Top SLC9A3R1
Localization (UniProt annotation) Cytoplasm Apical cellmembrane Endomembrane system; Peripheral membraneprotein Cell projection, filopodium Cell projection, ruffleCell projection, microvillus Note=Translocates from the cytoplasmto the apical cell membrane in a PODXL-dependent mannerColocalizes with CFTR at the midpiece of sperm tail (Bysimilarity) Colocalizes with actin in microvilli-rich apicalregions of the syncytiotrophoblast Found in microvilli, rufflingmembrane and filopodia of HeLa cells Present in lipid rafts of T-cells Function (UniProt annotation) Scaffold protein that connects plasma membrane proteinswith members of the ezrin/moesin/radixin family and thereby helpsto link them to the actin cytoskeleton and to regulate theirsurface expression Necessary for recycling of internalized ADRB2Was first known to play a role in the regulation of the activityand subcellular location of SLC9A3 Necessary for cAMP-mediatedphosphorylation and inhibition of SLC9A3 May enhance Wntsignaling May participate in HTR4 targeting to microvilli (Bysimilarity) Involved in the regulation of phosphate reabsorptionin the renal proximal tubules Involved in sperm capacitation Mayparticipate in the regulation of the chloride and bicarbonatehomeostasis in spermatozoa Catalytic Activity (UniProt annotation) N/A Protein Sequence MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIR
AALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQAEPPAAAEVQGAGNENEPREADKSHPEQRELRPRLCTMKKG
PSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFK
KCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPI
LDFNISLAMAKERAHQKRSSKRAPQMDWSKKNELFSNL
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
SLC9A3R1 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa04530 Tight junction Tight junctions (TJs) are essential for establishing a selectively permeable barrier to diffusion through the paracellular space between neighboring cells. TJs are composed of at least three types of transmembrane protein -occludin, claudin and junctional adhesion molecules (JAMs)- and a cytoplasmic 'plaque' consisting of many different proteins that form large complexes. These are proposed to be involved in junction assembly, barrier regulation, cell polarity, gene transcription, and other pathways. hsa04928 Parathyroid hormone synthesis, secretion and action Parathyroid hormone (PTH) is a key regulator of calcium and phosphorus homeostasis. The principal regulators of PTH secretion are extracellular ionized calcium (Ca2+) and 1,25-dihydroxyvitamin D (1,25(OH)2D3). Under conditions of dietary Ca restriction, a decrement in serum Ca concentration induces release of PTH from the parathyroid gland. PTH acts on bone and kidney to stimulate bone turnover, increase the circulating levels of 1,25(OH)2D3 and calcium and inhibit the reabsorption of phosphate from the glomerular filtrate. This hormone exerts its actions via binding to the PTH/PTH-related peptide receptor (PTH1R). PTH1R primarily activates two sub-types of heterotrimeric Gproteins: Gs and Gq , which in turn regulate the activity of adenylyl cyclases and phospholipase C (PLC) that control the flow of cAMP/PKA and IP/PKC signaling cascades, respectively. hsa05165 Human papillomavirus infection Human papillomavirus (HPV) is a non-enveloped, double-stranded DNA virus. HPV infect mucoal and cutaneous epithelium resulting in several types of pathologies, most notably, cervical cancer. All types of HPV share a common genomic structure and encode eight proteins: E1, E2, E4, E5, E6, and E7 (early) and L1 and L2 (late). It has been demonstrated that E1 and E2 are involved in viral transcription and replication. The functions of the E4 protein is not yet fully understood. E5, E6, and E7 act as oncoproteins. E5 inhibits the V-ATPase, prolonging EGFR signaling and thereby promoting cell proliferation. The expression of E6 and E7 not only inhibits the tumor suppressors p53 and Rb, but also alters additional signalling pathways. Among these pathways, PI3K/Akt signalling cascade plays a very important role in HPV-induced carcinogenesis. The L1 and L2 proteins form icosahedral capsids for progeny virion generation.
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCC4 Affinity Capture-Western, Reconstituted Complex physical 18045536 , 18559527 , (Europe PMC )NA BioGRID ADRB2 Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, filter binding, saturation binding direct interaction, physical 11526121 , 11882663 , 9560162 , 9671706 , (Europe PMC )0.56 BioGRID, IntAct, MINT AKT1 Affinity Capture-Western, Biochemical Activity physical 25492869 , (Europe PMC )NA BioGRID BCL10 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct CAPN1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CDCA5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CDH1 Proximity Label-MS physical 25468996 , (Europe PMC )NA BioGRID CDH2 Co-fractionation physical 20736378 , (Europe PMC )NA BioGRID CFTR Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, filter binding, pull down, surface plasmon resonance association, direct interaction, physical, physical association 10852925 , 12403779 , 12471024 , 12615054 , 17110338 , 17244609 , 19446522 , 26618866 , 9613608 , 9671706 , 9677412 , (Europe PMC )0.44, 0.81 BioGRID, IntAct, MINT CKB Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CLCN3 Reconstituted Complex, pull down physical, physical association 12471024 , (Europe PMC )0.40 BioGRID, IntAct CNDP2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CSE1L Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CTNNB1 Affinity Capture-Western, Reconstituted Complex physical 12830000 , (Europe PMC )NA BioGRID ECHS1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID EPHB1 Affinity Capture-Western physical 23118026 , (Europe PMC )NA BioGRID EZR Affinity Capture-Western, Co-fractionation, Reconstituted Complex, affinity chromatography technology, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach association, physical, physical association 11285285 , 11684085 , 15020681 , 23414517 , 26344197 , 29568061 , 9314537 , (Europe PMC )0.76 BioGRID, IntAct, MINT FTO Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID G6PD Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID GDA Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID GNA11 Affinity Capture-Western, Reconstituted Complex physical 12193606 , (Europe PMC )NA BioGRID IREB2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID KCNJ1 Reconstituted Complex, Two-hybrid physical 14604981 , (Europe PMC )NA BioGRID LDHAL6B Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID LDHB Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID MAPK1 Co-fractionation physical 20736378 , (Europe PMC )NA BioGRID MDH1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID MME Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17342744 , (Europe PMC )0.35 BioGRID, IntAct MSN Reconstituted Complex physical 9430655 , (Europe PMC )NA BioGRID NANS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NF2 Reconstituted Complex, fluorescence microscopy, pull down, two hybrid colocalization, physical, physical association 15467741 , 26045165 , 9430655 , (Europe PMC )0.37, 0.54 BioGRID, IntAct NOS2 Reconstituted Complex physical 12080081 , (Europe PMC )NA BioGRID NPEPPS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID OPRK1 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation physical, physical association 12004055 , 15070904 , (Europe PMC )0.40 BioGRID, IntAct, MINT P2RY1 Reconstituted Complex, filter binding, saturation binding direct interaction, physical 9671706 , (Europe PMC )0.56 BioGRID, IntAct, MINT PAG1 Affinity Capture-Western, Co-fractionation, Far Western, Two-hybrid, coimmunoprecipitation, two hybrid physical, physical association 11684085 , (Europe PMC )0.51 BioGRID, IntAct, MINT PALM2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PCYOX1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PDGFRA Affinity Capture-Western, Far Western, Reconstituted Complex physical 11046132 , (Europe PMC )NA BioGRID PDGFRB Affinity Capture-Western, Far Western, Reconstituted Complex, filter binding, proximity ligation assay, pull down association, direct interaction, physical, physical association 11046132 , 16456542 , 23397142 , 24012959 , (Europe PMC )0.74 BioGRID, IntAct, MINT PDIA3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PDZK1 Reconstituted Complex, Two-hybrid physical 14531806 , (Europe PMC )NA BioGRID PHLPP1 Affinity Capture-Western, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, filter binding, fluorescence microscopy, pull down colocalization, direct interaction, physical, physical association 21804599 , (Europe PMC )0.52, 0.62 BioGRID, IntAct PHLPP2 Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, anti tag coimmunoprecipitation, filter binding, pull down direct interaction, physical, physical association 19615732 , 21804599 , 27880917 , (Europe PMC )0.70 BioGRID, IntAct PLCB1 Affinity Capture-Western physical 10980202 , 12193606 , (Europe PMC )NA BioGRID PPME1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PPP4R3B Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PRKCA Reconstituted Complex physical 12954600 , (Europe PMC )NA BioGRID PTEN Affinity Capture-Western, Phenotypic Enhancement, Reconstituted Complex, filter binding, pull down, two hybrid direct interaction, genetic, physical, physical association 16456542 , 21804599 , 21990315 , 23118026 , 24012959 , 26531778 , (Europe PMC )0.77 BioGRID, IntAct, MINT PTH1R Affinity Capture-Western, Far Western physical 12075354 , (Europe PMC )NA BioGRID PTPRQ Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct RACK1 Affinity Capture-Western physical 11956211 , (Europe PMC )NA BioGRID RNASET2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RPL23 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID RPS3 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RPS6KA3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SCN4A Protein-peptide physical 9677412 , (Europe PMC )NA BioGRID SKP2 Affinity Capture-Western, Far Western, Protein-peptide physical 25492869 , (Europe PMC )NA BioGRID SLC4A7 Reconstituted Complex physical 12403779 , (Europe PMC )NA BioGRID SLC4A8 Reconstituted Complex physical 12444018 , (Europe PMC )NA BioGRID SLC9A3 Affinity Capture-Western physical 14580213 , (Europe PMC )NA BioGRID SLC9A3R1 Far Western, Reconstituted Complex, nuclear magnetic resonance direct interaction, physical 11046132 , 15070904 , 19446522 , (Europe PMC )0.44 BioGRID, IntAct SMS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SNRNP27 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TACC1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TBC1D10A Reconstituted Complex, filter binding, imaging technique colocalization, direct interaction, physical 11285285 , (Europe PMC )0.49 BioGRID, IntAct, MINT TCF3 Affinity Capture-MS physical 22354994 , (Europe PMC )NA BioGRID TGM2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TKFC Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID U2AF2 Affinity Capture-MS physical 26641092 , (Europe PMC )NA BioGRID UBFD1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID UQCRFS1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID UQCRFS1P1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID YAP1 Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, anti bait coimmunoprecipitation, imaging technique, pull down colocalization, direct interaction, physical, physical association 10562288 , (Europe PMC )0.68 BioGRID, IntAct, MINT YES1 Reconstituted Complex, pull down physical, physical association 10562288 , (Europe PMC )0.40 BioGRID, IntAct, MINT YWHAB Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID YWHAQ Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID YWHAZ Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ZNF468 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ADRB2 Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, filter binding, saturation binding direct interaction, physical 11526121 , 11882663 , 9560162 , 9671706 , (Europe PMC )0.56 BioGRID, IntAct, MINT ARHGAP17 filter binding direct interaction 11285285 , (Europe PMC )0.44 IntAct, MINT BCL10 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct BCL2A1 barcode fusion genetics two hybrid, validated two hybrid physical association 27107012 , (Europe PMC )0.49 IntAct CAPN6 pull down physical association 11285285 , (Europe PMC )0.40 IntAct, MINT CDCA5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CFTR Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, filter binding, pull down, surface plasmon resonance association, direct interaction, physical, physical association 10852925 , 12403779 , 12471024 , 12615054 , 17110338 , 17244609 , 19446522 , 26618866 , 9613608 , 9671706 , 9677412 , (Europe PMC )0.44, 0.81 BioGRID, IntAct, MINT CLCN3 Reconstituted Complex, pull down physical, physical association 12471024 , (Europe PMC )0.40 BioGRID, IntAct EZR Affinity Capture-Western, Co-fractionation, Reconstituted Complex, affinity chromatography technology, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach association, physical, physical association 11285285 , 11684085 , 15020681 , 23414517 , 26344197 , 29568061 , 9314537 , (Europe PMC )0.76 BioGRID, IntAct, MINT FAM20C protein kinase assay phosphorylation reaction 22582013 , (Europe PMC )0.44 IntAct FZD4 far western blotting direct interaction 20802536 , (Europe PMC )0.44 IntAct LAMP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MCC pull down physical association 19555689 , (Europe PMC )0.40 IntAct, MINT MME Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17342744 , (Europe PMC )0.35 BioGRID, IntAct MSN affinity chromatography technology, fluorescence microscopy, pull down, x-ray crystallography colocalization, direct interaction, physical association 15020681 , 9430655 , (Europe PMC )0.68 IntAct NF2 Reconstituted Complex, fluorescence microscopy, pull down, two hybrid colocalization, physical, physical association 15467741 , 26045165 , 9430655 , (Europe PMC )0.37, 0.54 BioGRID, IntAct OPRK1 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation physical, physical association 12004055 , 15070904 , (Europe PMC )0.40 BioGRID, IntAct, MINT P2RY1 Reconstituted Complex, filter binding, saturation binding direct interaction, physical 9671706 , (Europe PMC )0.56 BioGRID, IntAct, MINT P2RY2 filter binding direct interaction 9671706 , (Europe PMC )0.44 IntAct, MINT PAG1 Affinity Capture-Western, Co-fractionation, Far Western, Two-hybrid, coimmunoprecipitation, two hybrid physical, physical association 11684085 , (Europe PMC )0.51 BioGRID, IntAct, MINT PDGFRB Affinity Capture-Western, Far Western, Reconstituted Complex, filter binding, proximity ligation assay, pull down association, direct interaction, physical, physical association 11046132 , 16456542 , 23397142 , 24012959 , (Europe PMC )0.74 BioGRID, IntAct, MINT PHLPP1 Affinity Capture-Western, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, filter binding, fluorescence microscopy, pull down colocalization, direct interaction, physical, physical association 21804599 , (Europe PMC )0.52, 0.62 BioGRID, IntAct PHLPP2 Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, anti tag coimmunoprecipitation, filter binding, pull down direct interaction, physical, physical association 19615732 , 21804599 , 27880917 , (Europe PMC )0.70 BioGRID, IntAct PLCB3 pull down physical association 11285285 , (Europe PMC )0.40 IntAct, MINT PTEN Affinity Capture-Western, Phenotypic Enhancement, Reconstituted Complex, filter binding, pull down, two hybrid direct interaction, genetic, physical, physical association 16456542 , 21804599 , 21990315 , 23118026 , 24012959 , 26531778 , (Europe PMC )0.77 BioGRID, IntAct, MINT PTPRQ Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SLC26A6 pull down direct interaction 12444019 , (Europe PMC )0.44 IntAct SLC9A3R1 Far Western, Reconstituted Complex, nuclear magnetic resonance direct interaction, physical 11046132 , 15070904 , 19446522 , (Europe PMC )0.44 BioGRID, IntAct TBC1D10A Reconstituted Complex, filter binding, imaging technique colocalization, direct interaction, physical 11285285 , (Europe PMC )0.49 BioGRID, IntAct, MINT YAP1 Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, anti bait coimmunoprecipitation, imaging technique, pull down colocalization, direct interaction, physical, physical association 10562288 , (Europe PMC )0.68 BioGRID, IntAct, MINT YES1 Reconstituted Complex, pull down physical, physical association 10562288 , (Europe PMC )0.40 BioGRID, IntAct, MINT ZNF468 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ARHGAP17 filter binding direct interaction 11285285 , (Europe PMC )0.44 IntAct, MINT CAPN6 pull down physical association 11285285 , (Europe PMC )0.40 IntAct, MINT CFTR Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, filter binding, pull down, surface plasmon resonance association, direct interaction, physical, physical association 10852925 , 12403779 , 12471024 , 12615054 , 17110338 , 17244609 , 19446522 , 26618866 , 9613608 , 9671706 , 9677412 , (Europe PMC )0.44, 0.81 BioGRID, IntAct, MINT EZR Affinity Capture-Western, Co-fractionation, Reconstituted Complex, affinity chromatography technology, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach association, physical, physical association 11285285 , 11684085 , 15020681 , 23414517 , 26344197 , 29568061 , 9314537 , (Europe PMC )0.76 BioGRID, IntAct, MINT MCC pull down physical association 19555689 , (Europe PMC )0.40 IntAct, MINT OPRK1 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation physical, physical association 12004055 , 15070904 , (Europe PMC )0.40 BioGRID, IntAct, MINT P2RY1 Reconstituted Complex, filter binding, saturation binding direct interaction, physical 9671706 , (Europe PMC )0.56 BioGRID, IntAct, MINT P2RY2 filter binding direct interaction 9671706 , (Europe PMC )0.44 IntAct, MINT PAG1 Affinity Capture-Western, Co-fractionation, Far Western, Two-hybrid, coimmunoprecipitation, two hybrid physical, physical association 11684085 , (Europe PMC )0.51 BioGRID, IntAct, MINT PDGFRB Affinity Capture-Western, Far Western, Reconstituted Complex, filter binding, proximity ligation assay, pull down association, direct interaction, physical, physical association 11046132 , 16456542 , 23397142 , 24012959 , (Europe PMC )0.74 BioGRID, IntAct, MINT PLCB3 pull down physical association 11285285 , (Europe PMC )0.40 IntAct, MINT PTEN Affinity Capture-Western, Phenotypic Enhancement, Reconstituted Complex, filter binding, pull down, two hybrid direct interaction, genetic, physical, physical association 16456542 , 21804599 , 21990315 , 23118026 , 24012959 , 26531778 , (Europe PMC )0.77 BioGRID, IntAct, MINT TBC1D10A Reconstituted Complex, filter binding, imaging technique colocalization, direct interaction, physical 11285285 , (Europe PMC )0.49 BioGRID, IntAct, MINT YAP1 Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, anti bait coimmunoprecipitation, imaging technique, pull down colocalization, direct interaction, physical, physical association 10562288 , (Europe PMC )0.68 BioGRID, IntAct, MINT YES1 Reconstituted Complex, pull down physical, physical association 10562288 , (Europe PMC )0.40 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCC2 Co-localization, Reconstituted Complex physical 12615054 , 25163515 , (Europe PMC )NA BioGRID ABCC4 Affinity Capture-Western, Reconstituted Complex physical 18045536 , 18559527 , (Europe PMC )NA BioGRID ADRB2 Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, filter binding, saturation binding direct interaction, physical 11526121 , 11882663 , 9560162 , 9671706 , (Europe PMC )0.56 BioGRID, IntAct, MINT AKT1 Affinity Capture-Western, Biochemical Activity physical 25492869 , (Europe PMC )NA BioGRID ARHGAP17 filter binding direct interaction 11285285 , (Europe PMC )0.44 IntAct, MINT BCL10 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct BCL2A1 barcode fusion genetics two hybrid, validated two hybrid physical association 27107012 , (Europe PMC )0.49 IntAct CAPN1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CAPN6 pull down physical association 11285285 , (Europe PMC )0.40 IntAct, MINT CDCA5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CDH1 Proximity Label-MS physical 25468996 , (Europe PMC )NA BioGRID CDH2 Co-fractionation physical 20736378 , (Europe PMC )NA BioGRID CFTR Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, filter binding, pull down, surface plasmon resonance association, direct interaction, physical, physical association 10852925 , 12403779 , 12471024 , 12615054 , 17110338 , 17244609 , 19446522 , 26618866 , 9613608 , 9671706 , 9677412 , (Europe PMC )0.44, 0.81 BioGRID, IntAct, MINT CKB Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CLCN3 Reconstituted Complex, pull down physical, physical association 12471024 , (Europe PMC )0.40 BioGRID, IntAct CNDP2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CSE1L Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CTNNB1 Affinity Capture-Western, Reconstituted Complex physical 12830000 , (Europe PMC )NA BioGRID ECHS1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID EPHB1 Affinity Capture-Western physical 23118026 , (Europe PMC )NA BioGRID EZR Affinity Capture-Western, Co-fractionation, Reconstituted Complex, affinity chromatography technology, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach association, physical, physical association 11285285 , 11684085 , 15020681 , 23414517 , 26344197 , 29568061 , 9314537 , (Europe PMC )0.76 BioGRID, IntAct, MINT FAM20C protein kinase assay phosphorylation reaction 22582013 , (Europe PMC )0.44 IntAct FTO Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID FZD4 far western blotting direct interaction 20802536 , (Europe PMC )0.44 IntAct G6PD Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID GDA Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID GNA11 Affinity Capture-Western, Reconstituted Complex physical 12193606 , (Europe PMC )NA BioGRID IREB2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID KCNJ1 Reconstituted Complex, Two-hybrid physical 14604981 , (Europe PMC )NA BioGRID LAMP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LDHAL6B Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID LDHB Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID MAPK1 Co-fractionation physical 20736378 , (Europe PMC )NA BioGRID MCC pull down physical association 19555689 , (Europe PMC )0.40 IntAct, MINT MDH1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID MME Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17342744 , (Europe PMC )0.35 BioGRID, IntAct MSN Reconstituted Complex physical 9430655 , (Europe PMC )NA BioGRID MSN affinity chromatography technology, fluorescence microscopy, pull down, x-ray crystallography colocalization, direct interaction, physical association 15020681 , 9430655 , (Europe PMC )0.68 IntAct NANS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NF2 Reconstituted Complex, fluorescence microscopy, pull down, two hybrid colocalization, physical, physical association 15467741 , 26045165 , 9430655 , (Europe PMC )0.37, 0.54 BioGRID, IntAct NOS2 Reconstituted Complex physical 12080081 , (Europe PMC )NA BioGRID NPEPPS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID OPRK1 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation physical, physical association 12004055 , 15070904 , (Europe PMC )0.40 BioGRID, IntAct, MINT P2RY1 Reconstituted Complex, filter binding, saturation binding direct interaction, physical 9671706 , (Europe PMC )0.56 BioGRID, IntAct, MINT P2RY2 filter binding direct interaction 9671706 , (Europe PMC )0.44 IntAct, MINT PAG1 Affinity Capture-Western, Co-fractionation, Far Western, Two-hybrid, coimmunoprecipitation, two hybrid physical, physical association 11684085 , (Europe PMC )0.51 BioGRID, IntAct, MINT PALM2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PCYOX1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PDGFRA Affinity Capture-Western, Far Western, Reconstituted Complex physical 11046132 , (Europe PMC )NA BioGRID PDGFRB Affinity Capture-Western, Far Western, Reconstituted Complex, filter binding, proximity ligation assay, pull down association, direct interaction, physical, physical association 11046132 , 16456542 , 23397142 , 24012959 , (Europe PMC )0.74 BioGRID, IntAct, MINT PDIA3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PDZK1 Reconstituted Complex, Two-hybrid physical 14531806 , (Europe PMC )NA BioGRID PHLPP1 Affinity Capture-Western, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, filter binding, fluorescence microscopy, pull down colocalization, direct interaction, physical, physical association 21804599 , (Europe PMC )0.52, 0.62 BioGRID, IntAct PHLPP2 Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, anti tag coimmunoprecipitation, filter binding, pull down direct interaction, physical, physical association 19615732 , 21804599 , 27880917 , (Europe PMC )0.70 BioGRID, IntAct PLCB1 Affinity Capture-Western physical 10980202 , 12193606 , (Europe PMC )NA BioGRID PLCB3 pull down physical association 11285285 , (Europe PMC )0.40 IntAct, MINT PPME1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PPP4R3B Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PRKCA Reconstituted Complex physical 12954600 , (Europe PMC )NA BioGRID PTEN Affinity Capture-Western, Phenotypic Enhancement, Reconstituted Complex, filter binding, pull down, two hybrid direct interaction, genetic, physical, physical association 16456542 , 21804599 , 21990315 , 23118026 , 24012959 , 26531778 , (Europe PMC )0.77 BioGRID, IntAct, MINT PTH1R Affinity Capture-Western, Far Western physical 12075354 , (Europe PMC )NA BioGRID PTPRQ Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct RACK1 Affinity Capture-Western physical 11956211 , (Europe PMC )NA BioGRID RNASET2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RPL23 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID RPS3 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RPS6KA3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SCN4A Protein-peptide physical 9677412 , (Europe PMC )NA BioGRID SKP2 Affinity Capture-Western, Far Western, Protein-peptide physical 25492869 , (Europe PMC )NA BioGRID SLC26A6 pull down direct interaction 12444019 , (Europe PMC )0.44 IntAct SLC4A7 Reconstituted Complex physical 12403779 , (Europe PMC )NA BioGRID SLC4A8 Reconstituted Complex physical 12444018 , (Europe PMC )NA BioGRID SLC9A3 Affinity Capture-Western physical 14580213 , (Europe PMC )NA BioGRID SLC9A3R1 Far Western, Reconstituted Complex, nuclear magnetic resonance direct interaction, physical 11046132 , 15070904 , 19446522 , (Europe PMC )0.44 BioGRID, IntAct SMS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SNRNP27 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TACC1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TBC1D10A Reconstituted Complex, filter binding, imaging technique colocalization, direct interaction, physical 11285285 , (Europe PMC )0.49 BioGRID, IntAct, MINT TCF3 Affinity Capture-MS physical 22354994 , (Europe PMC )NA BioGRID TGM2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TKFC Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID U2AF2 Affinity Capture-MS physical 26641092 , (Europe PMC )NA BioGRID UBFD1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID UQCRFS1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID UQCRFS1P1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID YAP1 Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, anti bait coimmunoprecipitation, imaging technique, pull down colocalization, direct interaction, physical, physical association 10562288 , (Europe PMC )0.68 BioGRID, IntAct, MINT YES1 Reconstituted Complex, pull down physical, physical association 10562288 , (Europe PMC )0.40 BioGRID, IntAct, MINT YWHAB Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID YWHAQ Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID YWHAZ Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ZNF468 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
CDK1 S280_LAEAALEsPRPALVR , S302_EELNSQDsPPKQDST , NA NA PhosphoSitePlus , GRK-6 S290_PALVRSAsSDTSEEL , LTP 10446210 ,(Europe PMC )PhosphoELM , GRK6 S290_PALVRSAsSDTSEEL , in vivo 15302935 , 18088087 , 18452278 , 18669648 , 19413330 , 19664995 , 20166139 ,(Europe PMC )HPRD, PKC_alpha S162_CTMKKGPsGYGFNLH , LTP 12881487 ,(Europe PMC )PhosphoELM , PRKCA S162_CTMKKGPsGYGFNLH , S339_ERAHQKRsSKRAPQM , S340_RAHQKRSsKRAPQMD , S77_ETHQQVVsRIRAALN , NA NA PhosphoSitePlus , RPS6KA1 T156_ELRPRLCtMKKGPSG , NA NA PhosphoSitePlus , Unknown S269_GEIQKENsREALAEA , S280_LAEAALEsPRPALVR , S288_PRPALVRsASSDTSE , S290_PALVRSAsSDTSEEL , S291_ALVRSASsDTSEELN , S294_RSASSDTsEELNSQD , S299_DTSEELNsQDSPPKQ , S2_MsADAAAGA , S302_EELNSQDsPPKQDST , S316_TAPSSTSsSDPILDF , S317_APSSTSSsDPILDFN , S326_PILDFNIsLAMAKER , S46_IRLVEPGsPAEKAGL , T293_VRSASSDtSEELNSQ , HTP, in vivo 15302935 , 17081983 , 17924679 , 18088087 , 18212344 , 18452278 , 18669648 , 18707149 , 18767875 , 19413330 , 19415658 , 19651622 , 19664994 , 19664995 , 20058876 , 20068231 , 20166139 ,(Europe PMC )HPRD, PhosphoELM ,
Statistics
