Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
CSN1S1
Gene Name  | CSN1S1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: NA |
| Synonyms | CSN1S1, CASA, CSN1 | |
| Protein Name | CSN1S1 | |
| Alternative Name(s) | Alpha-S1-casein;Casoxin-D; | |
| Protein Family | Belongs to the alpha-casein family | |
| EntrezGene ID | 1446 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P47710 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 21671 Dalton | |
| Protein Length | 185 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000126545 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - ENOG410J2MD | eggNOG - ENOG41114JX | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Secreted | |||
| Function (UniProt annotation) | |||
| Important role in the capacity of milk to transportcalcium phosphate Casoxin D acts as opioid antagonist and has vasorelaxingactivity mediated by bradykinin B1 receptors | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMNRQRNILREKQTDEIKDTRNESTQNCVVAEP EKMESSISSSSEEMSLSKCAEQFCRLNEYNQLQLQAAHAQEQIRRMNENSHVQVPFQQLNQLAAYPYAVWYYPQIMQYVP FPPFSDISNPTAHENYEKNNVMLQW | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0005576 | C:extracellular region |
| GO:0005615 | C:extracellular space |
| GO:0055085 | P:transmembrane transport |
