Top MAP4K1
Localization (UniProt annotation) N/A Function (UniProt annotation) Serine/threonine-protein kinase, which may play a rolein the response to environmental stress Appears to act upstreamof the JUN N-terminal pathway May play a role in hematopoieticlineage decisions and growth regulation Able toautophosphorylate Catalytic Activity (UniProt annotation) ATP + a protein = ADP + a phosphoprotein Protein Sequence MDVVDPDIFNRDPRDHYDLLQRLGGGTYGEVFKARDKVSGDLVALKMVKMEPDDDVSTLQKEILILKTCRHANIVAYHGS
YLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILINDAGEVRLADFGISA
QIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEK
GKWSAAFHNFIKVTLTKSPKKRPSATKMLSHQLVSQPGLNRGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRS
THRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPK
PKFRSPSDEGPGSMGDDGQLSPGVLVRCASGPPPNSPRPGPPPSTSSPHLTAHSEPSLWNPPSRELDKPPLLPPKKEKMK
RKGCALLVKLFNGCPLRIHSTAAWTHPSTKDQHLLLGAEEGIFILNRNDQEATLEMLFPSRTTWVYSINNVLMSLSGKTP
HLYSHSILGLLERKETRAGNPIAHISPHRLLARKNMVSTKIQDTKGCRACCVAEGASSGGPFLCGALETSVVLLQWYQPM
NKFLLVRQVLFPLPTPLSVFALLTGPGSELPAVCIGVSPGRPGKSVLFHTVRFGALSCWLGEMSTEHRGPVQVTQVEEDM
VMVLMDGSVKLVTPEGSPVRGLRTPEIPMTEAVEAVAMVGGQLQAFWKHGVQVWALGSDQLLQELRDPTLTFRLLGSPRL
ECSGTISPHCNLLLPGSSNSPASASRVAGITGL
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) hsa04010 MAPK signaling pathway The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli.
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CARD11 Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation physical, physical association 19706536 , (Europe PMC )0.40 BioGRID, IntAct COPS5 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CRK Affinity Capture-Western, Reconstituted Complex, peptide array, pull down physical, physical association 11279207 , 17474147 , 9788432 , 9891069 , (Europe PMC )0.59 BioGRID, IntAct CRKL Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down physical, physical association 11279207 , 9788432 , 9891069 , (Europe PMC )0.52 BioGRID, IntAct CUL7 Affinity Capture-Western physical 24362026 , (Europe PMC )NA BioGRID DBNL Affinity Capture-Western, Reconstituted Complex physical 10567356 , (Europe PMC )NA BioGRID EGFR Co-fractionation, PCA, Two-hybrid, ubiquitin reconstruction physical, physical association 24658140 , 25402006 , 9346925 , (Europe PMC )0.37 BioGRID, IntAct FBXW7 Affinity Capture-Western physical 24362026 , (Europe PMC )NA BioGRID FBXW8 Affinity Capture-Western physical 24362026 , (Europe PMC )NA BioGRID GRAP2 Affinity Capture-Western, Co-purification, Phenotypic Enhancement, Reconstituted Complex, Two-hybrid genetic, physical 11313918 , 12496419 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, peptide array, pull down, surface plasmon resonance, two hybrid physical, physical association 11279207 , 17474147 , 9346925 , 9788432 , 9891069 , (Europe PMC )0.72 BioGRID, IntAct, MINT HCLS1 Affinity Capture-Western physical 10233887 , (Europe PMC )NA BioGRID HIST1H2AB Biochemical Activity physical 17895239 , (Europe PMC )NA BioGRID HSD17B10 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct HSP90AA1 Affinity Capture-Luminescence physical 22939624 , (Europe PMC )NA BioGRID LAT Affinity Capture-Western, Co-fractionation physical 11279207 , (Europe PMC )NA BioGRID LRRK1 Affinity Capture-MS physical 20697350 , (Europe PMC )NA BioGRID MAP3K11 Biochemical Activity physical 11053428 , (Europe PMC )NA BioGRID MAP3K7 Affinity Capture-Western physical 10224067 , (Europe PMC )NA BioGRID MAP4K1 Affinity Capture-Western, Biochemical Activity physical 19706536 , 24362026 , (Europe PMC )NA BioGRID NCK1 Affinity Capture-Western, Protein-peptide, Reconstituted Complex, Two-hybrid, peptide array, pull down, two hybrid physical, physical association 11279207 , 17474147 , 22974441 , 9346925 , 9891069 , (Europe PMC )0.65 BioGRID, IntAct, MINT PDHA1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct PPP4C Affinity Capture-Western, Biochemical Activity physical 15364934 , 24362026 , (Europe PMC )NA BioGRID RBX1 Affinity Capture-Western physical 24362026 , (Europe PMC )NA BioGRID SDHA Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SKP1 Affinity Capture-Western physical 24362026 , (Europe PMC )NA BioGRID SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SPRY1 Affinity Capture-Western physical 19915061 , (Europe PMC )NA BioGRID TMEM101 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CARD11 Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation physical, physical association 19706536 , (Europe PMC )0.40 BioGRID, IntAct CRK Affinity Capture-Western, Reconstituted Complex, peptide array, pull down physical, physical association 11279207 , 17474147 , 9788432 , 9891069 , (Europe PMC )0.59 BioGRID, IntAct CRKL Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down physical, physical association 11279207 , 9788432 , 9891069 , (Europe PMC )0.52 BioGRID, IntAct EGFR Co-fractionation, PCA, Two-hybrid, ubiquitin reconstruction physical, physical association 24658140 , 25402006 , 9346925 , (Europe PMC )0.37 BioGRID, IntAct FYN peptide array physical association 17474147 , (Europe PMC )0.40 IntAct GRB2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, peptide array, pull down, surface plasmon resonance, two hybrid physical, physical association 11279207 , 17474147 , 9346925 , 9788432 , 9891069 , (Europe PMC )0.72 BioGRID, IntAct, MINT HSD17B10 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct HSP90AB1 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct MAP3K11 two hybrid physical association 9346925 , (Europe PMC )0.37 IntAct, MINT NCK1 Affinity Capture-Western, Protein-peptide, Reconstituted Complex, Two-hybrid, peptide array, pull down, two hybrid physical, physical association 11279207 , 17474147 , 22974441 , 9346925 , 9891069 , (Europe PMC )0.65 BioGRID, IntAct, MINT PDHA1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct PIK3R1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PLCG1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence technology, peptide array, pull down direct interaction, physical association 17474147 , (Europe PMC )0.66 IntAct SDHA Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SLAMF1 anti bait coimmunoprecipitation, pull down association, physical association 20231852 , (Europe PMC )0.58 IntAct SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SRC peptide array physical association 17474147 , (Europe PMC )0.40 IntAct TMEM101 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source GRB2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, peptide array, pull down, surface plasmon resonance, two hybrid physical, physical association 11279207 , 17474147 , 9346925 , 9788432 , 9891069 , (Europe PMC )0.72 BioGRID, IntAct, MINT MAP3K11 two hybrid physical association 9346925 , (Europe PMC )0.37 IntAct, MINT NCK1 Affinity Capture-Western, Protein-peptide, Reconstituted Complex, Two-hybrid, peptide array, pull down, two hybrid physical, physical association 11279207 , 17474147 , 22974441 , 9346925 , 9891069 , (Europe PMC )0.65 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source BLNK Affinity Capture-Western, Reconstituted Complex physical 11514608 , (Europe PMC )NA BioGRID CARD11 Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation physical, physical association 19706536 , (Europe PMC )0.40 BioGRID, IntAct COPS5 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CRK Affinity Capture-Western, Reconstituted Complex, peptide array, pull down physical, physical association 11279207 , 17474147 , 9788432 , 9891069 , (Europe PMC )0.59 BioGRID, IntAct CRKL Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down physical, physical association 11279207 , 9788432 , 9891069 , (Europe PMC )0.52 BioGRID, IntAct CUL7 Affinity Capture-Western physical 24362026 , (Europe PMC )NA BioGRID DBNL Affinity Capture-Western, Reconstituted Complex physical 10567356 , (Europe PMC )NA BioGRID EGFR Co-fractionation, PCA, Two-hybrid, ubiquitin reconstruction physical, physical association 24658140 , 25402006 , 9346925 , (Europe PMC )0.37 BioGRID, IntAct FBXW7 Affinity Capture-Western physical 24362026 , (Europe PMC )NA BioGRID FBXW8 Affinity Capture-Western physical 24362026 , (Europe PMC )NA BioGRID FYN peptide array physical association 17474147 , (Europe PMC )0.40 IntAct GRAP2 Affinity Capture-Western, Co-purification, Phenotypic Enhancement, Reconstituted Complex, Two-hybrid genetic, physical 11313918 , 12496419 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, peptide array, pull down, surface plasmon resonance, two hybrid physical, physical association 11279207 , 17474147 , 9346925 , 9788432 , 9891069 , (Europe PMC )0.72 BioGRID, IntAct, MINT HCLS1 Affinity Capture-Western physical 10233887 , (Europe PMC )NA BioGRID HIST1H2AB Biochemical Activity physical 17895239 , (Europe PMC )NA BioGRID HSD17B10 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct HSP90AA1 Affinity Capture-Luminescence physical 22939624 , (Europe PMC )NA BioGRID HSP90AB1 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct LAT Affinity Capture-Western, Co-fractionation physical 11279207 , (Europe PMC )NA BioGRID LRRK1 Affinity Capture-MS physical 20697350 , (Europe PMC )NA BioGRID MAP3K11 Biochemical Activity physical 11053428 , (Europe PMC )NA BioGRID MAP3K11 two hybrid physical association 9346925 , (Europe PMC )0.37 IntAct, MINT MAP3K7 Affinity Capture-Western physical 10224067 , (Europe PMC )NA BioGRID MAP4K1 Affinity Capture-Western, Biochemical Activity physical 19706536 , 24362026 , (Europe PMC )NA BioGRID NCK1 Affinity Capture-Western, Protein-peptide, Reconstituted Complex, Two-hybrid, peptide array, pull down, two hybrid physical, physical association 11279207 , 17474147 , 22974441 , 9346925 , 9891069 , (Europe PMC )0.65 BioGRID, IntAct, MINT PDHA1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct PIK3R1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PLCG1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence technology, peptide array, pull down direct interaction, physical association 17474147 , (Europe PMC )0.66 IntAct PPP4C Affinity Capture-Western, Biochemical Activity physical 15364934 , 24362026 , (Europe PMC )NA BioGRID RBX1 Affinity Capture-Western physical 24362026 , (Europe PMC )NA BioGRID SDHA Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SKP1 Affinity Capture-Western physical 24362026 , (Europe PMC )NA BioGRID SLAMF1 anti bait coimmunoprecipitation, pull down association, physical association 20231852 , (Europe PMC )0.58 IntAct SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SPRY1 Affinity Capture-Western physical 19915061 , (Europe PMC )NA BioGRID SRC peptide array physical association 17474147 , (Europe PMC )0.40 IntAct TMEM101 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
ABL1 Y232_FLMTKSGyQPPRLKE , in vitro, in vivo 11278340 ,(Europe PMC )HPRD, LYN Y381_SESSDDDyDDVDIPT , in vitro 11514608 ,(Europe PMC )HPRD, MAP4K1 S376_PRKQLSEsSDDDYDD , S377_RKQLSESsDDDYDDV , S407_KPKFRSPsDEGPGSM , S421_MGDDGQLsPGVLVRC , S586_GNPIAHIsPHRLLAR , T165_ISAQIGAtLARRLSF , Y381_SESSDDDyDDVDIPT , in vivo 17192257 ,(Europe PMC )HPRD, PhosphoSitePlus , PRKD1 S171_ATLARRLsFIGTPYW , NA NA PhosphoSitePlus , SYK Y381_SESSDDDyDDVDIPT , LTP, in vitro 11514608 ,(Europe PMC )HPRD, PhosphoELM , Unknown S171_ATLARRLsFIGTPYW , S366_QPPRDLRsSSPRKQL , S368_PRDLRSSsPRKQLSE , S374_SSPRKQLsESSDDDY , S376_PRKQLSEsSDDDYDD , S407_KPKFRSPsDEGPGSM , S413_PSDEGPGsMGDDGQL , S421_MGDDGQLsPGVLVRC , S586_GNPIAHIsPHRLLAR , T165_ISAQIGAtLARRLSF , Y381_SESSDDDyDDVDIPT , HTP, LTP, in vivo 11487585 , 15302935 , 15743830 , 17192257 ,(Europe PMC )HPRD, PhosphoELM ,
Statistics
