ATXN1 Affinity Capture-Western, Two-hybrid, pull down, two hybrid physical, physical association 16713569 , (Europe PMC )0.51 BioGRID, IntAct CAP1 Affinity Capture-MS physical 11950878 , 26186194 , 28514442 , (Europe PMC )NA BioGRID CAP2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CAPG Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CAPZA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CD81 Affinity Capture-MS physical 23463506 , (Europe PMC )NA BioGRID CDC73 Affinity Capture-MS physical 27462432 , (Europe PMC )NA BioGRID CDK2 Affinity Capture-MS physical 21319273 , (Europe PMC )NA BioGRID CFL2 Two-hybrid, two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.37 BioGRID, IntAct, MINT CFTR Affinity Capture-MS physical 17110338 , (Europe PMC )NA BioGRID CKS2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID COTL1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID COX17 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CRIP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CSRP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID DAZAP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID DBN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DBNL Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID DCAF4L2 Affinity Capture-MS physical 27158335 , (Europe PMC )NA BioGRID DUT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID DYNLL1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EBI-1059270 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ECT2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID EED Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID EGFR PCA, ubiquitin reconstruction physical, physical association 20029029 , 24658140 , (Europe PMC )0.55 BioGRID, IntAct EIF4B Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EIF6 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ENO1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ERBB4 ubiquitin reconstruction physical association 24658140 , (Europe PMC )0.37 IntAct ESR1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT FAHD1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID FBXO25 Affinity Capture-MS physical 20473970 , (Europe PMC )NA BioGRID FLNA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct FUS Affinity Capture-MS physical 25192599 , (Europe PMC )NA BioGRID G3BP1 Affinity Capture-MS physical 26777405 , (Europe PMC )NA BioGRID GABARAPL1 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GAPDH Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GPT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GPT2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GRB2 pull down association 12577067 , (Europe PMC )0.35 IntAct GRK5 Affinity Capture-MS physical 22952844 , (Europe PMC )NA BioGRID H2AFX Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, confocal microscopy association, colocalization, physical 20000738 , (Europe PMC )0.43 BioGRID, IntAct HECW2 Affinity Capture-MS physical 24163370 , (Europe PMC )NA BioGRID HNRNPA1 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID HSPA9 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPE1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPH1 Reconstituted Complex, Two-hybrid physical 14733918 , (Europe PMC )NA BioGRID HUNK anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical association 20133759 , (Europe PMC )0.52 IntAct IGSF8 Affinity Capture-MS physical 23463506 , (Europe PMC )NA BioGRID IQGAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ISG15 Affinity Capture-MS, Affinity Capture-Western physical 16009940 , 16815975 , (Europe PMC )NA BioGRID ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID JPT1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KYNU Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID LDHA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID LDHAL6A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID LDHB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID LIMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LIMK1 Biochemical Activity, anti bait coimmunoprecipitation, protein kinase assay phosphorylation reaction, physical, physical association 10436159 , 12963706 , 15220930 , 16278681 , 17500066 , 17853892 , 19424295 , 20133759 , (Europe PMC )0.72 BioGRID, IntAct, MINT LIMK2 Affinity Capture-Western physical 10436159 , (Europe PMC )NA BioGRID LYPLA2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MAP1LC3A anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct MAPK6 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAPK8IP2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MCM2 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MCM5 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MDH2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MTAP Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID MYC tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MYCBP Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct MYH9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO18A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO19 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MYO19 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NFKB1 tandem affinity purification association 25609649 , (Europe PMC )0.35 IntAct, MINT NME1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NME1-NME2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NME2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NPM1 Affinity Capture-MS physical 23402259 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NUP214 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID OCRL anti tag coimmunoprecipitation association 25107275 , (Europe PMC )0.35 IntAct, MINT PAN2 Affinity Capture-MS physical 23398456 , (Europe PMC )NA BioGRID PCBP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PEBP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PFN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PIN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PIR Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PKM Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PLD1 anti bait coimmunoprecipitation, fluorescence microscopy, pull down colocalization, direct interaction, physical association 17853892 , (Europe PMC )0.57 IntAct, MINT PLD2 anti bait coimmunoprecipitation, pull down direct interaction, physical association 17853892 , (Europe PMC )0.54 IntAct, MINT PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct POLR1C Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID POT1 Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct PPIA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPP1CB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP2CA anti bait coimmunoprecipitation physical association 20133759 , (Europe PMC )0.40 IntAct PRDX1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PRDX5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PRKCZ Affinity Capture-Western physical 23402259 , (Europe PMC )NA BioGRID PSEN1 Two-hybrid, two hybrid physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct PTBP3 anti bait coimmunoprecipitation association 22575643 , (Europe PMC )0.35 IntAct, MINT PTEN Reconstituted Complex physical 26561776 , (Europe PMC )NA BioGRID PTGR1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PUDP Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RAB10 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RAB7A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RAD21 Two-hybrid physical 22145905 , (Europe PMC )NA BioGRID ROCK1 Affinity Capture-Western physical 10436159 , (Europe PMC )NA BioGRID RPS6KA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RPS6KB2 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID RTN4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SERPINH1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SMURF1 Affinity Capture-MS physical 23184937 , (Europe PMC )NA BioGRID SOD1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SRC Biochemical Activity physical 19802004 , (Europe PMC )NA BioGRID SRXN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SSH1 pull down physical association 21525957 , (Europe PMC )0.40 IntAct, MINT STYX Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID SUGT1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SYNPO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TAB1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TAGLN Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct TAGLN2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TANGO2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TERF1 Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct TES Affinity Capture-MS physical 28378594 , (Europe PMC )NA BioGRID TKT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TPI1 Affinity Capture-Western physical 12359716 , (Europe PMC )NA BioGRID TRAP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TRIM15 PCA physical 25450970 , (Europe PMC )NA BioGRID TXNDC17 Affinity Capture-MS physical 14607843 , (Europe PMC )NA BioGRID U2AF2 Affinity Capture-MS physical 26641092 , (Europe PMC )NA BioGRID UBA52 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID UCHL5 Reconstituted Complex physical 21800051 , (Europe PMC )NA BioGRID UFD1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UFM1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct WDR1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID WWP2 Affinity Capture-MS physical 25071155 , (Europe PMC )NA BioGRID YWHAG pull down association, physical association 15598710 , (Europe PMC )0.50 IntAct, MINT YWHAQ Reconstituted Complex physical 15161933 , (Europe PMC )NA BioGRID YWHAZ affinity chromatography technology, pull down physical association 12361576 , 15161933 , (Europe PMC )0.66 IntAct, MINT
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
LIMK1 S3_EGKPLsGVAVSDG , S3_MAsGVAVSDG , LTP, in vitro, in vivo 11340065 , 11418599 , 11925442 , 18491316 , 18578522 , 18669648 , 18702456 , 19413330 , 19651622 , 20058876 , 20068231 , 9655398 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , LIMK2 S3_EGKPLsGVAVSDG , S3_MAsGVAVSDG , LTP, in vitro, in vivo 11340065 , 11418599 , 11925442 , 18491316 , 18578522 , 18669648 , 18702456 , 19413330 , 19651622 , 20058876 , 20068231 , 9655398 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , NRK S3_MAsGVAVSDG , in vitro, in vivo 11340065 , 11418599 , 11925442 , 18491316 , 18578522 , 18669648 , 18702456 , 19413330 , 19651622 , 20058876 , 20068231 , 9655398 ,(Europe PMC )HPRD, PRKCA S23_NDMKVRKsSTPEEVK , S24_DMKVRKSsTPEEVKK , NA NA PhosphoSitePlus , PRKD1 S3_MAsGVAVSDG , NA NA PhosphoSitePlus , SRC Y68_GQTVDDPyATFVKML , NA NA PhosphoSitePlus , TESK1 S3_EGKPLsGVAVSDG , S3_MAsGVAVSDG , LTP, in vitro, in vivo 11340065 , 11418599 , 11925442 , 18491316 , 18578522 , 18669648 , 18702456 , 19413330 , 19651622 , 20058876 , 20068231 , 9655398 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , TESK2 S3_EGKPLsGVAVSDG , S3_MAsGVAVSDG , LTP, in vitro, in vivo 11340065 , 11418599 , 11925442 , 18491316 , 18578522 , 18669648 , 18702456 , 19413330 , 19651622 , 20058876 , 20068231 , 9655398 ,(Europe PMC )HPRD, PhosphoELM , Unknown S156_LAEKLGGsAVISLEG , S23_NDMKVRKsSTPEEVK , S24_DMKVRKSsTPEEVKK , S41_KAVLFCLsEDKKNII , S8_MASGVAVsDGVIKVF , T25_MKVRKSStPEEVKKR , Y140_HELQANCyEEVKDRC , Y68_GQTVDDPyATFVKML , Y85_KDCRYALyDATYETK , Y89_YALYDATyETKESKK , HTP, in vivo 15592455 , 15951569 , 16497976 , 16964243 , 17016520 , 17081983 , 17389395 , 18083107 , 18669648 , 19651622 , 20068231 ,(Europe PMC )HPRD, PhosphoELM ,