- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
MAPT
Gene Name  | MAPT (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 5HF3 |
| Synonyms | MAPT, MAPTL, MTBT1, TAU | |
| Protein Name | MAPT | |
| Alternative Name(s) | Microtubule-associated protein tau;Neurofibrillary tangle protein;Paired helical filament-tau;PHF-tau; | |
| Protein Family | noSimilarity_annotations | |
| EntrezGene ID | 4137 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P10636 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 78928 Dalton | |
| Protein Length | 758 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000186868 (Ensembl) | ENSG00000277956 (Ensembl) | ENSG00000276155 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG2418 | eggNOG - ENOG4111J07 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm, cytosol Cell membrane Cytoplasm, cytoskeleton Cell projection, axon Cytoplasm Cell projection, dendrite Note=Mostly found in the axons ofneurons, in the cytosol and in association with plasma membranecomponents | |||
| Function (UniProt annotation) | |||
| Promotes microtubule assembly and stability, and mightbe involved in the establishment and maintenance of neuronalpolarity The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting thattau functions as a linker protein between both Axonal polarity ispredetermined by TAU/MAPT localization (in the neuronal cell) inthe domain of the cell body defined by the centrosome The shortisoforms allow plasticity of the cytoskeleton whereas the longerisoforms may preferentially play a role in its stabilization | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLV DEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLP EGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPA QDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLEFTFHVEITPNVQKEQAHSEE HLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSS AKTLKNRPCLSPKHPTPGSSDPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQK GQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRL QTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCG SLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDT SPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| DOC_WW_Pin1_4 | 228-SPQDSP-233 | WW domain ligands | ...([ST])P. | LIG_SH3_1 | 547-RTPPKSP-553 | SH3 ligand | [RKY]..P..P | LIG_SH3_3 | 213-GSKEEVD-219 | SH3 ligand | ...[PV]..P |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000226 | P:microtubule cytoskeleton organization |
| GO:0001774 | P:microglial cell activation |
| GO:0003677 | F:DNA binding |
| GO:0003680 | F:AT DNA binding |
| GO:0003690 | F:double-stranded DNA binding |
| GO:0003697 | F:single-stranded DNA binding |
| GO:0003723 | F:RNA binding |
| GO:0003779 | F:actin binding |
| GO:0005576 | C:extracellular region |
| GO:0005622 | C:intracellular |
| GO:0005634 | C:nucleus |
| GO:0005737 | C:cytoplasm |
| GO:0005739 | C:mitochondrion |
| GO:0005829 | C:cytosol |
| GO:0005874 | C:microtubule |
| GO:0005875 | C:microtubule associated complex |
| GO:0005886 | C:plasma membrane |
| GO:0006475 | P:internal protein amino acid acetylation |
| GO:0006919 | P:activation of cysteine-type endopeptidase activity involved in apoptotic process |
| GO:0007267 | P:cell-cell signaling |
| GO:0007416 | P:synapse assembly |
| GO:0007611 | P:learning or memory |
| GO:0007613 | P:memory |
| GO:0008017 | F:microtubule binding |
| GO:0010288 | P:response to lead ion |
| GO:0010506 | P:regulation of autophagy |
| GO:0010629 | P:negative regulation of gene expression |
| GO:0010917 | P:negative regulation of mitochondrial membrane potential |
| GO:0015630 | C:microtubule cytoskeleton |
| GO:0016072 | P:rRNA metabolic process |
| GO:0016607 | C:nuclear speck |
| GO:0017124 | F:SH3 domain binding |
| GO:0019896 | P:axonal transport of mitochondrion |
| GO:0019899 | F:enzyme binding |
| GO:0019901 | F:protein kinase binding |
| GO:0021954 | P:central nervous system neuron development |
| GO:0030424 | C:axon |
| GO:0030425 | C:dendrite |
| GO:0030426 | C:growth cone |
| GO:0030673 | C:axolemma |
| GO:0030674 | F:protein binding |
| GO:0031110 | bridging |
| GO:0031113 | P:regulation of microtubule polymerization or depolymerization |
| GO:0031116 | P:regulation of microtubule polymerization |
| GO:0031122 | P:positive regulation of microtubule polymerization |
| GO:0031175 | P:cytoplasmic microtubule organization |
| GO:0032930 | P:neuron projection development |
| GO:0033044 | P:positive regulation of superoxide anion generation |
| GO:0033673 | P:regulation of chromosome organization |
| GO:0034063 | P:negative regulation of kinase activity |
| GO:0034185 | P:stress granule assembly |
| GO:0034399 | F:apolipoprotein binding |
| GO:0034452 | C:nuclear periphery |
| GO:0034605 | F:dynactin binding |
| GO:0034614 | P:cellular response to heat |
| GO:0035091 | P:cellular response to reactive oxygen species |
| GO:0036464 | F:phosphatidylinositol binding |
| GO:0036477 | C:cytoplasmic ribonucleoprotein granule |
| GO:0042802 | C:somatodendritic compartment |
| GO:0042803 | F:identical protein binding |
| GO:0043025 | F:protein homodimerization activity |
| GO:0043197 | C:neuronal cell body |
| GO:0043565 | C:dendritic spine |
| GO:0044297 | F:sequence-specific DNA binding |
| GO:0044304 | C:cell body |
| GO:0045121 | C:main axon |
| GO:0045298 | C:membrane raft |
| GO:0045773 | C:tubulin complex |
| GO:0046785 | P:positive regulation of axon extension |
| GO:0048018 | P:microtubule polymerization |
| GO:0048143 | F:receptor ligand activity |
| GO:0048167 | P:astrocyte activation |
| GO:0048312 | P:regulation of synaptic plasticity |
| GO:0048699 | P:intracellular distribution of mitochondria |
| GO:0050808 | P:generation of neurons |
| GO:0050848 | P:synapse organization |
| GO:0051087 | P:regulation of calcium-mediated signaling |
| GO:0051259 | F:chaperone binding |
| GO:0051260 | P:protein complex oligomerization |
| GO:0051721 | P:protein homooligomerization |
| GO:0051879 | F:protein phosphatase 2A binding |
| GO:0061564 | F:Hsp90 protein binding |
| GO:0070507 | P:axon development |
| GO:0071813 | P:regulation of microtubule cytoskeleton organization |
| GO:0072386 | F:lipoprotein particle binding |
| GO:0090140 | P:plus-end-directed organelle transport along microtubule |
| GO:0090258 | P:regulation of mitochondrial fission |
| GO:0097386 | P:negative regulation of mitochondrial fission |
| GO:0097418 | C:glial cell projection |
| GO:0097435 | C:neurofibrillary tangle |
| GO:0098930 | P:supramolecular fiber organization |
| GO:0099077 | P:axonal transport |
| GO:0099609 | F:histone-dependent DNA binding |
| GO:1900034 | F:microtubule lateral binding |
| GO:1900452 | P:regulation of cellular response to heat |
| GO:1901216 | P:regulation of long term synaptic depression |
| GO:1902474 | P:positive regulation of neuron death |
| GO:1902936 | P:positive regulation of protein localization to synapse |
| GO:1902988 | F:phosphatidylinositol bisphosphate binding |
| GO:1903748 | P:neurofibrillary tangle assembly |
| GO:1903829 | P:negative regulation of establishment of protein localization to mitochondrion |
| GO:1904115 | P:positive regulation of cellular protein localization |
| GO:1904428 | C:axon cytoplasm |
| GO:1905689 | P:negative regulation of tubulin deacetylation |
| GO:1990000 | P:positive regulation of diacylglycerol kinase activity |
| GO:1990090 | P:amyloid fibril formation |
| GO:1990416 | P:cellular response to nerve growth factor stimulus |
| GO:2001020 | P:cellular response to brain-derived neurotrophic factor stimulus |
MAPT is dephosphorylated by following phosphatases:
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04010 | MAPK signaling pathway | The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli. |
| hsa05010 | Alzheimer disease | Alzheimer disease (AD) is a chronic disorder that slowly destroys neurons and causes serious cognitive disability. AD is associated with senile plaques and neurofibrillary tangles (NFTs). Amyloid-beta (Abeta), a major component of senile plaques, has various pathological effects on cell and organelle function. The extracellular Abeta oligomers may activate caspases through activation of cell surface death receptors. Alternatively, intracellular Abeta may contribute to pathology by facilitating tau hyper-phosphorylation, disrupting mitochondria function, and triggering calcium dysfunction. To date genetic studies have revealed four genes that may be linked to autosomal dominant or familial early onset AD (FAD). These four genes include: amyloid precursor protein (APP), presenilin 1 (PS1), presenilin 2 (PS2) and apolipoprotein E (ApoE). All mutations associated with APP and PS proteins can lead to an increase in the production of Abeta peptides, specfically the more amyloidogenic form, Abeta42. FAD-linked PS1 mutation downregulates the unfolded protein response and leads to vulnerability to ER stress. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-264870 | Caspase-mediated cleavage of cytoskeletal proteins. | Caspase-mediated cleavage of a number of proteins in the cortical actin network ( ) microfilament system and others involved in maintenance of the cytoskeletal architecture (vimentin, or Gas2 and plectin) may directly contribute to apoptotic changes in cell shape |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABL1 | Affinity Capture-Western, Biochemical Activity | physical | 16014719, 18070606, (Europe PMC) | NA | BioGRID |
| AK2 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| AKT1 | Biochemical Activity, anti tag coimmunoprecipitation, protein kinase assay | association, phosphorylation reaction, physical, physical association | 17512525, 18292230, 19014373, (Europe PMC) | 0.44, 0.50 | BioGRID, IntAct, MINT |
| APOE | Protein-peptide, Reconstituted Complex, electrophoretic mobility-based method | direct interaction, physical, physical association | 7566652, 8620924, (Europe PMC) | 0.54 | BioGRID, IntAct |
| APP | Protein-peptide, Reconstituted Complex, comigration in sds page, confocal microscopy, enzyme linked immunosorbent assay, peptide array, protein kinase assay, surface plasmon resonance | colocalization, direct interaction, phosphorylation reaction, physical | 16446437, (Europe PMC) | 0.44, 0.62, 0.63 | BioGRID, IntAct |
| ARMC1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| BAG1 | Affinity Capture-Western, Reconstituted Complex | physical | 17954934, (Europe PMC) | NA | BioGRID |
| BAG6 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| BIN1 | Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy, pull down | colocalization, physical, physical association | 23399914, 28755476, (Europe PMC) | 0.40, 0.56 | BioGRID, IntAct |
| CALM1 | Reconstituted Complex | physical | 2123288, (Europe PMC) | NA | BioGRID |
| CAMK2A | Biochemical Activity | physical | 17512525, (Europe PMC) | NA | BioGRID |
| CAPN2 | Biochemical Activity | physical | 14993287, (Europe PMC) | NA | BioGRID |
| CDCA8 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CDK2 | Biochemical Activity | physical | 19014373, (Europe PMC) | NA | BioGRID |
| CDK5 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 12387894, 17078951, 19527721, 9353289, 9735171, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| CDK5R1 | Biochemical Activity | physical | 19527721, (Europe PMC) | NA | BioGRID |
| CKAP5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSNK1A1 | Biochemical Activity | physical | 19014373, 9771888, (Europe PMC) | NA | BioGRID |
| CSNK1D | Biochemical Activity | physical | 16618118, 17101137, (Europe PMC) | NA | BioGRID |
| CSNK2A1 | Biochemical Activity | physical | 15882073, (Europe PMC) | NA | BioGRID |
| DCTN1 | Affinity Capture-Western, Co-purification, Proximity Label-MS, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, fluorescence microscopy, proximity-dependent biotin identification, pull down, two hybrid | association, colocalization, direct interaction, physical, physical association | 17932487, 26638075, (Europe PMC) | 0.35, 0.61 | BioGRID, IntAct, MINT |
| DENR | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| DGUOK | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DNAAF2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| EGFR | PCA, Two-hybrid, ubiquitin reconstruction | physical, physical association | 24658140, 25402006, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EP300 | Biochemical Activity | physical | 20869593, (Europe PMC) | NA | BioGRID |
| EWSR1 | Proximity Label-MS | physical | 24999758, (Europe PMC) | NA | BioGRID |
| FKBP4 | Affinity Capture-Western, far western blotting | direct interaction, physical | 20133804, (Europe PMC) | 0.44 | BioGRID, IntAct |
| FYN | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, pull down, surface plasmon resonance | direct interaction, physical, physical association | 11826099, 16115884, 21692989, (Europe PMC) | 0.40, 0.44 | BioGRID, IntAct, MINT |
| GAR1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GNPNAT1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| GSK3A | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 16446437, 7931292, 9735171, (Europe PMC) | 0.44 | BioGRID, IntAct |
| GSK3B | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti tag coimmunoprecipitation, protein kinase assay, pull down | direct interaction, phosphorylation reaction, physical, physical association | 10090741, 12048243, 12387894, 14612456, 17078951, 17512525, 19014373, 19527721, 21985244, 22965877, 24165324, 9546672, 9771888, (Europe PMC) | 0.44, 0.74 | BioGRID, IntAct, MINT |
| HAX1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| HDAC6 | Affinity Capture-Western, Reconstituted Complex | physical | 18636984, (Europe PMC) | NA | BioGRID |
| HNRNPL | Affinity Capture-RNA | physical | 28611215, (Europe PMC) | NA | BioGRID |
| HSPA1A | Affinity Capture-Western, Reconstituted Complex | physical | 23271055, 23554879, (Europe PMC) | NA | BioGRID |
| HSPA4 | Affinity Capture-Western, Reconstituted Complex | physical | 14962978, 21985244, 23271055, (Europe PMC) | NA | BioGRID |
| HSPA8 | Affinity Capture-MS, Affinity Capture-Western | physical | 14612456, 17954934, 28514442, (Europe PMC) | NA | BioGRID |
| KATNA1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| LIMS1 | Affinity Capture-Western | physical | 23554879, (Europe PMC) | NA | BioGRID |
| LRRK2 | Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation, protein kinase assay, pull down | phosphorylation reaction, physical, physical association | 22303461, 24113872, (Europe PMC) | 0.40, 0.44, 0.68 | BioGRID, IntAct |
| MAPK11 | Biochemical Activity | physical | 9199504, (Europe PMC) | NA | BioGRID |
| MAPK13 | Biochemical Activity | physical | 9199504, (Europe PMC) | NA | BioGRID |
| MAPK8 | Biochemical Activity | physical | 9199504, (Europe PMC) | NA | BioGRID |
| MAPT | Reconstituted Complex, anti bait coimmunoprecipitation, atomic force microscopy, comigration in sds page, fluorescence microscopy, surface plasmon resonance, transmission electron microscopy | direct interaction, physical, physical association | 16446437, 17535890, 26436840, 9353289, (Europe PMC) | 0.44, 0.71 | BioGRID, IntAct |
| MARCH7 | Affinity Capture-Western, Biochemical Activity, Two-hybrid | physical | 24905733, (Europe PMC) | NA | BioGRID |
| MARK1 | Biochemical Activity, FRET | physical | 10090741, 23666762, 8631898, (Europe PMC) | NA | BioGRID |
| MARK2 | Biochemical Activity, Co-crystal Structure | physical | 24251416, (Europe PMC) | NA | BioGRID |
| MARK3 | FRET, proximity ligation assay | physical, physical association | 23666762, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MARK4 | Biochemical Activity, FRET, proximity ligation assay | physical, physical association | 14594945, 23666762, (Europe PMC) | 0.40 | BioGRID, IntAct |
| NME2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| NUB1 | Affinity Capture-Western | physical | 22965877, (Europe PMC) | NA | BioGRID |
| NUFIP1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| OGT | Biochemical Activity | physical | 16434389, (Europe PMC) | NA | BioGRID |
| PEG10 | FRET | physical | 23666762, (Europe PMC) | NA | BioGRID |
| PIK3R1 | Affinity Capture-Western, Reconstituted Complex | physical | 19681044, (Europe PMC) | NA | BioGRID |
| PIN1 | Affinity Capture-Western, Reconstituted Complex | physical | 10391244, 16365047, (Europe PMC) | NA | BioGRID |
| PKN1 | Biochemical Activity | physical | 11104762, (Europe PMC) | NA | BioGRID |
| PPP5C | Biochemical Activity | physical | 12435421, (Europe PMC) | NA | BioGRID |
| PRKACA | Biochemical Activity | physical | 10090741, 12435421, 19014373, 21127069, 9546672, 9771888, (Europe PMC) | NA | BioGRID |
| PRKAR1A | Biochemical Activity | physical | 19014373, (Europe PMC) | NA | BioGRID |
| PRKN | Affinity Capture-Western | physical | 14962978, 18248624, (Europe PMC) | NA | BioGRID |
| PSEN1 | Co-fractionation | physical | 9689133, (Europe PMC) | NA | BioGRID |
| PSMC2 | Affinity Capture-Western | physical | 15953362, (Europe PMC) | NA | BioGRID |
| PTK2B | Biochemical Activity | physical | 17512525, (Europe PMC) | NA | BioGRID |
| PTPA | Biochemical Activity | physical | 12435421, (Europe PMC) | NA | BioGRID |
| RPS6KA1 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| RPS6KA3 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| RPS6KA5 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| RPS6KB1 | Biochemical Activity, anti bait coimmunoprecipitation, protein kinase assay | phosphorylation reaction, physical, physical association | 16364302, 17512525, (Europe PMC) | 0.40, 0.44 | BioGRID, IntAct, MINT |
| RRP7A | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| S100B | Reconstituted Complex | physical | 11264299, 2833519, (Europe PMC) | NA | BioGRID |
| SCLT1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SGK1 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 15650334, 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| SIRT1 | Affinity Capture-Western, Reconstituted Complex | physical | 20869593, (Europe PMC) | NA | BioGRID |
| SLC1A2 | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down | association, physical | 19527721, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| SMAD2 | Affinity Capture-Western | physical | 24964035, (Europe PMC) | NA | BioGRID |
| SNCA | Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, pull down | direct interaction, physical, physical association | 10464279, 15904919, 17408955, 21127069, 21985244, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| SPICE1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SQSTM1 | Affinity Capture-Western, anti tag coimmunoprecipitation | physical, physical association | 15953362, 25686248, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SRC | Biochemical Activity, surface plasmon resonance | direct interaction, physical | 16115884, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| STUB1 | Affinity Capture-Western, Biochemical Activity, Co-purification, Protein-peptide, Reconstituted Complex | physical | 14612456, 14962978, 15447663, 16275660, 17304350, 18292230, 20466727, 23237806, 23554879, (Europe PMC) | NA | BioGRID |
| STXBP1 | Affinity Capture-Western | physical | 12963086, (Europe PMC) | NA | BioGRID |
| SYK | Affinity Capture-Western, Biochemical Activity | physical | 18070606, (Europe PMC) | NA | BioGRID |
| SYNCRIP | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TFEB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TIGD6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TRAF6 | Biochemical Activity | physical | 15953362, (Europe PMC) | NA | BioGRID |
| TUBA1A | Affinity Capture-Western | physical | 22565157, (Europe PMC) | NA | BioGRID |
| TUBA1B | Reconstituted Complex | physical | 24905733, (Europe PMC) | NA | BioGRID |
| TUBA4A | Co-crystal Structure, Reconstituted Complex | physical | 19681044, 24251416, (Europe PMC) | NA | BioGRID |
| TUBB3 | Co-crystal Structure, Reconstituted Complex | physical | 24251416, 24905733, (Europe PMC) | NA | BioGRID |
| UBASH3B | Affinity Capture-Western, Biochemical Activity | physical | 16364302, (Europe PMC) | NA | BioGRID |
| UBC | Affinity Capture-Western | physical | 1723470, (Europe PMC) | NA | BioGRID |
| UBE2D2 | Biochemical Activity | physical | 14612456, (Europe PMC) | NA | BioGRID |
| UBE2W | Co-crystal Structure | physical | 25436519, (Europe PMC) | NA | BioGRID |
| USP43 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAB | Affinity Capture-Western | physical | 10840038, 12176984, (Europe PMC) | NA | BioGRID |
| YWHAQ | Affinity Capture-Western, coimmunoprecipitation | association, physical | 15650334, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| YWHAZ | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, biochemical, coimmunoprecipitation, comigration in non denaturing gel electrophoresis, cross-linking study, molecular sieving | association, direct interaction, physical, physical association | 10840038, 15650334, 17317006, 19138662, 19647741, (Europe PMC) | 0.62, 0.72 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AK2 | anti tag coimmunoprecipitation | physical association | 26496610, (Europe PMC) | 0.40 | IntAct |
| AKT1 | Biochemical Activity, anti tag coimmunoprecipitation, protein kinase assay | association, phosphorylation reaction, physical, physical association | 17512525, 18292230, 19014373, (Europe PMC) | 0.44, 0.50 | BioGRID, IntAct, MINT |
| APOE | Protein-peptide, Reconstituted Complex, electrophoretic mobility-based method | direct interaction, physical, physical association | 7566652, 8620924, (Europe PMC) | 0.54 | BioGRID, IntAct |
| APP | Protein-peptide, Reconstituted Complex, comigration in sds page, confocal microscopy, enzyme linked immunosorbent assay, peptide array, protein kinase assay, surface plasmon resonance | colocalization, direct interaction, phosphorylation reaction, physical | 16446437, (Europe PMC) | 0.44, 0.62, 0.63 | BioGRID, IntAct |
| BAG6 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| BIN1 | Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy, pull down | colocalization, physical, physical association | 23399914, 28755476, (Europe PMC) | 0.40, 0.56 | BioGRID, IntAct |
| CDK5 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 12387894, 17078951, 19527721, 9353289, 9735171, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| CKAP5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DCTN1 | Affinity Capture-Western, Co-purification, Proximity Label-MS, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, fluorescence microscopy, proximity-dependent biotin identification, pull down, two hybrid | association, colocalization, direct interaction, physical, physical association | 17932487, 26638075, (Europe PMC) | 0.35, 0.61 | BioGRID, IntAct, MINT |
| EBI-4399559 | anti tag coimmunoprecipitation | association, physical association | 18292230, 25686248, (Europe PMC) | 0.64 | IntAct |
| EGFR | PCA, Two-hybrid, ubiquitin reconstruction | physical, physical association | 24658140, 25402006, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EZR | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| FKBP4 | Affinity Capture-Western, far western blotting | direct interaction, physical | 20133804, (Europe PMC) | 0.44 | BioGRID, IntAct |
| FYN | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, pull down, surface plasmon resonance | direct interaction, physical, physical association | 11826099, 16115884, 21692989, (Europe PMC) | 0.40, 0.44 | BioGRID, IntAct, MINT |
| GAR1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GSK3A | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 16446437, 7931292, 9735171, (Europe PMC) | 0.44 | BioGRID, IntAct |
| GSK3B | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti tag coimmunoprecipitation, protein kinase assay, pull down | direct interaction, phosphorylation reaction, physical, physical association | 10090741, 12048243, 12387894, 14612456, 17078951, 17512525, 19014373, 19527721, 21985244, 22965877, 24165324, 9546672, 9771888, (Europe PMC) | 0.44, 0.74 | BioGRID, IntAct, MINT |
| HSP90AB1 | classical fluorescence spectroscopy, nuclear magnetic resonance, x ray scattering | direct interaction | 24581495, (Europe PMC) | 0.62 | IntAct |
| HTRA1 | atomic force microscopy, cosedimentation in solution, fluorescence microscopy, isothermal titration calorimetry, protease assay, transmission electron microscopy | direct interaction, protein cleavage | 26436840, (Europe PMC) | 0.67 | IntAct |
| KATNA1 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| LRRK2 | Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation, protein kinase assay, pull down | phosphorylation reaction, physical, physical association | 22303461, 24113872, (Europe PMC) | 0.40, 0.44, 0.68 | BioGRID, IntAct |
| MAPT | Reconstituted Complex, anti bait coimmunoprecipitation, atomic force microscopy, comigration in sds page, fluorescence microscopy, surface plasmon resonance, transmission electron microscopy | direct interaction, physical, physical association | 16446437, 17535890, 26436840, 9353289, (Europe PMC) | 0.44, 0.71 | BioGRID, IntAct |
| MARK1 | proximity ligation assay | physical association | 23666762, (Europe PMC) | 0.40 | IntAct |
| MARK2 | proximity ligation assay | physical association | 23001711, 23666762, (Europe PMC) | 0.59 | IntAct |
| MARK3 | FRET, proximity ligation assay | physical, physical association | 23666762, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MARK4 | Biochemical Activity, FRET, proximity ligation assay | physical, physical association | 14594945, 23666762, (Europe PMC) | 0.40 | BioGRID, IntAct |
| P4HB | anti tag coimmunoprecipitation, confocal microscopy, isothermal titration calorimetry | colocalization, direct interaction, physical association | 24098548, (Europe PMC) | 0.44, 0.46 | IntAct |
| PASK | peptide array | phosphorylation reaction | 21418524, (Europe PMC) | 0.44 | IntAct, MINT |
| PIN1P1 | nuclear magnetic resonance | direct interaction | 16024016, (Europe PMC) | 0.44 | IntAct, MINT |
| PRNP | anti bait coimmunoprecipitation | association, physical association | 24028865, (Europe PMC) | 0.50 | IntAct |
| RPS6KA1 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| RPS6KA3 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| RPS6KA5 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| RPS6KB1 | Biochemical Activity, anti bait coimmunoprecipitation, protein kinase assay | phosphorylation reaction, physical, physical association | 16364302, 17512525, (Europe PMC) | 0.40, 0.44 | BioGRID, IntAct, MINT |
| SCLT1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SGK1 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 15650334, 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| SLC1A2 | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down | association, physical | 19527721, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| SNCA | Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, pull down | direct interaction, physical, physical association | 10464279, 15904919, 17408955, 21127069, 21985244, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| SPICE1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SQSTM1 | Affinity Capture-Western, anti tag coimmunoprecipitation | physical, physical association | 15953362, 25686248, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SRC | Biochemical Activity, surface plasmon resonance | direct interaction, physical | 16115884, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| STAU1 | imaging technique, tandem affinity purification | association, colocalization | 15121898, (Europe PMC) | 0.43 | IntAct |
| STUB1 | anti tag coimmunoprecipitation, filter binding, pull down | association, physical association | 16275660, 18292230, (Europe PMC) | 0.50, 0.52 | IntAct |
| SYNCRIP | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TFEB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TIGD6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TTLL6 | anti tag coimmunoprecipitation | physical association | 24065130, (Europe PMC) | 0.40 | IntAct, MINT |
| USP43 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAQ | Affinity Capture-Western, coimmunoprecipitation | association, physical | 15650334, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| YWHAZ | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, biochemical, coimmunoprecipitation, comigration in non denaturing gel electrophoresis, cross-linking study, molecular sieving | association, direct interaction, physical, physical association | 10840038, 15650334, 17317006, 19138662, 19647741, (Europe PMC) | 0.62, 0.72 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AKT1 | Biochemical Activity, anti tag coimmunoprecipitation, protein kinase assay | association, phosphorylation reaction, physical, physical association | 17512525, 18292230, 19014373, (Europe PMC) | 0.44, 0.50 | BioGRID, IntAct, MINT |
| CDK5 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 12387894, 17078951, 19527721, 9353289, 9735171, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| DCTN1 | Affinity Capture-Western, Co-purification, Proximity Label-MS, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, fluorescence microscopy, proximity-dependent biotin identification, pull down, two hybrid | association, colocalization, direct interaction, physical, physical association | 17932487, 26638075, (Europe PMC) | 0.35, 0.61 | BioGRID, IntAct, MINT |
| FYN | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, pull down, surface plasmon resonance | direct interaction, physical, physical association | 11826099, 16115884, 21692989, (Europe PMC) | 0.40, 0.44 | BioGRID, IntAct, MINT |
| GSK3B | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti tag coimmunoprecipitation, protein kinase assay, pull down | direct interaction, phosphorylation reaction, physical, physical association | 10090741, 12048243, 12387894, 14612456, 17078951, 17512525, 19014373, 19527721, 21985244, 22965877, 24165324, 9546672, 9771888, (Europe PMC) | 0.44, 0.74 | BioGRID, IntAct, MINT |
| PASK | peptide array | phosphorylation reaction | 21418524, (Europe PMC) | 0.44 | IntAct, MINT |
| PIN1P1 | nuclear magnetic resonance | direct interaction | 16024016, (Europe PMC) | 0.44 | IntAct, MINT |
| RPS6KA1 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| RPS6KA3 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| RPS6KA5 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| RPS6KB1 | Biochemical Activity, anti bait coimmunoprecipitation, protein kinase assay | phosphorylation reaction, physical, physical association | 16364302, 17512525, (Europe PMC) | 0.40, 0.44 | BioGRID, IntAct, MINT |
| SGK1 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 15650334, 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| SLC1A2 | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down | association, physical | 19527721, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| SNCA | Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, pull down | direct interaction, physical, physical association | 10464279, 15904919, 17408955, 21127069, 21985244, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| SRC | Biochemical Activity, surface plasmon resonance | direct interaction, physical | 16115884, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| TTLL6 | anti tag coimmunoprecipitation | physical association | 24065130, (Europe PMC) | 0.40 | IntAct, MINT |
| YWHAQ | Affinity Capture-Western, coimmunoprecipitation | association, physical | 15650334, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| YWHAZ | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, biochemical, coimmunoprecipitation, comigration in non denaturing gel electrophoresis, cross-linking study, molecular sieving | association, direct interaction, physical, physical association | 10840038, 15650334, 17317006, 19138662, 19647741, (Europe PMC) | 0.62, 0.72 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABL1 | Affinity Capture-Western, Biochemical Activity | physical | 16014719, 18070606, (Europe PMC) | NA | BioGRID |
| AK2 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| AK2 | anti tag coimmunoprecipitation | physical association | 26496610, (Europe PMC) | 0.40 | IntAct |
| AKT1 | Biochemical Activity, anti tag coimmunoprecipitation, protein kinase assay | association, phosphorylation reaction, physical, physical association | 17512525, 18292230, 19014373, (Europe PMC) | 0.44, 0.50 | BioGRID, IntAct, MINT |
| APOE | Protein-peptide, Reconstituted Complex, electrophoretic mobility-based method | direct interaction, physical, physical association | 7566652, 8620924, (Europe PMC) | 0.54 | BioGRID, IntAct |
| APP | Protein-peptide, Reconstituted Complex, comigration in sds page, confocal microscopy, enzyme linked immunosorbent assay, peptide array, protein kinase assay, surface plasmon resonance | colocalization, direct interaction, phosphorylation reaction, physical | 16446437, (Europe PMC) | 0.44, 0.62, 0.63 | BioGRID, IntAct |
| ARMC1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| BAG1 | Affinity Capture-Western, Reconstituted Complex | physical | 17954934, (Europe PMC) | NA | BioGRID |
| BAG6 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| BAG6 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| BIN1 | Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy, pull down | colocalization, physical, physical association | 23399914, 28755476, (Europe PMC) | 0.40, 0.56 | BioGRID, IntAct |
| CALM1 | Reconstituted Complex | physical | 2123288, (Europe PMC) | NA | BioGRID |
| CAMK2A | Biochemical Activity | physical | 17512525, (Europe PMC) | NA | BioGRID |
| CAPN2 | Biochemical Activity | physical | 14993287, (Europe PMC) | NA | BioGRID |
| CDCA8 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CDK2 | Biochemical Activity | physical | 19014373, (Europe PMC) | NA | BioGRID |
| CDK5 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 12387894, 17078951, 19527721, 9353289, 9735171, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| CDK5R1 | Biochemical Activity | physical | 19527721, (Europe PMC) | NA | BioGRID |
| CKAP5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSNK1A1 | Biochemical Activity | physical | 19014373, 9771888, (Europe PMC) | NA | BioGRID |
| CSNK1D | Biochemical Activity | physical | 16618118, 17101137, (Europe PMC) | NA | BioGRID |
| CSNK2A1 | Biochemical Activity | physical | 15882073, (Europe PMC) | NA | BioGRID |
| DCTN1 | Affinity Capture-Western, Co-purification, Proximity Label-MS, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, fluorescence microscopy, proximity-dependent biotin identification, pull down, two hybrid | association, colocalization, direct interaction, physical, physical association | 17932487, 26638075, (Europe PMC) | 0.35, 0.61 | BioGRID, IntAct, MINT |
| DENR | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| DGUOK | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DNAAF2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| EBI-4399559 | anti tag coimmunoprecipitation | association, physical association | 18292230, 25686248, (Europe PMC) | 0.64 | IntAct |
| EGFR | PCA, Two-hybrid, ubiquitin reconstruction | physical, physical association | 24658140, 25402006, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EP300 | Biochemical Activity | physical | 20869593, (Europe PMC) | NA | BioGRID |
| EWSR1 | Proximity Label-MS | physical | 24999758, (Europe PMC) | NA | BioGRID |
| EZR | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| FKBP4 | Affinity Capture-Western, far western blotting | direct interaction, physical | 20133804, (Europe PMC) | 0.44 | BioGRID, IntAct |
| FYN | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, pull down, surface plasmon resonance | direct interaction, physical, physical association | 11826099, 16115884, 21692989, (Europe PMC) | 0.40, 0.44 | BioGRID, IntAct, MINT |
| GAR1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GNPNAT1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| GSK3A | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 16446437, 7931292, 9735171, (Europe PMC) | 0.44 | BioGRID, IntAct |
| GSK3B | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti tag coimmunoprecipitation, protein kinase assay, pull down | direct interaction, phosphorylation reaction, physical, physical association | 10090741, 12048243, 12387894, 14612456, 17078951, 17512525, 19014373, 19527721, 21985244, 22965877, 24165324, 9546672, 9771888, (Europe PMC) | 0.44, 0.74 | BioGRID, IntAct, MINT |
| HAX1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| HDAC6 | Affinity Capture-Western, Reconstituted Complex | physical | 18636984, (Europe PMC) | NA | BioGRID |
| HNRNPL | Affinity Capture-RNA | physical | 28611215, (Europe PMC) | NA | BioGRID |
| HSP90AB1 | classical fluorescence spectroscopy, nuclear magnetic resonance, x ray scattering | direct interaction | 24581495, (Europe PMC) | 0.62 | IntAct |
| HSPA1A | Affinity Capture-Western, Reconstituted Complex | physical | 23271055, 23554879, (Europe PMC) | NA | BioGRID |
| HSPA4 | Affinity Capture-Western, Reconstituted Complex | physical | 14962978, 21985244, 23271055, (Europe PMC) | NA | BioGRID |
| HSPA8 | Affinity Capture-MS, Affinity Capture-Western | physical | 14612456, 17954934, 28514442, (Europe PMC) | NA | BioGRID |
| HTRA1 | atomic force microscopy, cosedimentation in solution, fluorescence microscopy, isothermal titration calorimetry, protease assay, transmission electron microscopy | direct interaction, protein cleavage | 26436840, (Europe PMC) | 0.67 | IntAct |
| KATNA1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| KATNA1 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| LIMS1 | Affinity Capture-Western | physical | 23554879, (Europe PMC) | NA | BioGRID |
| LRRK2 | Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation, protein kinase assay, pull down | phosphorylation reaction, physical, physical association | 22303461, 24113872, (Europe PMC) | 0.40, 0.44, 0.68 | BioGRID, IntAct |
| MAPK11 | Biochemical Activity | physical | 9199504, (Europe PMC) | NA | BioGRID |
| MAPK13 | Biochemical Activity | physical | 9199504, (Europe PMC) | NA | BioGRID |
| MAPK8 | Biochemical Activity | physical | 9199504, (Europe PMC) | NA | BioGRID |
| MAPT | Reconstituted Complex, anti bait coimmunoprecipitation, atomic force microscopy, comigration in sds page, fluorescence microscopy, surface plasmon resonance, transmission electron microscopy | direct interaction, physical, physical association | 16446437, 17535890, 26436840, 9353289, (Europe PMC) | 0.44, 0.71 | BioGRID, IntAct |
| MARCH7 | Affinity Capture-Western, Biochemical Activity, Two-hybrid | physical | 24905733, (Europe PMC) | NA | BioGRID |
| MARK1 | Biochemical Activity, FRET | physical | 10090741, 23666762, 8631898, (Europe PMC) | NA | BioGRID |
| MARK1 | proximity ligation assay | physical association | 23666762, (Europe PMC) | 0.40 | IntAct |
| MARK2 | Biochemical Activity, Co-crystal Structure | physical | 24251416, (Europe PMC) | NA | BioGRID |
| MARK2 | proximity ligation assay | physical association | 23001711, 23666762, (Europe PMC) | 0.59 | IntAct |
| MARK3 | FRET, proximity ligation assay | physical, physical association | 23666762, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MARK4 | Biochemical Activity, FRET, proximity ligation assay | physical, physical association | 14594945, 23666762, (Europe PMC) | 0.40 | BioGRID, IntAct |
| NME2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| NUB1 | Affinity Capture-Western | physical | 22965877, (Europe PMC) | NA | BioGRID |
| NUFIP1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| OGT | Biochemical Activity | physical | 16434389, (Europe PMC) | NA | BioGRID |
| P4HB | anti tag coimmunoprecipitation, confocal microscopy, isothermal titration calorimetry | colocalization, direct interaction, physical association | 24098548, (Europe PMC) | 0.44, 0.46 | IntAct |
| PASK | peptide array | phosphorylation reaction | 21418524, (Europe PMC) | 0.44 | IntAct, MINT |
| PEG10 | FRET | physical | 23666762, (Europe PMC) | NA | BioGRID |
| PIK3R1 | Affinity Capture-Western, Reconstituted Complex | physical | 19681044, (Europe PMC) | NA | BioGRID |
| PIN1 | Affinity Capture-Western, Reconstituted Complex | physical | 10391244, 16365047, (Europe PMC) | NA | BioGRID |
| PIN1P1 | nuclear magnetic resonance | direct interaction | 16024016, (Europe PMC) | 0.44 | IntAct, MINT |
| PKN1 | Biochemical Activity | physical | 11104762, (Europe PMC) | NA | BioGRID |
| PPP5C | Biochemical Activity | physical | 12435421, (Europe PMC) | NA | BioGRID |
| PRKACA | Biochemical Activity | physical | 10090741, 12435421, 19014373, 21127069, 9546672, 9771888, (Europe PMC) | NA | BioGRID |
| PRKAR1A | Biochemical Activity | physical | 19014373, (Europe PMC) | NA | BioGRID |
| PRKN | Affinity Capture-Western | physical | 14962978, 18248624, (Europe PMC) | NA | BioGRID |
| PRNP | anti bait coimmunoprecipitation | association, physical association | 24028865, (Europe PMC) | 0.50 | IntAct |
| PSEN1 | Co-fractionation | physical | 9689133, (Europe PMC) | NA | BioGRID |
| PSMC2 | Affinity Capture-Western | physical | 15953362, (Europe PMC) | NA | BioGRID |
| PTK2B | Biochemical Activity | physical | 17512525, (Europe PMC) | NA | BioGRID |
| PTPA | Biochemical Activity | physical | 12435421, (Europe PMC) | NA | BioGRID |
| RPS6KA1 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| RPS6KA3 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| RPS6KA5 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| RPS6KB1 | Biochemical Activity, anti bait coimmunoprecipitation, protein kinase assay | phosphorylation reaction, physical, physical association | 16364302, 17512525, (Europe PMC) | 0.40, 0.44 | BioGRID, IntAct, MINT |
| RRP7A | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| S100B | Reconstituted Complex | physical | 11264299, 2833519, (Europe PMC) | NA | BioGRID |
| SCLT1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SGK1 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 15650334, 17512525, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| SIRT1 | Affinity Capture-Western, Reconstituted Complex | physical | 20869593, (Europe PMC) | NA | BioGRID |
| SLC1A2 | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down | association, physical | 19527721, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| SMAD2 | Affinity Capture-Western | physical | 24964035, (Europe PMC) | NA | BioGRID |
| SNCA | Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, pull down | direct interaction, physical, physical association | 10464279, 15904919, 17408955, 21127069, 21985244, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| SPICE1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SQSTM1 | Affinity Capture-Western, anti tag coimmunoprecipitation | physical, physical association | 15953362, 25686248, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SRC | Biochemical Activity, surface plasmon resonance | direct interaction, physical | 16115884, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| STAU1 | imaging technique, tandem affinity purification | association, colocalization | 15121898, (Europe PMC) | 0.43 | IntAct |
| STUB1 | Affinity Capture-Western, Biochemical Activity, Co-purification, Protein-peptide, Reconstituted Complex | physical | 14612456, 14962978, 15447663, 16275660, 17304350, 18292230, 20466727, 23237806, 23554879, (Europe PMC) | NA | BioGRID |
| STUB1 | anti tag coimmunoprecipitation, filter binding, pull down | association, physical association | 16275660, 18292230, (Europe PMC) | 0.50, 0.52 | IntAct |
| STXBP1 | Affinity Capture-Western | physical | 12963086, (Europe PMC) | NA | BioGRID |
| SYK | Affinity Capture-Western, Biochemical Activity | physical | 18070606, (Europe PMC) | NA | BioGRID |
| SYNCRIP | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TFEB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TIGD6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TRAF6 | Biochemical Activity | physical | 15953362, (Europe PMC) | NA | BioGRID |
| TTLL6 | anti tag coimmunoprecipitation | physical association | 24065130, (Europe PMC) | 0.40 | IntAct, MINT |
| TUBA1A | Affinity Capture-Western | physical | 22565157, (Europe PMC) | NA | BioGRID |
| TUBA1B | Reconstituted Complex | physical | 24905733, (Europe PMC) | NA | BioGRID |
| TUBA4A | Co-crystal Structure, Reconstituted Complex | physical | 19681044, 24251416, (Europe PMC) | NA | BioGRID |
| TUBB3 | Co-crystal Structure, Reconstituted Complex | physical | 24251416, 24905733, (Europe PMC) | NA | BioGRID |
| UBASH3B | Affinity Capture-Western, Biochemical Activity | physical | 16364302, (Europe PMC) | NA | BioGRID |
| UBC | Affinity Capture-Western | physical | 1723470, (Europe PMC) | NA | BioGRID |
| UBE2D2 | Biochemical Activity | physical | 14612456, (Europe PMC) | NA | BioGRID |
| UBE2W | Co-crystal Structure | physical | 25436519, (Europe PMC) | NA | BioGRID |
| USP43 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAB | Affinity Capture-Western | physical | 10840038, 12176984, (Europe PMC) | NA | BioGRID |
| YWHAQ | Affinity Capture-Western, coimmunoprecipitation | association, physical | 15650334, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| YWHAZ | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, biochemical, coimmunoprecipitation, comigration in non denaturing gel electrophoresis, cross-linking study, molecular sieving | association, direct interaction, physical, physical association | 10840038, 15650334, 17317006, 19138662, 19647741, (Europe PMC) | 0.62, 0.72 | BioGRID, IntAct, MINT |