Top
NDEL1
Localization (UniProt annotation) Cytoplasm, cytoskeleton Cytoplasm,cytoskeleton, microtubule organizing center, centrosomeChromosome, centromere, kinetochore Cytoplasm, cytoskeleton,spindle Note=Localizes to the cell body of the motor neurons andcolocalizes with assembled neurofilaments within axonal processesLocalizes to the microtubules of the manchette in elongatedspermatids Colocalizes with DISC1 in the perinuclear region,including the centrosome (By similarity) Localizes to theinterphase centrosome and the mitotic spindle Localizes to thekinetochore in a CENPF-dependent manner Function (UniProt annotation) Required for organization of the cellular microtubulearray and microtubule anchoring at the centrosome May regulatemicrotubule organization at least in part by targeting themicrotubule severing protein KATNA1 to the centrosome Alsopositively regulates the activity of the minus-end directedmicrotubule motor protein dynein May enhance dynein-mediatedmicrotubule sliding by targeting dynein to the microtubule plusends Required for several dynein- and microtubule-dependentprocesses such as the maintenance of Golgi integrity, thecentripetal motion of secretory vesicles and the coupling of thenucleus and centrosome Also required during brain development forthe migration of newly formed neurons from theventricular/subventricular zone toward the cortical plate Plays arole, together with DISC1, in the regulation of neurite outgrowthRequired for mitosis in some cell types but appears to bedispensible for mitosis in cortical neuronal progenitors, whichinstead requires NDE1 Facilitates the polymerization ofneurofilaments from the individual subunits NEFH and NEFLPositively regulates lysosome peripheral distribution and ruffledborder formation in osteoclasts (By similarity) Catalytic Activity (UniProt annotation) N/A Protein Sequence MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALK
EKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEK
ESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAVQASLSLPATPVGKGTENTFPSPKAIPNGFG
TSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQASRKSYISGNVNCGVLNGNGTKFSRSGHTSFFDKGAVNGF
DPAPPPPGLGSSRPSSAPGMLPLSV
ELM Motif Motif Instance
Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal. The signal from unattached kinetochores is amplified through a Mad2 inhibitory signal that is propagated by the binding of Mad1 to the kinetochore, the association of Mad2 with Mad1, the conversion of Mad2 conformation to an inhibitory form through its association with Mad1 and finally the release of the inhibitory form of Mad2 from the kinetochore R-HSA-2467813 Separation of Sister Chromatids. While sister chromatids resolve in prometaphase, separating along chromosomal arms, the cohesion of sister centromeres persists until anaphase. At the anaphase onset, the anaphase promoting complex/cyclosome (APC/C) ubiquitinates PTTG1 (securin), targeting it for degradation (Hagting et al. 2002). PTTG1 acts as an inhibitor of ESPL1 (known as separin i.e. separase). Hence, PTTG1 removal initiated by APC/C, enables ESPL1 to become catalytically active (Zou et al. 1999, Waizenegger et al. 2002). ESPL1 undergoes autoleavage (Waizenegger et al. 2002) and also cleaves RAD21 subunit of centromeric cohesin (Hauf et al. 2001). RAD21 cleavage promotes dissociation of cohesin complexes from sister centromeres, leading to separation of sister chromatids. Subsequent movement of sister chromatids to opposite poles of the mitotic spindle segregates replicated chromosomes to two daughter cells (Waizenegger et al. 2000, Hauf et al. 2001, Waizenegger et al. 2002) R-HSA-2500257 Resolution of Sister Chromatid Cohesion. The resolution of sister chromatids in mitotic prometaphase involves removal of cohesin complexes from chromosomal arms, with preservation of cohesion at centromeres (Losada et al. 1998, Hauf et al. 2001, Hauf et al. 2005). CDK1-mediated phosphorylation of cohesin-bound CDCA5 (Sororin) at threonine T159 provides a docking site for PLK1, enabling PLK1-mediated phosphorylation of cohesin subunits STAG2 (SA2) and RAD21 (Hauf et al. 2005, Dreier et al. 2011, Zhang et al. 2011). Further phosphorylation of CDCA5 by CDK1 results in dissociation of CDCA5 from cohesin complex, which restores the activity of WAPAL in removing STAG2-phosphorylated cohesin from chromosomal arms (Hauf et al. 2005, Gandhi et al. 2006, Kueng et al. 2006, Shintomi and Hirano 2006, Nishiyama et al. 2010, Zhang et al. 2011). At centromeres, kinetochore proteins shugoshins (SGOL1 and SGOL2) enable PP2A-B56 (also a kinetochore constituent) to dephosphorylate the STAG2 subunit of centromeric cohesin. Dephosphorylation of STAG2 enables maintenance of centromeric cohesion, thus preventing separation of sister chromatids until anaphase (Salic et al. 2004, Kitajima et al. 2004, Kitajima et al. 2005, Kitajima et al. 2006) R-HSA-5663220 RHO GTPases Activate Formins. Formins are a family of proteins with 15 members in mammals, organized into 8 subfamilies. Formins are involved in the regulation of actin cytoskeleton. Many but not all formin family members are activated by RHO GTPases. Formins that serve as effectors of RHO GTPases belong to different formin subfamilies but they all share a structural similarity to Drosophila protein diaphanous and are hence named diaphanous-related formins (DRFs).DRFs activated by RHO GTPases contain a GTPase binding domain (GBD) at their N-terminus, followed by formin homology domains 3, 1, and 2 (FH3, FH1, FH2) and a diaphanous autoregulatory domain (DAD) at the C-terminus. Most DRFs contain a dimerization domain (DD) and a coiled-coil region (CC) in between FH3 and FH1 domains (reviewed by Kuhn and Geyer 2014). RHO GTPase-activated DRFs are autoinhibited through the interaction between FH3 and DAD which is disrupted upon binding to an active RHO GTPase (Li and Higgs 2003, Lammers et al. 2005, Nezami et al. 2006). Since formins dimerize, it is not clear whether the FH3-DAD interaction is intra- or intermolecular. FH2 domain is responsible for binding to the F-actin and contributes to the formation of head-to-tail formin dimers (Xu et al. 2004). The proline-rich FH1 domain interacts with the actin-binding proteins profilins, thereby facilitating actin recruitment to formins and accelerating actin polymerization (Romero et al. 2004, Kovar et al. 2006).
Different formins are activated by different RHO GTPases in different cell contexts. FMNL1 (formin-like protein 1) is activated by binding to the RAC1:GTP and is involved in the formation of lamellipodia in macrophages (Yayoshi-Yamamoto et al. 2000) and is involved in the regulation of the Golgi complex structure (Colon-Franco et al. 2011). Activation of FMNL1 by CDC42:GTP contributes to the formation of the phagocytic cup (Seth et al. 2006). Activation of FMNL2 (formin-like protein 2) and FMNL3 (formin-like protein 3) by RHOC:GTP is involved in cancer cell motility and invasiveness (Kitzing et al. 2010, Vega et al. 2011). DIAPH1, activated by RHOA:GTP, promotes elongation of actin filaments and activation of SRF-mediated transcription which is inhibited by unpolymerized actin (Miralles et al. 2003). RHOF-mediated activation of DIAPH1 is implicated in formation of stress fibers (Fan et al. 2010). Activation of DIAPH1 and DIAPH3 by RHOB:GTP leads to actin coat formation around endosomes and regulates endosome motility and trafficking (Fernandez-Borja et al. 2005, Wallar et al. 2007). Endosome trafficking is also regulated by DIAPH2 transcription isoform 3 (DIAPH2-3) which, upon activation by RHOD:GTP, recruits SRC kinase to endosomes (Tominaga et al. 2000, Gasman et al. 2003). DIAPH2 transcription isoform 2 (DIAPH2-2) is involved in mitosis where, upon being activated by CDC42:GTP, it facilitates the capture of astral microtubules by kinetochores (Yasuda et al. 2004, Cheng et al. 2011). DIAPH2 is implicated in ovarian maintenance and premature ovarian failure (Bione et al. 1998). DAAM1, activated by RHOA:GTP, is involved in linking WNT signaling to cytoskeleton reorganization (Habas et al. 2001)
R-HSA-68877 Mitotic Prometaphase. The dissolution of the nuclear membrane marks the beginning of the prometaphase. Kinetochores are created when proteins attach to the centromeres. Microtubules then attach at the kinetochores, and the chromosomes begin to move to the metaphase plate
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ANK2 Two-hybrid physical 17043677 , (Europe PMC )NA BioGRID ANKRD26 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID APP Reconstituted Complex physical 21832049 , (Europe PMC )NA BioGRID BCAS2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BMI1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct BORCS6 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CCDC18 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CCDC183 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CCDC88A Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct CCHCR1 Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 28514442 , (Europe PMC )0.56 BioGRID, IntAct CCSER1 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 17043677 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct CCSER2 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 17043677 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct CDK5 Biochemical Activity, Co-localization physical 11163260 , (Europe PMC )NA BioGRID CENPF Affinity Capture-Western, Two-hybrid, fluorescence technology, pull down, two hybrid colocalization, physical, physical association 17043677 , 17600710 , (Europe PMC )0.67 BioGRID, IntAct CEP128 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CEP135 Affinity Capture-MS, Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct CEP152 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CEP170 Two-hybrid physical 17043677 , (Europe PMC )NA BioGRID CEP63 Two-hybrid physical 17043677 , (Europe PMC )NA BioGRID CLPX Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CTR9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CWF19L2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct DCTN2 Affinity Capture-Western physical 14970193 , (Europe PMC )NA BioGRID DISC1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, far western blotting, fluorescence microscopy, two hybrid, two hybrid array, two hybrid prey pooling approach colocalization, direct interaction, physical, physical association 12506198 , 12812986 , 14962739 , 17043677 , 20880836 , 28514442 , (Europe PMC )0.44, 0.49, 0.66 BioGRID, IntAct DIXDC1 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 17043677 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct DTNB Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct DYNC1H1 Affinity Capture-Western, Co-fractionation physical 11163260 , 14970193 , 18784752 , (Europe PMC )NA BioGRID DYNC1I1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 14970193 , 19927128 , 22159412 , (Europe PMC )0.35 BioGRID, IntAct, MINT DYNLT1 Proximity Label-MS physical 26638075 , (Europe PMC )NA BioGRID EVI5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FBXW5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GOLGA2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct GRIPAP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IMMT Far Western, Reconstituted Complex, Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 20880836 , (Europe PMC )0.60 BioGRID, IntAct KALRN Two-hybrid physical 17043677 , (Europe PMC )NA BioGRID KATNA1 Affinity Capture-Western, Reconstituted Complex physical 16203747 , (Europe PMC )NA BioGRID KATNB1 Affinity Capture-Western, Reconstituted Complex physical 16203747 , (Europe PMC )NA BioGRID KIF20B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID KIFC3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct KRT40 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct KTN1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LMNB1 Affinity Capture-Western physical 19198602 , (Europe PMC )NA BioGRID LNX1 Affinity Capture-MS physical 29121065 , (Europe PMC )NA BioGRID LUC7L2 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct MAGEA11 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct MBIP Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 25416956 , (Europe PMC )0.37, 0.56 BioGRID, IntAct MIS18A Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 17043677 , (Europe PMC )0.62 BioGRID, IntAct MLLT10 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct MRC2 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct MTCL1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MTUS2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct NAP1L5 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID NDC80 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct NDE1 Affinity Capture-MS, Two-hybrid physical 24722188 , 28514442 , (Europe PMC )NA BioGRID NDEL1 Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, x-ray crystallography direct interaction, physical, physical association 10931877 , 17997972 , 25416956 , (Europe PMC )0.79 BioGRID, IntAct NINL Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct NUP54 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID OFD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PAFAH1B1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid physical 11163260 , 12796778 , 12885786 , 14970193 , 19622634 , 27173435 , 28514442 , (Europe PMC )NA BioGRID PAFAH1B2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PKP2 Two-hybrid, two hybrid array, two hybrid bait and prey pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 25910212 , (Europe PMC )0.56 BioGRID, IntAct PRPF19 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PTPN14 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RPS6KA3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SCARA3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID SHTN1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SLC25A43 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SNAP29 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SNAPC5 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.49, 0.56 BioGRID, IntAct SNTA1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SNTB1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SNTB2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SNX6 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct SSX2IP Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct SYNE1 Two-hybrid physical 17043677 , (Europe PMC )NA BioGRID TACC3 Affinity Capture-Western, Reconstituted Complex, two hybrid array, two hybrid prey pooling approach physical, physical association 17060449 , (Europe PMC )0.49 BioGRID, IntAct TRAF3IP3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct TRIM27 Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 28514442 , (Europe PMC )0.72 BioGRID, IntAct TRIM7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRIOBP Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TUBA1A Affinity Capture-Western physical 14970193 , (Europe PMC )NA BioGRID TUBG1 Affinity Capture-Western physical 14970193 , (Europe PMC )NA BioGRID USP2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct UTRN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID XPA Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct YWHAE Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12796778 , (Europe PMC )NA BioGRID YWHAG Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct ZNF10 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF17 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF180 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF197 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF211 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF230 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF260 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF264 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID ZNF417 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF445 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF490 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct ZNF544 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF572 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF599 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct ZNF844 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct ZNF91 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source BMI1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct BUB1 fluorescence technology colocalization 17600710 , (Europe PMC )0.35 IntAct CCDC88A Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct CCHCR1 Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 28514442 , (Europe PMC )0.56 BioGRID, IntAct CCSER1 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 17043677 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct CCSER2 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 17043677 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct CDC42 anti tag coimmunoprecipitation association 19492042 , (Europe PMC )0.35 IntAct CDK1 in-gel kinase assay phosphorylation reaction 16682949 , (Europe PMC )0.44 IntAct CENPF Affinity Capture-Western, Two-hybrid, fluorescence technology, pull down, two hybrid colocalization, physical, physical association 17043677 , 17600710 , (Europe PMC )0.67 BioGRID, IntAct CEP128 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CEP135 Affinity Capture-MS, Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct CEP152 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CTR9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CWF19L2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct DISC1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, far western blotting, fluorescence microscopy, two hybrid, two hybrid array, two hybrid prey pooling approach colocalization, direct interaction, physical, physical association 12506198 , 12812986 , 14962739 , 17043677 , 20880836 , 28514442 , (Europe PMC )0.44, 0.49, 0.66 BioGRID, IntAct DIXDC1 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 17043677 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct DTNB Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct DYNC1I1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 14970193 , 19927128 , 22159412 , (Europe PMC )0.35 BioGRID, IntAct, MINT GOLGA2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct IMMT Far Western, Reconstituted Complex, Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 20880836 , (Europe PMC )0.60 BioGRID, IntAct KALRN two hybrid physical association 17043677 , (Europe PMC )0.37 IntAct KIFC3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct KRT40 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct LUC7L2 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct MAGEA11 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct MBIP Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 25416956 , (Europe PMC )0.37, 0.56 BioGRID, IntAct MIS18A Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 17043677 , (Europe PMC )0.62 BioGRID, IntAct MLLT10 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct MRC2 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct MTUS2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct NDC80 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct NDEL1 Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, x-ray crystallography direct interaction, physical, physical association 10931877 , 17997972 , 25416956 , (Europe PMC )0.79 BioGRID, IntAct NINL Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct PAFAH1B1 inference by socio-affinity scoring, tandem affinity purification, two hybrid association, physical association 10931877 , 27173435 , (Europe PMC )0.64 IntAct PAFAH1B2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PKP2 Two-hybrid, two hybrid array, two hybrid bait and prey pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 25910212 , (Europe PMC )0.56 BioGRID, IntAct PXN anti tag coimmunoprecipitation, pull down association, physical association 19492042 , (Europe PMC )0.35, 0.58 IntAct SNAPC5 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.49, 0.56 BioGRID, IntAct SNX6 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct SSX2IP Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct TACC3 Affinity Capture-Western, Reconstituted Complex, two hybrid array, two hybrid prey pooling approach physical, physical association 17060449 , (Europe PMC )0.49 BioGRID, IntAct TCTE1 proximity-dependent biotin identification association 26638075 , (Europe PMC )0.35 IntAct TRAF3IP3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct TRIM27 Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 28514442 , (Europe PMC )0.72 BioGRID, IntAct USP2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct VCL anti tag coimmunoprecipitation association 19492042 , (Europe PMC )0.35 IntAct XPA Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct YWHAG Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct ZNF10 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF17 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF180 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF197 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF211 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF230 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF260 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF365 anti tag coimmunoprecipitation physical association 16682949 , (Europe PMC )0.40 IntAct ZNF417 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF490 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct ZNF544 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF572 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF599 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct ZNF844 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct ZNF91 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ANK2 Two-hybrid physical 17043677 , (Europe PMC )NA BioGRID ANKRD26 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID APP Reconstituted Complex physical 21832049 , (Europe PMC )NA BioGRID BCAS2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BMI1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct BORCS6 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID BUB1 fluorescence technology colocalization 17600710 , (Europe PMC )0.35 IntAct CCDC18 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CCDC183 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CCDC88A Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct CCHCR1 Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 28514442 , (Europe PMC )0.56 BioGRID, IntAct CCSER1 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 17043677 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct CCSER2 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 17043677 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct CDC42 anti tag coimmunoprecipitation association 19492042 , (Europe PMC )0.35 IntAct CDK1 in-gel kinase assay phosphorylation reaction 16682949 , (Europe PMC )0.44 IntAct CDK5 Biochemical Activity, Co-localization physical 11163260 , (Europe PMC )NA BioGRID CENPF Affinity Capture-Western, Two-hybrid, fluorescence technology, pull down, two hybrid colocalization, physical, physical association 17043677 , 17600710 , (Europe PMC )0.67 BioGRID, IntAct CEP128 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CEP135 Affinity Capture-MS, Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct CEP152 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CEP170 Two-hybrid physical 17043677 , (Europe PMC )NA BioGRID CEP63 Two-hybrid physical 17043677 , (Europe PMC )NA BioGRID CLPX Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CTR9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CWF19L2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct DCTN2 Affinity Capture-Western physical 14970193 , (Europe PMC )NA BioGRID DISC1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, far western blotting, fluorescence microscopy, two hybrid, two hybrid array, two hybrid prey pooling approach colocalization, direct interaction, physical, physical association 12506198 , 12812986 , 14962739 , 17043677 , 20880836 , 28514442 , (Europe PMC )0.44, 0.49, 0.66 BioGRID, IntAct DIXDC1 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 17043677 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct DTNB Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct DYNC1H1 Affinity Capture-Western, Co-fractionation physical 11163260 , 14970193 , 18784752 , (Europe PMC )NA BioGRID DYNC1I1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 14970193 , 19927128 , 22159412 , (Europe PMC )0.35 BioGRID, IntAct, MINT DYNLT1 Proximity Label-MS physical 26638075 , (Europe PMC )NA BioGRID EVI5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FBXW5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GOLGA2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct GRIPAP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IMMT Far Western, Reconstituted Complex, Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 20880836 , (Europe PMC )0.60 BioGRID, IntAct KALRN Two-hybrid physical 17043677 , (Europe PMC )NA BioGRID KALRN two hybrid physical association 17043677 , (Europe PMC )0.37 IntAct KATNA1 Affinity Capture-Western, Reconstituted Complex physical 16203747 , (Europe PMC )NA BioGRID KATNB1 Affinity Capture-Western, Reconstituted Complex physical 16203747 , (Europe PMC )NA BioGRID KIF20B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID KIFC3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct KRT40 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct KTN1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LMNB1 Affinity Capture-Western physical 19198602 , (Europe PMC )NA BioGRID LNX1 Affinity Capture-MS physical 29121065 , (Europe PMC )NA BioGRID LUC7L2 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct MAGEA11 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct MBIP Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 25416956 , (Europe PMC )0.37, 0.56 BioGRID, IntAct MIS18A Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 17043677 , (Europe PMC )0.62 BioGRID, IntAct MLLT10 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct MRC2 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct MTCL1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MTUS2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct NAP1L5 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID NDC80 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct NDE1 Affinity Capture-MS, Two-hybrid physical 24722188 , 28514442 , (Europe PMC )NA BioGRID NDEL1 Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, x-ray crystallography direct interaction, physical, physical association 10931877 , 17997972 , 25416956 , (Europe PMC )0.79 BioGRID, IntAct NINL Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct NUP54 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID OFD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PAFAH1B1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid physical 11163260 , 12796778 , 12885786 , 14970193 , 19622634 , 27173435 , 28514442 , (Europe PMC )NA BioGRID PAFAH1B1 inference by socio-affinity scoring, tandem affinity purification, two hybrid association, physical association 10931877 , 27173435 , (Europe PMC )0.64 IntAct PAFAH1B2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PKP2 Two-hybrid, two hybrid array, two hybrid bait and prey pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 25910212 , (Europe PMC )0.56 BioGRID, IntAct PRPF19 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PTPN14 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PXN anti tag coimmunoprecipitation, pull down association, physical association 19492042 , (Europe PMC )0.35, 0.58 IntAct RPS6KA3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SCARA3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID SHTN1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SLC25A43 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SNAP29 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SNAPC5 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.49, 0.56 BioGRID, IntAct SNTA1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SNTB1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SNTB2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SNX6 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct SSX2IP Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct SYNE1 Two-hybrid physical 17043677 , (Europe PMC )NA BioGRID TACC3 Affinity Capture-Western, Reconstituted Complex, two hybrid array, two hybrid prey pooling approach physical, physical association 17060449 , (Europe PMC )0.49 BioGRID, IntAct TCTE1 proximity-dependent biotin identification association 26638075 , (Europe PMC )0.35 IntAct TRAF3IP3 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct TRIM27 Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 28514442 , (Europe PMC )0.72 BioGRID, IntAct TRIM7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRIOBP Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TUBA1A Affinity Capture-Western physical 14970193 , (Europe PMC )NA BioGRID TUBG1 Affinity Capture-Western physical 14970193 , (Europe PMC )NA BioGRID USP2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct UTRN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID VCL anti tag coimmunoprecipitation association 19492042 , (Europe PMC )0.35 IntAct XPA Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct YWHAE Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12796778 , (Europe PMC )NA BioGRID YWHAG Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct ZNF10 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF17 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF180 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF197 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF211 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF230 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct ZNF260 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF264 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID ZNF365 anti tag coimmunoprecipitation physical association 16682949 , (Europe PMC )0.40 IntAct ZNF417 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF445 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF490 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct ZNF544 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF572 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ZNF599 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct ZNF844 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct ZNF91 Two-hybrid, two hybrid physical, physical association 17043677 , (Europe PMC )0.37 BioGRID, IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
CDK1 S242_IPNGFGTsPLTPSAR , T219_ASLSLPAtPVGKGTE , T245_GFGTSPLtPSARISA , NA NA PhosphoSitePlus , CDK5 S198_TRKSAPSsPTLDCEK , S231_GTENTFPsPKAIPNG , S242_IPNGFGTsPLTPSAR , T219_ASLSLPAtPVGKGTE , T245_GFGTSPLtPSARISA , in vitro, in vivo 12796778 , 18669648 , 19413330 , 20068231 ,(Europe PMC )HPRD, MAPK1 T219_ASLSLPAtPVGKGTE , T245_GFGTSPLtPSARISA , NA NA PhosphoSitePlus , Unknown S194_QQEVTRKsAPSSPTL , S197_VTRKSAPsSPTLDCE , S198_TRKSAPSsPTLDCEK , S208_LDCEKMDsAVQASLS , S215_SAVQASLsLPATPVG , S242_IPNGFGTsPLTPSAR , T219_ASLSLPAtPVGKGTE , T241_AIPNGFGtSPLTPSA , T245_GFGTSPLtPSARISA , HTP, in vivo 18669648 , 19413330 , 20068231 ,(Europe PMC )HPRD, PhosphoELM ,