Top
PPP4C
Gene Name PPP4C (QuickGO )Interactive visualization PPP4C structures
(A quick tutorial to explore the interctive visulaization)
Synonyms
PPP4C, PPP4, PPX
Protein Name
PPP4C
Alternative Name(s)
Serine/threonine-protein phosphatase 4 catalytic subunit;PP4C;Pp4;3.1.3.16;Protein phosphatase X;PP-X;
EntrezGene ID 5531    (Comparitive Toxicogenomics)
UniProt AC (Human)
P60510 (protein sequence )
Enzyme Class EC 3.1.3.16 (BRENDA ) Molecular Weight 35080 Dalton Protein Length 307 amino acids (AA) Genome Browsers NCBI | ENSG00000149923 (Ensembl) | UCSC Crosslinking annotations Query our ID-mapping tableOrthologues Quest For Orthologues (QFO) | GeneTree Classification Superfamily: PPPL --> Family: PPP | Historic class: PSTPs --> PPP --> PP4 | CATH ID: 3.60.21.10 | SCOP Fold: PPPL Phosphatase activity active | Catalytic signature motif: unknown
Localization (UniProt annotation) Cytoplasm Nucleus Cytoplasm, cytoskeleton,microtubule organizing center, centrosome Function (UniProt annotation) Protein phosphatase that is involved in many processessuch as microtubule organization at centrosomes, maturation ofspliceosomal snRNPs, apoptosis, DNA repair, tumor necrosis factor(TNF)-alpha signaling, activation of c-Jun N-terminal kinaseMAPK8, regulation of histone acetylation, DNA damage checkpointsignaling, NF-kappa-B activation and cell migration The PPP4C-PPP4R1 PP4 complex may play a role in dephosphorylation andregulation of HDAC3 The PPP4C-PPP4R2-PPP4R3A PP4 complexspecifically dephosphorylates H2AFX phosphorylated on Ser-140(gamma-H2AFX) generated during DNA replication and required forDNA double strand break repair Dephosphorylates NDEL1 at CDK1phosphorylation sites and negatively regulates CDK1 activity ininterphase (By similarity) In response to DNA damage, catalyzesRPA2 dephosphorylation, an essential step for DNA repair since itallows the efficient RPA2-mediated recruitment of RAD51 tochromatin Catalytic Activity (UniProt annotation) [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate Protein Sequence MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFM
GDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKI
FCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQL
VMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Download FASTA sequences of PPP4C-substrates in HumansSubstrate Gene Name Substrate UniProt_AC DephosphoSite and sequence (+/-5) Bioassay Type PubMed ID View in Europe PMC Reliability of the interaction H2AFX P16104 Ser-140 _KATQAsQEY-- , In vitro and in vivo 18758438 , 18614045 , Europe PMC RPA2 P15927 NA In vitro and in vivo 20154705 , Europe PMC NDEL1 Q9GZM8 Thr-219_LSLPAtPVGKG , In vitro and in vivo 18347064 , Europe PMC HDAC3 O15379 Ser-424_DNDKEsDVEI- , In vivo 15805470 , Europe PMC RELA Q04206 Thr-435_QAGEGtLSEAL , In vivo 15073167 , Europe PMC CCAR2 Q8N163 Thr-454_EAAPPtQEAQG , in vitro 26194823 , Europe PMC MAP4K1 Q92918 NA In vivo 15364934 , Europe PMC
Pathway ID Pathway Name Pathway Description (KEGG) hsa04922 Glucagon signaling pathway Glucagon is conventionally regarded as a counterregulatory hormone for insulin and plays a critical anti-hypoglycemic role by maintaining glucose homeostasis in both animals and humans. To increase blood glucose, glucagon promotes hepatic glucose output by increasing glycogenolysis and gluconeogenesis and by decreasing glycogenesis and glycolysis in a concerted fashion via multiple mechanisms. Glucagon also stimulates hepatic mitochondrial beta-oxidation to supply energy for glucose production. Glucagon performs its main effect via activation of adenylate cyclase. The adenylate-cyclase-derived cAMP activates protein kinase A (PKA), which then phosphorylates downstream targets, such as cAMP response element binding protein (CREB) and the bifunctional enzyme 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase (one of the isoforms being PFK/FBPase 1, encoded by PFKFB1).
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-5693607 Processing of DNA double-strand break ends. Homology directed repair (HDR) through homologous recombination (HRR) or single strand annealing (SSA) requires extensive resection of DNA double strand break (DSB) ends (Thompson and Limoli 2003, Ciccia and Elledge 2010). The resection is performed in a two-step process, where the MRN complex (MRE11A:RAD50:NBN) and RBBP8 (CtIP) bound to BRCA1 initiate the resection. This step is regulated by the complex of CDK2 and CCNA (cyclin A), ensuring the initiation of HRR during S and G2 phases of the cell cycle, when sister chromatids are available. The initial resection is also regulated by ATM-mediated phosphorylation of RBBP8 and CHEK2-mediated phosphorylation of BRCA1 (Chen et al. 2008, Yun and Hiom 2009, Buis et al. 2012, Wang et al. 2013, Davies et al. 2015, Parameswaran et al. 2015). After the initial resection, DNA nucleases EXO1 and/or DNA2 perform long-range resection, which is facilitated by DNA helicases BLM or WRN, as well as BRIP1 (BACH1) (Chen et al. 2008, Nimonkar et al. 2011, Sturzenegger et al. 2014, Suhasini et al. 2011). The resulting long 3'-ssDNA overhangs are coated by the RPA heterotrimers (RPA1:RPA2:RPA3), which recruit ATR:ATRIP complexes to DNA DSBs and, in collaboration with RAD17:RFC and RAD9:HUS1:RAD1 complexes, and TOPBP1 and RHNO1, activate ATR signaling. Activated ATR phosphorylates RPA2 and activates CHEK1 (Cotta-Ramusino et al. 2011), both of which are necessary prerequisites for the subsequent steps in HRR and SSA
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ATAD3B Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID BAG6 Affinity Capture-MS, Co-fractionation physical 17353931 , 22863883 , (Europe PMC )NA BioGRID BCAS2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CAND1 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CCDC6 Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 17353931 , 18715871 , 19156129 , 27880917 , 28514442 , (Europe PMC )0.67 BioGRID, IntAct CCT2 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT3 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT5 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT6A Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT6P1 Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID CCT7 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT8 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CDC5L Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CLASP2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID DHX38 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18715871 , 27880917 , (Europe PMC )0.35 BioGRID, IntAct DYNLT1 Proximity Label-MS physical 26638075 , (Europe PMC )NA BioGRID EEF1A1 Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID GEMIN4 Affinity Capture-Western physical 12668731 , (Europe PMC )NA BioGRID GLYATL3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 19156129 , (Europe PMC )0.35 BioGRID, IntAct HDAC3 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down physical, physical association 15805470 , (Europe PMC )0.52 BioGRID, IntAct, MINT HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID IGBP1 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 16085932 , 16769727 , 18614045 , 18715871 , 19156129 , 26496610 , 27880917 , 9647778 , , (Europe PMC )0.93 BioGRID, IntAct IKBKG Affinity Capture-Western, Co-localization physical 24109239 , (Europe PMC )NA BioGRID JUN Reconstituted Complex physical 9837938 , (Europe PMC )NA BioGRID LCMT1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MAP4K1 Affinity Capture-Western, Biochemical Activity physical 15364934 , 24362026 , (Europe PMC )NA BioGRID NFKB1 Affinity Capture-Western physical 9837938 , (Europe PMC )NA BioGRID PLOD3 Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID PPME1 Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID PPP2CA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP2CB Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 17353931 , 26496610 , 27880917 , (Europe PMC )0.56 BioGRID, IntAct PPP2R1A Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical, physical association 17353931 , 18715871 , 19156129 , 27880917 , 28330616 , (Europe PMC )0.80 BioGRID, IntAct PPP2R2A Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PPP2R2B Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical 19156129 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct PPP2R2D Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical 19156129 , 28330616 , 28514442 , (Europe PMC )0.60 BioGRID, IntAct PPP2R5D Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18715871 , 19156129 , 27880917 , (Europe PMC )0.35 BioGRID, IntAct PPP4R1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 16085932 , 17353931 , 18614045 , 18715871 , 19156129 , 26496610 , 27880917 , (Europe PMC )0.35, 0.86 BioGRID, IntAct PPP4R2 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 10769191 , 12668731 , 16085932 , 17353931 , 18614045 , 18715871 , 19156129 , 20876121 , 26344197 , 26496610 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.93 BioGRID, IntAct PPP4R3A Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 16085932 , 17353931 , 18715871 , 19156129 , 20876121 , 21423269 , 26496610 , 27880917 , 28514442 , (Europe PMC )NA BioGRID PPP4R3B Affinity Capture-MS, Affinity Capture-Western, Co-fractionation physical 16085932 , 17353931 , 18715871 , 19156129 , 20876121 , 26344197 , 27880917 , (Europe PMC )NA BioGRID PPP4R4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical, physical association 18715871 , 19156129 , 27880917 , 28514442 , (Europe PMC )0.35, 0.50 BioGRID, IntAct PRPF19 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PTPA Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID REL Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 9837938 , (Europe PMC )NA BioGRID RELA Reconstituted Complex physical 9837938 , (Europe PMC )NA BioGRID RNGTT Affinity Capture-MS physical 27432908 , 27880917 , (Europe PMC )NA BioGRID SLC25A31 Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID SMN1 Affinity Capture-Western physical 12668731 , (Europe PMC )NA BioGRID SRRM2 Affinity Capture-MS physical 16159877 , (Europe PMC )NA BioGRID SUPT5H Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID TCP1 Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , 22863883 , (Europe PMC )0.64 BioGRID, IntAct TIPRL Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, direct interaction, physical, physical association 16085932 , 17353931 , 17384681 , 18614045 , 27880917 , (Europe PMC )0.80 BioGRID, IntAct, MINT TK1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TLR4 Affinity Capture-Western physical 18634786 , (Europe PMC )NA BioGRID TP53 Reconstituted Complex physical 9837938 , (Europe PMC )NA BioGRID TRAF6 Affinity Capture-Western, Two-hybrid physical 18634786 , (Europe PMC )NA BioGRID TRIM28 Affinity Capture-Western, Biochemical Activity physical 22491012 , (Europe PMC )NA BioGRID TRMT1L Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID TUBA3C Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID UBXN10 Affinity Capture-MS physical 26389662 , (Europe PMC )NA BioGRID WDR81 Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID XPO1 Affinity Capture-MS physical 26673895 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CALML5 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CCDC6 Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 17353931 , 18715871 , 19156129 , 27880917 , 28514442 , (Europe PMC )0.67 BioGRID, IntAct CCT2 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT3 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT5 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT6A Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT7 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT8 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CDC45 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DHX38 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18715871 , 27880917 , (Europe PMC )0.35 BioGRID, IntAct DSP anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DYNC1H1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058599 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct GLYATL3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 19156129 , (Europe PMC )0.35 BioGRID, IntAct HDAC3 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down physical, physical association 15805470 , (Europe PMC )0.52 BioGRID, IntAct, MINT IGBP1 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 16085932 , 16769727 , 18614045 , 18715871 , 19156129 , 26496610 , 27880917 , 9647778 , , (Europe PMC )0.93 BioGRID, IntAct IKBKE anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct KSR1 anti tag coimmunoprecipitation association 27086506 , (Europe PMC )0.35 IntAct MYO1D anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PPM1D anti bait coimmunoprecipitation physical association 18614045 , (Europe PMC )0.40 IntAct PPP2CA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP2CB Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 17353931 , 26496610 , 27880917 , (Europe PMC )0.56 BioGRID, IntAct PPP2R1A Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical, physical association 17353931 , 18715871 , 19156129 , 27880917 , 28330616 , (Europe PMC )0.80 BioGRID, IntAct PPP2R2B Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical 19156129 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct PPP2R2D Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical 19156129 , 28330616 , 28514442 , (Europe PMC )0.60 BioGRID, IntAct PPP2R5D Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18715871 , 19156129 , 27880917 , (Europe PMC )0.35 BioGRID, IntAct PPP4R1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 16085932 , 17353931 , 18614045 , 18715871 , 19156129 , 26496610 , 27880917 , (Europe PMC )0.35, 0.86 BioGRID, IntAct PPP4R2 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 10769191 , 12668731 , 16085932 , 17353931 , 18614045 , 18715871 , 19156129 , 20876121 , 26344197 , 26496610 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.93 BioGRID, IntAct PPP4R3A anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical association 16085932 , 17353931 , 18614045 , 18715871 , 19156129 , 26496610 , (Europe PMC )0.35, 0.82 IntAct PPP4R3B anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical association 16085932 , 17353931 , 18614045 , 18715871 , 19156129 , (Europe PMC )0.35, 0.74 IntAct PPP4R4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical, physical association 18715871 , 19156129 , 27880917 , 28514442 , (Europe PMC )0.35, 0.50 BioGRID, IntAct PPP6C anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct RPAP1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TCP1 Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , 22863883 , (Europe PMC )0.64 BioGRID, IntAct TCTE1 proximity-dependent biotin identification association 26638075 , (Europe PMC )0.35 IntAct TIPRL Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, direct interaction, physical, physical association 16085932 , 17353931 , 17384681 , 18614045 , 27880917 , (Europe PMC )0.80 BioGRID, IntAct, MINT TK1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TTC34 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source TIPRL Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, direct interaction, physical, physical association 16085932 , 17353931 , 17384681 , 18614045 , 27880917 , (Europe PMC )0.80 BioGRID, IntAct, MINT TK1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ATAD3B Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID BAG6 Affinity Capture-MS, Co-fractionation physical 17353931 , 22863883 , (Europe PMC )NA BioGRID BAG6 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct BCAS2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CALML5 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CAND1 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CCDC6 Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 17353931 , 18715871 , 19156129 , 27880917 , 28514442 , (Europe PMC )0.67 BioGRID, IntAct CCT2 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT3 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT5 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT6A Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT6P1 Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID CCT7 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CCT8 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , (Europe PMC )0.64 BioGRID, IntAct CDC45 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CDC5L Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CLASP2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID DHX38 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18715871 , 27880917 , (Europe PMC )0.35 BioGRID, IntAct DSP anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DYNC1H1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DYNLT1 Proximity Label-MS physical 26638075 , (Europe PMC )NA BioGRID EBI-1058599 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EEF1A1 Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID GEMIN4 Affinity Capture-Western physical 12668731 , (Europe PMC )NA BioGRID GLYATL3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 19156129 , (Europe PMC )0.35 BioGRID, IntAct HDAC3 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down physical, physical association 15805470 , (Europe PMC )0.52 BioGRID, IntAct, MINT HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID IGBP1 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 16085932 , 16769727 , 18614045 , 18715871 , 19156129 , 26496610 , 27880917 , 9647778 , , (Europe PMC )0.93 BioGRID, IntAct IKBKE anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct IKBKG Affinity Capture-Western, Co-localization physical 24109239 , (Europe PMC )NA BioGRID JUN Reconstituted Complex physical 9837938 , (Europe PMC )NA BioGRID KSR1 anti tag coimmunoprecipitation association 27086506 , (Europe PMC )0.35 IntAct LCMT1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MAP4K1 Affinity Capture-Western, Biochemical Activity physical 15364934 , 24362026 , (Europe PMC )NA BioGRID MYO1D anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct NFKB1 Affinity Capture-Western physical 9837938 , (Europe PMC )NA BioGRID PLOD3 Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID PPM1D anti bait coimmunoprecipitation physical association 18614045 , (Europe PMC )0.40 IntAct PPME1 Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID PPP2CA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP2CB Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 17353931 , 26496610 , 27880917 , (Europe PMC )0.56 BioGRID, IntAct PPP2R1A Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical, physical association 17353931 , 18715871 , 19156129 , 27880917 , 28330616 , (Europe PMC )0.80 BioGRID, IntAct PPP2R2A Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PPP2R2B Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical 19156129 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct PPP2R2D Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical 19156129 , 28330616 , 28514442 , (Europe PMC )0.60 BioGRID, IntAct PPP2R5D Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18715871 , 19156129 , 27880917 , (Europe PMC )0.35 BioGRID, IntAct PPP4R1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 16085932 , 17353931 , 18614045 , 18715871 , 19156129 , 26496610 , 27880917 , (Europe PMC )0.35, 0.86 BioGRID, IntAct PPP4R2 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 10769191 , 12668731 , 16085932 , 17353931 , 18614045 , 18715871 , 19156129 , 20876121 , 26344197 , 26496610 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.93 BioGRID, IntAct PPP4R3A Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 16085932 , 17353931 , 18715871 , 19156129 , 20876121 , 21423269 , 26496610 , 27880917 , 28514442 , (Europe PMC )NA BioGRID PPP4R3A anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical association 16085932 , 17353931 , 18614045 , 18715871 , 19156129 , 26496610 , (Europe PMC )0.35, 0.82 IntAct PPP4R3B Affinity Capture-MS, Affinity Capture-Western, Co-fractionation physical 16085932 , 17353931 , 18715871 , 19156129 , 20876121 , 26344197 , 27880917 , (Europe PMC )NA BioGRID PPP4R3B anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical association 16085932 , 17353931 , 18614045 , 18715871 , 19156129 , (Europe PMC )0.35, 0.74 IntAct PPP4R4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical, physical association 18715871 , 19156129 , 27880917 , 28514442 , (Europe PMC )0.35, 0.50 BioGRID, IntAct PPP6C anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PRPF19 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PTPA Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID REL Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 9837938 , (Europe PMC )NA BioGRID RELA Reconstituted Complex physical 9837938 , (Europe PMC )NA BioGRID RNGTT Affinity Capture-MS physical 27432908 , 27880917 , (Europe PMC )NA BioGRID RPAP1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SLC25A31 Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID SMN1 Affinity Capture-Western physical 12668731 , (Europe PMC )NA BioGRID SRRM2 Affinity Capture-MS physical 16159877 , (Europe PMC )NA BioGRID SUPT5H Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID TCP1 Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 16085932 , 18715871 , 19156129 , 22863883 , (Europe PMC )0.64 BioGRID, IntAct TCTE1 proximity-dependent biotin identification association 26638075 , (Europe PMC )0.35 IntAct TIPRL Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, direct interaction, physical, physical association 16085932 , 17353931 , 17384681 , 18614045 , 27880917 , (Europe PMC )0.80 BioGRID, IntAct, MINT TK1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TLR4 Affinity Capture-Western physical 18634786 , (Europe PMC )NA BioGRID TP53 Reconstituted Complex physical 9837938 , (Europe PMC )NA BioGRID TRAF6 Affinity Capture-Western, Two-hybrid physical 18634786 , (Europe PMC )NA BioGRID TRIM28 Affinity Capture-Western, Biochemical Activity physical 22491012 , (Europe PMC )NA BioGRID TRMT1L Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID TTC34 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TUBA3C Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID UBXN10 Affinity Capture-MS physical 26389662 , (Europe PMC )NA BioGRID WDR81 Affinity Capture-MS physical 19156129 , (Europe PMC )NA BioGRID XPO1 Affinity Capture-MS physical 26673895 , (Europe PMC )NA BioGRID