Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
DUSP3
Gene Name  | DUSP3 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | DUSP3, VHR | |
| Protein Name | DUSP3 |
|
| Alternative Name(s) |
Dual specificity protein phosphatase 3;3.1.3.16;3.1.3.48;Dual specificity protein phosphatase VHR;Vaccinia H1-related phosphatase;VHR; | |
| EntrezGene ID | 1845 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P51452 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 20478 Dalton | |
| Protein Length | 185 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000108861 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class I Cys-based PTPs --> Family: DSP | Historic class: Class I Cys-based PTPs --> VH1-like or DSPs --> Atypical DSPs | CATH ID: 3.90.190.10 | SCOP Fold: CC1 | |
| Phosphatase activity | active | Catalytic signature motif: HCREGYSR | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Nucleus | |||
| Function (UniProt annotation) | |||
| Shows activity both for tyrosine-protein phosphate andserine-protein phosphate, but displays a strong preference towardphosphotyrosines Specifically dephosphorylates and inactivatesERK1 and ERK2 | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKD SGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREI GPNDGFLAQLCQLNDRLAKEGKLKP |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000188 | P:inactivation of MAPK activity |
| GO:0001701 | P:in utero embryonic development |
| GO:0001772 | C:immunological synapse |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0005634 | C:nucleus |
| GO:0005654 | C:nucleoplasm |
| GO:0005829 | C:cytosol |
| GO:0008092 | F:cytoskeletal protein binding |
| GO:0008138 | F:protein tyrosine/serine/threonine phosphatase activity |
| GO:0016311 | P:dephosphorylation |
| GO:0016791 | F:phosphatase activity |
| GO:0019901 | F:protein kinase binding |
| GO:0030336 | P:negative regulation of cell migration |
| GO:0030971 | F:receptor tyrosine kinase binding |
| GO:0033549 | F:MAP kinase phosphatase activity |
| GO:0035335 | P:peptidyl-tyrosine dephosphorylation |
| GO:0042059 | P:negative regulation of epidermal growth factor receptor signaling pathway |
| GO:0043409 | P:negative regulation of MAPK cascade |
| GO:0045931 | P:positive regulation of mitotic cell cycle |
| GO:0046329 | P:negative regulation of JNK cascade |
| GO:0050860 | P:negative regulation of T cell receptor signaling pathway |
| GO:0050868 | P:negative regulation of T cell activation |
| GO:0050922 | P:negative regulation of chemotaxis |
| GO:0051893 | P:regulation of focal adhesion assembly |
| GO:0070373 | P:negative regulation of ERK1 and ERK2 cascade |
| GO:0071364 | P:cellular response to epidermal growth factor stimulus |
| GO:0120183 | P:positive regulation of focal adhesion disassembly |
| GO:1990264 | P:peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity |
| GO:1990782 | F:protein tyrosine kinase binding |
