Top CCAR2
Localization (UniProt annotation) Nucleus CytoplasmNote=Recruited to chromatin, post-UV irradiation Sequestered tothe cytoplasm in the presence of MCC Translocated to thecytoplasm during UV-induced apoptosis Function (UniProt annotation) Core component of the DBIRD complex, a multiproteincomplex that acts at the interface between core mRNP particles andRNA polymerase II (RNAPII) and integrates transcript elongationwith the regulation of alternative splicing: the DBIRD complexaffects local transcript elongation rates and alternative splicingof a large set of exons embedded in (A + T)-rich DNA regionsInhibits SIRT1 deacetylase activity leading to increasing levelsof p53/TP53 acetylation and p53-mediated apoptosis InhibitsSUV39H1 methyltransferase activity As part of a histone H3-specific methyltransferase complex may mediate ligand-dependenttranscriptional activation by nuclear hormone receptors Plays acritical role in maintaining genomic stability and cellularintegrity following UV-induced genotoxic stress Regulates thecircadian expression of the core clock components NR1D1 andARNTL/BMAL1 Enhances the transcriptional repressor activity ofNR1D1 through stabilization of NR1D1 protein levels by preventingits ubiquitination and subsequent degradation (PubMed:18235501,PubMed:18235502, PubMed:19131338, PubMed:19218236,PubMed:22446626, PubMed:23352644, PubMed:23398316) Represses theligand-dependent transcriptional activation function of ESR2(PubMed:20074560) Acts as a regulator of PCK1 expression andgluconeogenesis by a mechanism that involves, at least in part,both NR1D1 and SIRT1 (PubMed:24415752) Negatively regulates thedeacetylase activity of HDAC3 and can alter its subcellularlocalization (PubMed:21030595) Positively regulates the beta-catenin pathway (canonical Wnt signaling pathway) and is requiredfor MCC-mediated repression of the beta-catenin pathway(PubMed:24824780) Represses ligand-dependent transcriptionalactivation function of NR1H2 and NR1H3 and inhibits theinteraction of SIRT1 with NR1H3 (PubMed:25661920) Plays animportant role in tumor suppression through p53/TP53 regulation;stabilizes p53/TP53 by affecting its interaction with ubiquitinligase MDM2 (PubMed:25732823) Represses the transcriptionalactivator activity of BRCA1 (PubMed:20160719) Inhibits SIRT1 in aCHEK2 and PSEM3-dependent manner and inhibits the activity ofCHEK2 in vitro (PubMed:25361978) Catalytic Activity (UniProt annotation) N/A Protein Sequence MSQFKRQRINPLPGGRNFSGTASTSLLGPPPGLLTPPVATELSQNARHLQGGEKQRVFTGIVTSLHDYFGVVDEEVFFQL
SVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVKVQTLSNQPLLKSPAPPLLHVAALGQKQGILGAQPQLIFQPHRIPPLFP
QKPLSLFQTSHTLHLSHLNRFPARGPHGRLDQGRSDDYDSKKRKQRAGGEPWGAKKPRHDLPPYRVHLTPYTVDSPICDF
LELQRRYRSLLVPSDFLSVHLSWLSAFPLSQPFSLHHPSRIQVSSEKEAAPDAGAEPITADSDPAYSSKVLLLSSPGLEE
LYRCCMLFVDDMAEPRETPEHPLKQIKFLLGRKEEEAVLVGGEWSPSLDGLDPQADPQVLVRTAIRCAQAQTGIDLSGCT
KWWRFAEFQYLQPGPPRRLQTVVVYLPDVWTIMPTLEEWEALCQQKAAEAAPPTQEAQGETEPTEQAPDALEQAADTSRR
NAETPEATTQQETDTDLPEAPPPPLEPAVIARPGCVNLSLHGIVEDRRPKERISFEVMVLAELFLEMLQRDFGYRVYKML
LSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEAS
EDLCEMALDPELLLLRDDGEEEFAGAKLEDSEVRSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYL
HRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRSLQYSRQEGLDGGLPEEVLFGNLDLLPPPGKSTKPGAAPTEHK
ALVSHNGSLINVGSLLQRAEQQDSGRLYLENKIHTLELKLEESHNRFSATEVTNKTLAAEMQELRVRLAEAEETARTAER
QKSQLQRLLQELRRRLTPLQLEIQRVVEKADSWVEKEEPAPSN
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
CCAR2 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-3371453 Regulation of HSF1-mediated heat shock response. The ability of HSF1 to respond to cellular stresses is under negative regulation by chaperones, modulation of nucleocytoplasmic shuttling, post-translational modifications and transition from monomeric to trimeric state
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AIMP1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID AIMP2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ANKRA2 Affinity Capture-MS physical 25752541 , (Europe PMC )NA BioGRID ASH2L Affinity Capture-Western physical 19131338 , (Europe PMC )NA BioGRID B9D2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct BAG2 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT BRCA1 Affinity Capture-MS, Affinity Capture-Western physical 20160719 , 26831064 , (Europe PMC )NA BioGRID CCDC8 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CCNA1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct CDK7 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CDK9 Affinity Capture-MS, Co-fractionation physical 17643375 , 22863883 , (Europe PMC )NA BioGRID CEP170 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 28514442 , (Europe PMC )0.27, 0.35 BioGRID, IntAct CEP170P1 Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 20360068 , 25416956 , 26496610 , (Europe PMC )0.56 BioGRID, IntAct CFTR Affinity Capture-MS physical 26618866 , (Europe PMC )NA BioGRID CHEK2 Affinity Capture-Western physical 25361978 , (Europe PMC )NA BioGRID CIAO1 Affinity Capture-MS physical 17353931 , (Europe PMC )NA BioGRID CNOT1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID COPG1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID COPS5 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID DCTN3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID EEF1A1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID EEF1AKMT3 Affinity Capture-MS physical 23349634 , (Europe PMC )NA BioGRID EEF1E1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID EIF2S3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID EMSY Affinity Capture-Western physical 19131338 , (Europe PMC )NA BioGRID FN1 Affinity Capture-MS physical 19738201 , (Europe PMC )NA BioGRID FOXB1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXH1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXP3 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXQ1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT GBF1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID GSTK1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HAO1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HDAC5 Affinity Capture-MS physical 21081666 , (Europe PMC )NA BioGRID HDAC9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA1 Affinity Capture-MS, Co-fractionation physical 22863883 , 25324306 , (Europe PMC )NA BioGRID HSD17B10 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct HSPA1L Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 22365833 , 26186194 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT HSPD1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HTRA2 Biochemical Activity, Protein-peptide, protease assay physical, protein cleavage 17266347 , (Europe PMC )0.44 BioGRID, IntAct IQGAP1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID KAT8 Affinity Capture-MS physical 20479123 , (Europe PMC )NA BioGRID KBTBD7 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct KCNAB2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MAGEA6 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MAGED1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MCC Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MDM2 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID MEPCE Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID METTL23 Affinity Capture-MS physical 23349634 , (Europe PMC )NA BioGRID MEX3C Affinity Capture-MS physical 26471122 , (Europe PMC )NA BioGRID MTMR11 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID MYC Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, tandem affinity purification, two hybrid association, physical, physical association 17314511 , 17353931 , 22190494 , (Europe PMC )0.75 BioGRID, IntAct NANOG Affinity Capture-MS physical 26687479 , (Europe PMC )NA BioGRID NCAPD2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NCAPG Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NEK6 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct NELFCD Affinity Capture-MS physical 17353931 , (Europe PMC )NA BioGRID NLGN3 Two-hybrid, two hybrid physical, physical association 25464930 , (Europe PMC )0.37 BioGRID, IntAct NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID PDIA6 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PLEC Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PNMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 14676191 , (Europe PMC )0.35 BioGRID, IntAct POU5F1 Affinity Capture-MS physical 26687479 , (Europe PMC )NA BioGRID PPIL4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPP4R3A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PRMT5 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSMA4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PSMC1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PSMD3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PSME3 Affinity Capture-Western physical 25361978 , (Europe PMC )NA BioGRID QARS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID RAD21 Affinity Capture-MS, Affinity Capture-Western physical 22145905 , (Europe PMC )NA BioGRID RARS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID RBBP5 Affinity Capture-Western physical 19131338 , (Europe PMC )NA BioGRID RC3H1 Affinity Capture-MS physical 26170170 , (Europe PMC )NA BioGRID RPA1 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA2 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA3 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPL27A Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID RUVBL2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID SCARNA22 Affinity Capture-RNA physical 22751105 , (Europe PMC )NA BioGRID SEC16A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SF3A2 Affinity Capture-MS, affinity chromatography technology physical, physical association 17332742 , (Europe PMC )0.40 BioGRID, IntAct, MINT SF3B3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SIRT1 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, molecular sieving, pull down direct interaction, physical, physical interaction 18235501 , 18235502 , 22190494 , 22735644 , 25361978 , (Europe PMC )0.69 BioGRID, IntAct SIRT6 Affinity Capture-MS physical 24169447 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SMC2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SMC4 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SOX2 Affinity Capture-MS physical 21532573 , 23667531 , (Europe PMC )NA BioGRID TARDBP Affinity Capture-MS physical 20020773 , (Europe PMC )NA BioGRID TUBA1A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TUBB3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TUBB8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID WRAP73 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct XPO1 Affinity Capture-MS physical 26673895 , (Europe PMC )NA BioGRID ZBTB1 Affinity Capture-MS physical 24657165 , (Europe PMC )NA BioGRID ZNF335 Affinity Capture-Western, Two-hybrid physical 19131338 , (Europe PMC )NA BioGRID
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ANG anti bait coimmunoprecipitation association 28777577 , (Europe PMC )0.35 IntAct, MINT ANXA1 anti bait coimmunoprecipitation association 23754495 , (Europe PMC )0.35 IntAct B9D2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct BAG2 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT BCOR tandem affinity purification association 27505670 , (Europe PMC )0.35 IntAct C20orf24 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CBFA2T2 anti tag coimmunoprecipitation association 27281218 , (Europe PMC )0.35 IntAct CCNA1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct CEP170 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 28514442 , (Europe PMC )0.27, 0.35 BioGRID, IntAct CEP170P1 Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 20360068 , 25416956 , 26496610 , (Europe PMC )0.56 BioGRID, IntAct CIAO1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1059087 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EGFR tandem affinity purification association 24189400 , (Europe PMC )0.35 IntAct EIPR1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct FOXB1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXH1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXP3 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXQ1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT GSTK1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HDAC9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.35 BioGRID, IntAct HIF1AN anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HSD17B10 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct HSPA8 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 22365833 , 26186194 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT HTRA2 Biochemical Activity, Protein-peptide, protease assay physical, protein cleavage 17266347 , (Europe PMC )0.44 BioGRID, IntAct IFI16 anti tag coimmunoprecipitation association 25665578 , (Europe PMC )0.35 IntAct IKBKB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct IKBKE anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KATNAL2 tandem affinity purification association 26929214 , (Europe PMC )0.35 IntAct KBTBD7 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct MAGEA6 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MAGED1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MAP3K3 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MAX cosedimentation through density gradient physical association 17314511 , (Europe PMC )0.40 IntAct MCM7 cosedimentation through density gradient physical association 17314511 , (Europe PMC )0.40 IntAct MYC Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, tandem affinity purification, two hybrid association, physical, physical association 17314511 , 17353931 , 22190494 , (Europe PMC )0.75 BioGRID, IntAct NBEAL2 tandem affinity purification association 29187380 , (Europe PMC )0.35 IntAct NEK6 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct NFKB2 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NFKBIB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NLGN3 Two-hybrid, two hybrid physical, physical association 25464930 , (Europe PMC )0.37 BioGRID, IntAct PHLDA3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PNMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 14676191 , (Europe PMC )0.35 BioGRID, IntAct POLR2A cosedimentation through density gradient physical association 17314511 , (Europe PMC )0.40 IntAct PPEF1 pull down association 28330616 , (Europe PMC )0.35 IntAct PPP2R1A pull down association 28330616 , (Europe PMC )0.35 IntAct PPP2R2A proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PPP2R2B anti tag coimmunoprecipitation, pull down association 19156129 , (Europe PMC )0.46 IntAct PPP2R2D proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PRMT5 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT PTP4A3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PYHIN1 anti tag coimmunoprecipitation association 25665578 , (Europe PMC )0.35 IntAct RELA tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct RELB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct SEC16A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SF3A2 Affinity Capture-MS, affinity chromatography technology physical, physical association 17332742 , (Europe PMC )0.40 BioGRID, IntAct, MINT SIRT1 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, molecular sieving, pull down direct interaction, physical, physical interaction 18235501 , 18235502 , 22190494 , 22735644 , 25361978 , (Europe PMC )0.69 BioGRID, IntAct SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct TAB2 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TP53 anti tag coimmunoprecipitation physical interaction 18235501 , (Europe PMC )0.27 IntAct TRADD tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct VCAM1 cross-linking study association 22623428 , (Europe PMC )0.35 IntAct VHL anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct WRAP73 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct ZNF121 cosedimentation through density gradient physical association 17314511 , (Europe PMC )0.40 IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source BAG2 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT FOXB1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXH1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXP3 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXQ1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT HSPA8 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 22365833 , 26186194 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRMT5 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT SF3A2 Affinity Capture-MS, affinity chromatography technology physical, physical association 17332742 , (Europe PMC )0.40 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AIMP1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID AIMP2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ANG anti bait coimmunoprecipitation association 28777577 , (Europe PMC )0.35 IntAct, MINT ANKRA2 Affinity Capture-MS physical 25752541 , (Europe PMC )NA BioGRID ANXA1 anti bait coimmunoprecipitation association 23754495 , (Europe PMC )0.35 IntAct ASH2L Affinity Capture-Western physical 19131338 , (Europe PMC )NA BioGRID B9D2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct BAG2 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT BCOR tandem affinity purification association 27505670 , (Europe PMC )0.35 IntAct BRCA1 Affinity Capture-MS, Affinity Capture-Western physical 20160719 , 26831064 , (Europe PMC )NA BioGRID C20orf24 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CBFA2T2 anti tag coimmunoprecipitation association 27281218 , (Europe PMC )0.35 IntAct CCDC8 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CCNA1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct CDK7 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID CDK9 Affinity Capture-MS, Co-fractionation physical 17643375 , 22863883 , (Europe PMC )NA BioGRID CEP170 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 28514442 , (Europe PMC )0.27, 0.35 BioGRID, IntAct CEP170P1 Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 20360068 , 25416956 , 26496610 , (Europe PMC )0.56 BioGRID, IntAct CFTR Affinity Capture-MS physical 26618866 , (Europe PMC )NA BioGRID CHEK2 Affinity Capture-Western physical 25361978 , (Europe PMC )NA BioGRID CIAO1 Affinity Capture-MS physical 17353931 , (Europe PMC )NA BioGRID CIAO1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CNOT1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID COPG1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID COPS5 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID DCTN3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID EBI-1059087 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EEF1A1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID EEF1AKMT3 Affinity Capture-MS physical 23349634 , (Europe PMC )NA BioGRID EEF1E1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID EGFR tandem affinity purification association 24189400 , (Europe PMC )0.35 IntAct EIF2S3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID EIPR1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EMSY Affinity Capture-Western physical 19131338 , (Europe PMC )NA BioGRID FN1 Affinity Capture-MS physical 19738201 , (Europe PMC )NA BioGRID FOXB1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXH1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXP3 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXQ1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT GBF1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID GSTK1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HAO1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HDAC5 Affinity Capture-MS physical 21081666 , (Europe PMC )NA BioGRID HDAC9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.35 BioGRID, IntAct HIF1AN anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HNRNPA1 Affinity Capture-MS, Co-fractionation physical 22863883 , 25324306 , (Europe PMC )NA BioGRID HSD17B10 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct HSPA1L Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 22365833 , 26186194 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT HSPD1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HTRA2 Biochemical Activity, Protein-peptide, protease assay physical, protein cleavage 17266347 , (Europe PMC )0.44 BioGRID, IntAct IFI16 anti tag coimmunoprecipitation association 25665578 , (Europe PMC )0.35 IntAct IKBKB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct IKBKE anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct IQGAP1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KAT8 Affinity Capture-MS physical 20479123 , (Europe PMC )NA BioGRID KATNAL2 tandem affinity purification association 26929214 , (Europe PMC )0.35 IntAct KBTBD7 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct KCNAB2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MAGEA6 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MAGED1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MAP3K3 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MAX cosedimentation through density gradient physical association 17314511 , (Europe PMC )0.40 IntAct MCC Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MCM7 cosedimentation through density gradient physical association 17314511 , (Europe PMC )0.40 IntAct MDM2 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID MEPCE Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID METTL23 Affinity Capture-MS physical 23349634 , (Europe PMC )NA BioGRID MEX3C Affinity Capture-MS physical 26471122 , (Europe PMC )NA BioGRID MTMR11 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID MYC Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, tandem affinity purification, two hybrid association, physical, physical association 17314511 , 17353931 , 22190494 , (Europe PMC )0.75 BioGRID, IntAct NANOG Affinity Capture-MS physical 26687479 , (Europe PMC )NA BioGRID NBEAL2 tandem affinity purification association 29187380 , (Europe PMC )0.35 IntAct NCAPD2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NCAPG Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NEK6 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct NELFCD Affinity Capture-MS physical 17353931 , (Europe PMC )NA BioGRID NFKB2 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NFKBIB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NLGN3 Two-hybrid, two hybrid physical, physical association 25464930 , (Europe PMC )0.37 BioGRID, IntAct NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID PDIA6 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PHLDA3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PLEC Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PNMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 14676191 , (Europe PMC )0.35 BioGRID, IntAct POLR2A cosedimentation through density gradient physical association 17314511 , (Europe PMC )0.40 IntAct POU5F1 Affinity Capture-MS physical 26687479 , (Europe PMC )NA BioGRID PPEF1 pull down association 28330616 , (Europe PMC )0.35 IntAct PPIL4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPP2R1A pull down association 28330616 , (Europe PMC )0.35 IntAct PPP2R2A proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PPP2R2B anti tag coimmunoprecipitation, pull down association 19156129 , (Europe PMC )0.46 IntAct PPP2R2D proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PPP4R3A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PRMT5 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSMA4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PSMC1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PSMD3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PSME3 Affinity Capture-Western physical 25361978 , (Europe PMC )NA BioGRID PTP4A3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PYHIN1 anti tag coimmunoprecipitation association 25665578 , (Europe PMC )0.35 IntAct QARS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID RAD21 Affinity Capture-MS, Affinity Capture-Western physical 22145905 , (Europe PMC )NA BioGRID RARS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID RBBP5 Affinity Capture-Western physical 19131338 , (Europe PMC )NA BioGRID RC3H1 Affinity Capture-MS physical 26170170 , (Europe PMC )NA BioGRID RELA tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct RELB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct RPA1 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA2 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA3 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPL27A Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID RUVBL2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID SCARNA22 Affinity Capture-RNA physical 22751105 , (Europe PMC )NA BioGRID SEC16A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SF3A2 Affinity Capture-MS, affinity chromatography technology physical, physical association 17332742 , (Europe PMC )0.40 BioGRID, IntAct, MINT SF3B3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SIRT1 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, molecular sieving, pull down direct interaction, physical, physical interaction 18235501 , 18235502 , 22190494 , 22735644 , 25361978 , (Europe PMC )0.69 BioGRID, IntAct SIRT6 Affinity Capture-MS physical 24169447 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SMC2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SMC4 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SOX2 Affinity Capture-MS physical 21532573 , 23667531 , (Europe PMC )NA BioGRID TAB2 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TARDBP Affinity Capture-MS physical 20020773 , (Europe PMC )NA BioGRID TP53 anti tag coimmunoprecipitation physical interaction 18235501 , (Europe PMC )0.27 IntAct TRADD tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TUBA1A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TUBB3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TUBB8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID VCAM1 cross-linking study association 22623428 , (Europe PMC )0.35 IntAct VHL anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct WRAP73 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct XPO1 Affinity Capture-MS physical 26673895 , (Europe PMC )NA BioGRID ZBTB1 Affinity Capture-MS physical 24657165 , (Europe PMC )NA BioGRID ZNF121 cosedimentation through density gradient physical association 17314511 , (Europe PMC )0.40 IntAct ZNF335 Affinity Capture-Western, Two-hybrid physical 19131338 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
ATR T454_AAEAAPPtQEAQGET , NA NA PhosphoSitePlus , Unknown S124_SNQPLLKsPAPPLLH , S478_LEQAADTsRRNAETP , S671_AGAKLEDsEVRSVAS , S675_LEDSEVRsVASNQSE , S678_SEVRSVAsNQSEMEF , S681_RSVASNQsEMEFSSL , S686_NQSEMEFsSLQDMPK , S808_ALVSHNGsLINVGSL , T35_GPPPGLLtPPVATEL , T454_AAEAAPPtQEAQGET , T484_TSRRNAEtPEATTQQ , T488_NAETPEAtTQQETDT , T493_EATTQQEtDTDLPEA , T495_TTQQETDtDLPEAPP , T897_QELRRRLtPLQLEIQ , HTP, in vivo 15302935 , 17081983 , 17287340 , 17322306 , 18452278 , 18669648 , 18767875 , 19413330 , 19415658 , 19651622 , 19664995 , 20058876 , 20068231 , 20166139 ,(Europe PMC )HPRD, PhosphoELM ,
Statistics
