Top
ESR1
Localization (UniProt annotation) Isoform 1: Nucleus Cytoplasm Cell membrane Note=A minor fraction is associatedwith the inner membrane Isoform 3: Nucleus Cytoplasm Cellmembrane; Peripheral membrane protein; Cytoplasmic side Cellmembrane; Single-pass type I membrane protein Note=Associatedwith the inner membrane via palmitoylation (Probable) At least asubset exists as a transmembrane protein with a N-terminalextracellular domain Nucleus Golgi apparatus Cell membraneNote=Colocalizes with ZDHHC7 and ZDHHC21 in the Golgi apparatuswhere most probably palmitoylation occurs Associated with theplasma membrane when palmitoylated Function (UniProt annotation) Nuclear hormone receptor The steroid hormones and theirreceptors are involved in the regulation of eukaryotic geneexpression and affect cellular proliferation and differentiationin target tissues Ligand-dependent nuclear transactivationinvolves either direct homodimer binding to a palindromic estrogenresponse element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2,Sp1 and Sp3, to mediate ERE-independent signaling Ligand bindinginduces a conformational change allowing subsequent orcombinatorial association with multiprotein coactivator complexesthrough LXXLL motifs of their respective components Mutualtransrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcriptionfrom the IL6 promoter and displace RELA/p65 and associatedcoregulators from the promoter Recruited to the NF-kappa-Bresponse element of the CCL2 and IL8 promoters and can displaceCREBBP Present with NF-kappa-B components RELA/p65 and NFKB1/p50on ERE sequences Can also act synergistically with NF-kappa-B toactivate transcription involving respective recruitment adjacentresponse elements; the function involves CREBBP Can activate thetranscriptional activity of TFF1 Also mediates membrane-initiatedestrogen signaling involving various kinase cascades Isoform 3 isinvolved in activation of NOS3 and endothelial nitric oxideproduction Isoforms lacking one or several functional domains arethought to modulate transcriptional activity by competitive ligandor DNA binding and/or heterodimerization with the full-lengthreceptor Essential for MTA1-mediated transcriptional regulationof BRCA1 and BCAS3 Isoform 3 can bind to ERE and inhibit isoform1 Catalytic Activity (UniProt annotation) N/A Protein Sequence MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPY
GPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQG
GRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALL
DAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPG
KLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASV
EETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
ELM Motif Motif Instance
Description Motif Regex NA NA NA NA
ESR1 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa01522 Endocrine resistance Endocrine therapy is a key treatment strategy to control or eradicate hormone-responsive breast cancer. The most commonly used endocrine therapy agents are selective estrogen receptor modulators (SERMs, e.g. tamoxifen), estrogen synthesis inhibitors (e.g. aromatase inhibitors (AIs) such as anastrozole, letrozole, and exemestane), and selective estrogen receptor down-regulators (SERDs, e.g. fulvestrant). However, resistance to these agents has become a major clinical obstacle. Mechanisms of endocrine resistance include loss of ER-alpha expression, altered expression of coactivators or coregulators that play a critical role in ER-mediated gene transcription, ligand-independent growth factor signaling cascades that activate kinases and ER-phosphorylation, altered availability of active tamoxifen metabolites regulated by drug-metabolizing enzymes, such as CYP2D6, and deregulation of the cell cycle and apoptotic machinery. hsa04915 Estrogen signaling pathway Estrogens are steroid hormones that regulate a plethora of physiological processes in mammals, including reproduction, cardiovascular protection, bone integrity, cellular homeostasis, and behavior. Estrogen mediates its cellular actions through two signaling pathways classified as nuclear-initiated steroid signalingand membrane-initiated steroid signaling. In the nuclearpathway, estrogen binds either ERalpha or ERbeta, which in turn translocates to the nucleus, binds DNA at ERE elements and activates the expression of ERE-dependent genes. In membranepathway, Estrogen can exert its actions through a subpopulation of ER at the plasma membrane (mER) or novel G-protein coupled E2 receptors (GPER). Upon activation of these receptors various signaling pathways (i.e. Ca2+, cAMP, protein kinase cascades) are rapidly activated and ultimately influence downstream transcription factors. hsa04917 Prolactin signaling pathway Prolactin (PRL) is a polypeptide hormone known to be involved in a wide range of biological functions including osmoregulation, lactation, reproduction, growth and development, endocrinology and metabolism, brain and behavior, and immunomodulation. PRL mediates its action through PRLR, a transmembrane protein of the hematopoietin cytokine receptor superfamily. At the protein level, the long PRLR isoform (long-R) and several short PRLR isoforms (short-R) have been detected. Acting through the long-R, PRL activates many signaling cascades including Jak2/Stat, the major cascade, Src kinase, phosphatidylinositol-3-kinase (PI3K)/AKT, and mitogen-activated protein kinase (MAPK) pathways. PRL cannot activate Jak2/Stat5 through the short-R, but can activate pathways including MAPK and PI3K pathways. hsa04919 Thyroid hormone signaling pathway The thyroid hormones (THs) are important regulators of growth, development and metabolism. The action of TH is mainly mediated by T3 (3,5,3'-triiodo-L-thyronine). Thyroid hormones, L-thyroxine (T4) and T3 enter the cell through transporter proteins. Although the major form of TH in the blood is T4, it is converted to the more active hormone T3 within cells. T3 binds to nuclear thyroid hormone receptors (TRs), which functions as a ligand-dependent transcription factor and controls the expression of target genes (genomic action). Nongenomic mechanisms of action is initiated at the integrin receptor. The plasma membrane alpha(v)beta(3)-integrin has distinct binding sites for T3 and T4. One binding site binds only T3 and activates the phosphatidylinositol 3-kinase (PI3K) pathway. The other binding site binds both T3 and T4 and activates the ERK1/2 MAP kinase pathway. hsa04961 Endocrine and other factor-regulated calcium reabsorption Calcium (Ca2+) is essential for numerous physiological functions including intracellular signalling processes, neuronal excitability, muscle contraction and bone formation. Therefore, its homeostasis is finely maintained through the coordination of intestinal absorption, renal reabsorption, and bone resorption. In kidney, the late part of the distal convoluted tubule (DCT) and the connecting tubule (CNT) are the site of active Ca2+ transport and precisely regulate Ca2+ reabsorption. Following Ca2+ entry through TRPV5, Ca2+ bound to calbindin-D28K diffuses to the basolateral side, where it is extruded into the blood compartment through NCX1 and to a lesser extent PMCA1b. In the urinary compartment, both klotho and tissue kallikrein (TK) increase the apical abundance of TRPV5. In the blood compartment, PTH, 1,25(OH)2D3 and estrogen increase the transcription and protein expression of the luminal Ca2+ channels, calbindins, and the extrusion systems. hsa05200 Pathways in cancer hsa05205 Proteoglycans in cancer Many proteoglycans (PGs) in the tumor microenvironment have been shown to be key macromolecules that contribute to biology of various types of cancer including proliferation, adhesion, angiogenesis and metastasis, affecting tumor progress. The four main types of proteoglycans include hyaluronan (HA), which does not occur as a PG but in free form, heparan sulfate proteoglycans (HSPGs), chondroitin sulfate proteoglycans (CSPGs), dematan sulfate proteoglycans (DSPG) and keratan sulfate proteoglycans (KSPGs) [BR:00535]. Among these proteoglycans such as HA, acting with CD44, promotes tumor cell growth and migration, whereas other proteoglycans such as syndecans (-1~-4), glypican (-1, -3) and perlecan may interact with growth factors, cytokines, morphogens and enzymes through HS chains [BR: 00536], also leading to tumor growth and invasion. In contrast, some of the small leucine-rich proteolgycans, such as decorin and lumican, can function as tumor repressors, and modulate the signaling pathways by the interaction of their core proteins and multiple receptors. hsa05224 Breast cancer Breast cancer is the leading cause of cancer death among women worldwide. The vast majority of breast cancers are carcinomas that originate from cells lining the milk-forming ducts of the mammary gland. The molecular subtypes of breast cancer, which are based on the presence or absence of hormone receptors (estrogen and progesterone subtypes) and human epidermal growth factor receptor-2 (HER2), include: hormone receptor positive and HER2 negative (luminal A subtype), hormone receptor positive and HER2 positive (luminal B subtype), hormone receptor negative and HER2 positive (HER2 positive), and hormone receptor negative and HER2 negative (basal-like or triple-negative breast cancers (TNBCs)). Hormone receptor positive breast cancers are largely driven by the estrogen/ER pathway. In HER2 positive breast tumours, HER2 activates the PI3K/AKT and the RAS/RAF/MAPK pathways, and stimulate cell growth, survival and differentiation. In patients suffering from TNBC, the deregulation of various signalling pathways (Notch and Wnt/beta-catenin), EGFR protein have been confirmed. In the case of breast cancer only 8% of all cancers are hereditary, a phenomenon linked to genetic changes in BRCA1 or BRCA2. Somatic mutations in only three genes (TP53, PIK3CA and GATA3) occurred at >10% incidence across all breast cancers.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-1251985 Nuclear signaling by ERBB4. Besides signaling as a transmembrane receptor, ligand activated homodimers of ERBB4 JM-A isoforms (ERBB4 JM-A CYT1 and ERBB4 JM-A CYT2) undergo proteolytic cleavage by ADAM17 (TACE) in the juxtamembrane region, resulting in shedding of the extracellular domain and formation of an 80 kDa membrane bound ERBB4 fragment known as ERBB4 m80 (Rio et al. 2000, Cheng et al. 2003). ERBB4 m80 undergoes further proteolytic cleavage, mediated by the gamma-secretase complex, which releases the soluble 80 kDa ERBB4 intracellular domain, known as ERBB4 s80 or E4ICD, into the cytosol (Ni et al. 2001). ERBB4 s80 is able to translocate to the nucleus, promote nuclear translocation of various transcription factors, and act as a transcription co-factor. In neuronal precursors, ERBB4 s80 binds the complex of TAB and NCOR1, helps to move the complex into the nucleus, and is a co-factor of TAB:NCOR1-mediated inhibition of expression of astrocyte differentiation genes GFAP and S100B (Sardi et al. 2006). In mammary cells, ERBB4 s80 recruits STAT5A transcription factor in the cytosol, shuttles it to the nucleus, and acts as the STAT5A co-factor in binding to and promoting transcription from the beta-casein (CSN2) promoter, and may be involved in the regulation of other lactation-related genes (Williams et al. 2004, Muraoka-Cook et al. 2008). ERBB4 s80 was also shown to bind activated estrogen receptor in the nucleus and act as its transcriptional co-factor in promoting transcription of some estrogen-regulated genes, such as progesterone receptor gene NR3C3 and CXCL12 i.e. SDF1 (Zhu et al. 2006). ERBB4s80 may inhibit transcription of telomerase reverse transcriptase (TERT) by increasing methylation of the TERT gene promoter through an unknown mechanism (Ishibashi et al. 2012).The C-tail of ERBB4 possesses several WW-domain binding motifs (three in CYT1 isoform and two in CYT2 isoform), which enable interaction of ERBB4 with WW-domain containing proteins. ERBB4 s80, through WW-domain binding motifs, interacts with YAP1 transcription factor, a known proto-oncogene, and may be a co-regulator of YAP1-mediated transcription (Komuro et al. 2003, Omerovic et al. 2004). The tumor suppressor WWOX, another WW-domain containing protein, competes with YAP1 in binding to ERBB4 s80 and prevents translocation of ERBB4 s80 to the nucleus (Aqeilan et al. 2005). ERBB4 s80 is also able to translocate to the mitochondrial matrix, presumably when its nuclear translocation is inhibited. Once in the mitochondrion, the BH3 domain of ERBB4, characteristic of BCL2 family members, may enable it to act as a pro-apoptotic factor (Naresh et al. 2006) R-HSA-1257604 PIP3 activates AKT signaling. Signaling by AKT is one of the key outcomes of receptor tyrosine kinase (RTK) activation. AKT is activated by the cellular second messenger PIP3, a phospholipid that is generated by PI3K. In ustimulated cells, PI3K class IA enzymes reside in the cytosol as inactive heterodimers composed of p85 regulatory subunit and p110 catalytic subunit. In this complex, p85 stabilizes p110 while inhibiting its catalytic activity. Upon binding of extracellular ligands to RTKs, receptors dimerize and undergo autophosphorylation. The regulatory subunit of PI3K, p85, is recruited to phosphorylated cytosolic RTK domains either directly or indirectly, through adaptor proteins, leading to a conformational change in the PI3K IA heterodimer that relieves inhibition of the p110 catalytic subunit. Activated PI3K IA phosphorylates PIP2, converting it to PIP3; this reaction is negatively regulated by PTEN phosphatase. PIP3 recruits AKT to the plasma membrane, allowing TORC2 to phosphorylate a conserved serine residue of AKT. Phosphorylation of this serine induces a conformation change in AKT, exposing a conserved threonine residue that is then phosphorylated by PDPK1 (PDK1). Phosphorylation of both the threonine and the serine residue is required to fully activate AKT. The active AKT then dissociates from PIP3 and phosphorylates a number of cytosolic and nuclear proteins that play important roles in cell survival and metabolism. For a recent review of AKT signaling, please refer to Manning and Cantley, 2007 R-HSA-2219530 Constitutive Signaling by Aberrant PI3K in Cancer. Signaling by PI3K/AKT is frequently constitutively activated in cancer via gain-of-function mutations in one of the two PI3K subunits - PI3KCA (encoding the catalytic subunit p110alpha) or PIK3R1 (encoding the regulatory subunit p85alpha). Gain-of-function mutations activate PI3K signaling by diverse mechanisms. Mutations affecting the helical domain of PIK3CA and mutations affecting nSH2 and iSH2 domains of PIK3R1 impair inhibitory interactions between these two subunits while preserving their association. Mutations in the catalytic domain of PIK3CA enable the kinase to achieve an active conformation. PI3K complexes with gain-of-function mutations therefore produce PIP3 and activate downstream AKT in the absence of growth factors (Huang et al. 2007, Zhao et al. 2005, Miled et al. 2007, Horn et al. 2008, Sun et al. 2010, Jaiswal et al. 2009, Zhao and Vogt 2010, Urick et al. 2011) R-HSA-383280 Nuclear Receptor transcription pathway. A classic example of bifunctional transcription factors is the family of Nuclear Receptor (NR) proteins. These are DNA-binding transcription factors that bind certain hormones, vitamins, and other small, diffusible signaling molecules. The non-liganded NRs recruit specific corepressor complexes of the NCOR/SMRT type, to mediate transcriptional repression of the target genes to which they are bound. During signaling, ligand binding to a specific domain the NR proteins induces a conformational change that results in the exchange of the associated CoR complex, and its replacement by a specific coactivator complex of the TRAP / DRIP / Mediator type. These coactivator complexes typically nucleate around a MED1 coactivator protein that is directly bound to the NR transcription factor.A general feature of the 49 human NR proteins is that in the unliganded state, they each bind directly to an NCOR corepressor protein, either NCOR1 or NCOR2 (NCOR2 was previously named \SMRT\). This NCOR protein nucleates the assembly of additional, specific corepressor proteins, depending on the cell and DNA context. The NR-NCOR interaction is mediated by a specific protein interaction domain (PID) present in the NRs that binds to specific cognate PID(s) present in the NCOR proteins. Thus, the human NRs each take part in an NR-NCOR binding reaction in the absence of binding by their ligand.
A second general feature of the NR proteins is that they each contain an additional, but different PID that mediates specific binding interactions with MED1 proteins. In the ligand-bound state, NRs each take part in an NR-MED1 binding reaction to form an NR-MED1 complex. The bound MED1 then functions to nucleate the assembly of additional specific coactivator proteins, depending on the cell and DNA context, such as what specific target gene promoter they are bound to, and in what cell type.
The formation of specific MED1-containing coactivator complexes on specific NR proteins has been well-characterized for a number of the human NR proteins (see Table 1 in (Bourbon, 2004)). For example, binding of thyroid hormone (TH) to the human TH Receptor (THRA or THRB) was found to result in the recruitment of a specific complex of Thyroid Receptor Associated Proteins - the TRAP coactivator complex - of which the TRAP220 subunit was later identified to be the Mediator 1 (MED1) homologue.
Similarly, binding of Vitamin D to the human Vitamin D3 Receptor was found to result in the recruitment of a specific complex of D Receptor Interacting Proteins - the DRIP coactivator complex, of which the DRIP205 subunit was later identified to be human MED1
R-HSA-4090294 SUMOylation of intracellular receptors. At least 17 nuclear receptors have been discovered to be SUMOylated (reviewed in Treuter and Venteclef 2011, Wadosky et al. 2012, Knutson and Lange 2013). In all but a few cases (notably AR and RORA) SUMOylation causes transcriptional repression. Repression by SUMOylation is believed to occur through several mechanisms: interference with DNA binding, recruitment of corepressors, retention of corepressors at non-target promoters (transrepression), re-localization of nuclear receptors within the nucleus, interference with dimerization of receptors, and interference (crosstalk) with other post-translational modifications. SUMOylation of receptors affects inflammation and disease processes (Anbalagan et al. 2012) R-HSA-5689896 Ovarian tumor domain proteases. Humans have 16 Overian tumour domain (OTU) family DUBs that can be evolutionally divided into three classes, the OTUs, the Otubains (OTUBs), and the A20-like OTUs (Komander et al. 2009). OTU family DUBs can be highly selective in the type of ubiquitin crosslinks they cleave. OTUB1 is specific for K48-linked chains, whereas OTUB2 can cleave K11, K63 and K48-linked poly-Ub (Wang et al. 2009, Edelmann et al. 2009, Mevissen et al. 2013). A20 prefers K48-linked chains, Cezanne is specific for K11-linked chains, and TRABID acts on both K29, K33 and K63-linked poly-Ub (Licchesi et al. 2011, Komander & Barford 2008, Bremm et al. 2010, Mevissen et al. 2013). The active site of the OTU domain contains an unusual loop not seen in other thiol-DUBs and can lack an obvious catalytic Asp/Asn (Komander & Barford 2009, Messick et al. 2008, Lin et al. 2008). A20 and OTUB1 have an unusual mode of activity, binding directly to E2 enzymes (Nakada et al. 2010, Wertz et al. 2004) R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling. Phosphatidylinositol-5-phosphate (PI5P) may modulate PI3K/AKT signaling in several ways. PI5P is used as a substrate for production of phosphatidylinositol-4,5-bisphosphate, PI(4,5)P2 (Rameh et al. 1997, Clarke et al. 2008, Clarke et al. 2010, Clarke and Irvine 2013, Clarke et al. 2015), which serves as a substrate for activated PI3K, resulting in the production of PIP3 (Mandelker et al. 2009, Burke et al. 2011). The majority of PI(4,5)P2 in the cell, however, is produced from the phosphatidylinositol-4-phosphate (PI4P) substrate (Zhang et al. 1997, Di Paolo et al. 2002, Oude Weernink et al. 2004, Halstead et al. 2006, Oude Weernink et al. 2007). PIP3 is necessary for the activating phosphorylation of AKT. AKT1 can be deactivated by the protein phosphatase 2A (PP2A) complex that contains a regulatory subunit B56-beta (PPP2R5B) or B56-gamma (PPP2R5C). PI5P inhibits AKT1 dephosphorylation by PP2A through an unknown mechanism (Ramel et al. 2009). Increased PI5P levels correlate with inhibitory phosphorylation(s) of the PP2A complex. MAPK1 (ERK2) and MAPK3 (ERK1) are involved in inhibitory phosphorylation of PP2A, in a process that involves IER3 (IEX-1) (Letourneux et al. 2006, Rocher et al. 2007). It is uncertain, however, whether PI5P is in any way involved in ERK-mediated phosphorylation of PP2A or if it regulates another PP2A kinase R-HSA-8866910 TFAP2 (AP-2) family regulates transcription of growth factors and their receptors. TFAP2A and TFAP2C directly stimulate transcription of the estrogen receptor ESR1 gene (McPherson and Weigel 1999). TFAP2A expression correlates with ESR1 expression in breast cancer, and TFAP2C is frequently overexpressed in estrogen-positive breast cancer and endometrial cancer (deConinck et al. 1995, Turner et al. 1998). TFAP2A, TFAP2C, as well as TFAP2B can directly stimulate the expression of ERBB2, another important breast cancer gene (Bosher et al. 1996). Association of TFAP2A with the YY1 transcription factor significantly increases the ERBB2 transcription rate (Begon et al. 2005). In addition to ERBB2, the expression of another receptor tyrosine kinase, KIT, is also stimulated by TFAP2A and TFAP2B (Huang et al. 1998), while the expression of the VEGF receptor tyrosine kinase ligand VEGFA is repressed by TFAP2A (Ruiz et al. 2004, Li et al. 2012). TFAP2A stimulates transcription of the transforming growth factor alpha (TGFA) gene (Wang et al. 1997). TFAP2C regulates EGFR expression in luminal breast cancer (De Andrade et al. 2016). In placenta, TFAP2A and TFAP2C directly stimulate transcription of both subunits of the human chorionic gonadotropin, CGA and CGB (Johnson et al. 1997, LiCalsi et al. 2000) R-HSA-8931987 RUNX1 regulates estrogen receptor mediated transcription. The RUNX1:CBFB complex can associate with the activated estrogen receptor alpha (ESR1) through direct interaction between RUNX1 and ESR1. The RUNX1:CBFB complex is thus involved in transcriptional regulation of estrogen responsive genes, including GPAM, KCTD6 and AXIN1 (Stender et al. 2010). High GPAM expression correlates with better overall survival in breast cancer (Brockmoller et al. 2012) R-HSA-8939211 ESR-mediated signaling. Estrogens are a class of hormones that play a role in physiological processes such as development, reproduction, metabolism of liver, fat and bone, and neuronal and cardiovascular function (reviewed in Arnal et al, 2017; Haldosen et al, 2014). Estrogens bind estrogen receptors, members of the nuclear receptor superfamily. Ligand-bound estrogen receptors act as nuclear transcription factors to regulate expression of genes that control cellular proliferation and differentiation, among other processes (reviewed in Hah et al, 2014) R-HSA-8939256 RUNX1 regulates transcription of genes involved in WNT signaling. The RUNX1:CBFB complex directly regulates transcription of at least two components of WNT signaling. In association with its co-factor FOXP3, the RUNX1:CBFB complex stimulates transcription of the RSPO3 gene, encoding a WNT ligand that is implicated as a breast cancer oncogene (Recouvreux et al. 2016). In association with the activated estrogen receptor alpha (ESR1), the RUNX1:CBFB complex stimulates the expression of AXIN1, which functions as a regulator of WNT signaling (Stender et al. 2010) R-HSA-8939902 Regulation of RUNX2 expression and activity. Several transcription factors have been implicated in regulation of the RUNX2 gene transcription. Similar to the RUNX1 gene, the RUNX2 gene expression can be regulated from the proximal P2 promoter or the distal P1 promoter (reviewed in Li and Xiao 2007).Activated estrogen receptor alpha (ESR1) binds estrogen response elements (EREs) in the P2 promoter and stimulates RUNX2 transcription (Kammerer et al. 2013). Estrogen-related receptor alpha (ERRA) binds EREs or estrogen-related response elements (ERREs) in the P2 promoter of RUNX2. When ERRA is bound to its co-factor PPARG1CA (PGC1A), it stimulates RUNX2 transcription. When bound to its co-factor PPARG1CB (PGC1B), ERRA represses RUNX2 transcription (Kammerer et al. 2013).TWIST1, a basic helix-loop-helix (bHLH) transcription factor, stimulates RUNX2 transcription by binding to the E1-box in the P2 promoter (Yang, Yang et al. 2011). TWIST proteins also interact with the DNA-binding domain of RUNX2 to modulate its activity during skeletogenesis (Bialek et al. 2004). Schnurri-3 (SHN3) is another protein that interacts with RUNX2 to decrease its availability in the nucleus and therefore its activity (Jones et al. 2006). In contrast, RUNX2 and SATB2 interact to enhance the expression of osteoblast-specific genes (Dobreva et al. 2006). Formation of the heterodimer with CBFB (CBF-beta) also enhances the transcriptional activity of RUNX2 (Kundu et al. 2002, Yoshida et al. 2002, Otto et al. 2002).Transcription of RUNX2 from the proximal promoter is inhibited by binding of the glucocorticoid receptor (NR3C1) activated by dexamethasone (DEXA) to a glucocorticoid receptor response element (GRE), which is also present in the human promoter (Zhang et al. 2012).NKX3-2 (BAPX1), required for embryonic development of the axial skeleton (Tribioli and Lufkin 1999), binds the distal (P1) promoter of the RUNX2 gene and inhibits its transcription (Lengner et al. 2005). RUNX2-P1 transcription is also autoinhibited by RUNX2-P1, which binds to RUNX2 response elements in the P1 promoter of RUNX2 (Drissi et al. 2000). In contrast, binding of RUNX2-P2 to the proximal P2 promoter autoactivates transcription of RUNX2-P2 (Ducy et al. 1999). Binding of a homeodomain transcription factor DLX5, and possibly DLX6, to the RUNX2 P1 promoter stimulates RUNX2 transcription (Robledo et al. 2002, Lee et al. 2005). The homeobox transcription factor MSX2 can bind to DLX5 sites in the promoter of RUNX2 and inhibit transcription of RUNX2-P1 (Lee et al. 2005).Translocation of RUNX2 protein to the nucleus is inhibited by binding to non-activated STAT1 (Kim et al. 2003).Several E3 ubiquitin ligases were shown to polyubiquitinate RUNX2, targeting it for proteasome-mediated degradation: FBXW7a (Kumar et al. 2015), STUB1 (CHIP) (Li et al. 2008), SMURF1 (Zhao et al. 2003, Yang et al. 2014), WWP1 (Jones et al. 2006), and SKP2 (Thacker et al. 2016) R-HSA-9018519 Estrogen-dependent gene expression. Estrogens mediate their transcriptional effects through interaction with the estrogen receptors, ESR1 (also known as ER alpha) and ESR2 (ER beta). ESR1 and ESR2 share overlapping but distinct functions, with ESR1 playing the primary role in transcriptional activation in most cell types (Hah and Krauss, 2014; Haldosén et al, 2014. The receptors function as ligand-dependent dimers and can activate target genes either through direct binding to an estrogen responsive element (ERE) in the target gene promoter, or indirectly through interaction with another DNA-binding protein such as RUNX1, SP1, AP1 or NF-kappa beta (reviewed in Bai and Gust, 2009; Hah and Krause, 2014). Binding of estrogen receptors to the DNA promotes the assembly of higher order transcriptional complexes containing methyltransferases, histone acetyltransferases and other transcriptional activators, which promote transcription by establishing active chromatin marks and by recruiting general transcription factors and RNA polymerase II. ESR1- and estrogen-dependent recruitment of up to hundreds of coregulators has been demonstrated by varied co-immunoprecipitation and proteomic approaches (Kittler et al, 2013; Mohammed et al, 2013; Foulds et al, 2013; Mohammed et al, 2015; Liu et al, 2014; reviewed in Magnani and Lupien, 2014; Arnal, 2017). In some circumstances, ligand-bound receptors can also promote the assembly of a repression complex at a target gene, and in some cases, heterodimers of ESR1 and ESR2 serve as repressors of ESR1-mediated target gene activation (reviewed in Hah and Kraus, 2014; Arnal et al, 2017). Phosphorylation of the estrogen receptor also modulates its activity, and provides cross-talk between nuclear estrogen-dependent signaling and non-genomic estrogen signaling from the plasma membrane (reviewed in Anbalagan and Rowan, 2015; Halodsèn et al, 2014; Schwartz et al, 2016) A number of recent genome wide studies highlight the breadth of the transcriptional response to estrogen. The number of predicted estrogen-dependent target genes ranges from a couple of hundred (based on microarray studies) to upwards of 10000, based on ChIP-chip or ChIP-seq (Cheung and Kraus, 2010; Kinnis and Kraus, 2008; Lin et al, 2004; Welboren et al, 2009; Ikeda et al, 2015; Lin et al, 2007; Carroll et al, 2006). Many of these predicted sites may not represent transcriptionally productive binding events, however. A study examining ESR1 binding by ChIP-seq in 20 primary breast cancers identified a core of 484 ESR-binding events that were conserved in at least 75% of ER+ tumors, which may represent a more realistic estimate (Ross-Innes et al, 2012). These studies also highlight the long-range effect of estrogen receptor-binding, with distal enhancer or promoter elements regulating the expression of many target genes, often through looping or other higher order chromatin structures (Kittler et al, 2013; reviewed in Dietz and Carroll, 2008; Liu and Cheung, 2014; Magnani and Lupien, 2014). Transcription from a number of estrogen-responsive target genes also appears to be primed by the binding of pioneering transcription factors such as FOXA1, GATA3, PBX1 among others
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTC1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct ACTN1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ACTN4 Affinity Capture-Western, Reconstituted Complex physical 21078666 , (Europe PMC )NA BioGRID ACTR2 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology association, physical 20308691 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct ACTR3 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology association, physical 20308691 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct AGFG1 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID AHNAK Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct AHR Affinity Capture-Western, Reconstituted Complex physical 10620335 , 12612060 , 15837795 , 19460354 , (Europe PMC )NA BioGRID AHRR Affinity Capture-Western physical 18565642 , (Europe PMC )NA BioGRID AIFM1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct AKAP13 Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid direct interaction, physical, physical association 9627117 , (Europe PMC )0.59 BioGRID, IntAct AKAP8 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct AKT1 Biochemical Activity physical 11139588 , (Europe PMC )NA BioGRID AKT2 Affinity Capture-Western, Biochemical Activity physical 11507039 , (Europe PMC )NA BioGRID ALKBH7 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ALYREF Affinity Capture-MS, Reconstituted Complex physical 20348541 , 26487511 , (Europe PMC )NA BioGRID ANGPTL4 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT ANIB1 Affinity Capture-Western physical 9774463 , (Europe PMC )NA BioGRID ANP32A Affinity Capture-Western physical 15308690 , (Europe PMC )NA BioGRID ANP32B Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID ANXA2 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct AP2A2 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID AP2M1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct APOD Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ARFGAP2 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID ARG1 Affinity Capture-MS, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct ARHGDIA Affinity Capture-Western physical 21447808 , (Europe PMC )NA BioGRID ARID1A Reconstituted Complex physical 17363140 , (Europe PMC )NA BioGRID ARID5A Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 15941852 , (Europe PMC )0.63 BioGRID, IntAct ARNT Reconstituted Complex physical 15837795 , (Europe PMC )NA BioGRID ARSB Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ASCC1 Affinity Capture-Western physical 25219498 , (Europe PMC )NA BioGRID ASH2L Affinity Capture-MS, Affinity Capture-Western, pull down association, physical 16603732 , 21502505 , (Europe PMC )0.35 BioGRID, IntAct ATAD2 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array direct interaction, physical, physical association 17998543 , 25640309 , (Europe PMC )0.66 BioGRID, IntAct, MINT ATAD3A Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID ATP5F1B Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID ATP9A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct BAG1 Affinity Capture-Western, Reconstituted Complex physical 15538384 , 18388150 , 8524784 , (Europe PMC )NA BioGRID BAP1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT BARD1 Affinity Capture-Western physical 20060929 , 25740706 , (Europe PMC )NA BioGRID BCAR1 Affinity Capture-Western physical 15020686 , 19331827 , (Europe PMC )NA BioGRID BCAS2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 15694360 , (Europe PMC )NA BioGRID BCAS3 Affinity Capture-Western, Reconstituted Complex physical 17505058 , (Europe PMC )NA BioGRID BCL3 Affinity Capture-Western physical 16331275 , (Europe PMC )NA BioGRID BCLAF1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct BCOR Affinity Capture-MS, Affinity Capture-Western physical 26487511 , (Europe PMC )NA BioGRID BLOC1S1 Affinity Capture-Western, Reconstituted Complex physical 12639951 , (Europe PMC )NA BioGRID BRCA1 Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down direct interaction, physical, physical association 11244506 , 11493692 , 11782371 , 12400015 , 15674350 , 16061635 , 16860316 , 17505062 , 19887647 , 20060929 , 25499220 , (Europe PMC )0.76 BioGRID, IntAct, MINT BRI3BP Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID BTF3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid physical, physical association 18025262 , (Europe PMC )0.51 BioGRID, IntAct BUD13 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct CALM1 Reconstituted Complex physical 11981030 , (Europe PMC )NA BioGRID CAPRIN1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct CAPZB Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct CARM1 Affinity Capture-Western physical 28844863 , (Europe PMC )NA BioGRID CAT Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID CAV1 Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 11563984 , 19595769 , 22230296 , 23634843 , (Europe PMC )0.40 BioGRID, IntAct CBLL1 Affinity Capture-Western, Two-hybrid physical 20608937 , (Europe PMC )NA BioGRID CBR1 Affinity Capture-MS, pull down association, physical 23576398 , 26487511 , (Europe PMC )0.35 BioGRID, IntAct CCNC Affinity Capture-Western, Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID CCND1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 16061635 , 9039267 , (Europe PMC )NA BioGRID CCNH Affinity Capture-Western physical 12527756 , (Europe PMC )NA BioGRID CCNT1 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 15940264 , (Europe PMC )NA BioGRID CCT2 Affinity Capture-MS, Reconstituted Complex physical 20348541 , 26487511 , (Europe PMC )NA BioGRID CDC25B Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11689696 , (Europe PMC )NA BioGRID CDK11B Affinity Capture-Western, Reconstituted Complex physical 19122208 , (Europe PMC )NA BioGRID CDK2 Affinity Capture-Western, Biochemical Activity physical 23770852 , (Europe PMC )NA BioGRID CDK7 Biochemical Activity physical 10949034 , (Europe PMC )NA BioGRID CDK8 Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID CDKN1A Affinity Capture-Western, Reconstituted Complex physical 12897156 , 15743834 , 17911387 , (Europe PMC )NA BioGRID CEBPA Reconstituted Complex physical 9817600 , (Europe PMC )NA BioGRID CEBPB Affinity Capture-Western, Co-localization, Reconstituted Complex physical 16651265 , 19652226 , 7651415 , 9817600 , (Europe PMC )NA BioGRID CENPS-CORT Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID CEP290 Affinity Capture-MS physical 23576398 , (Europe PMC )NA BioGRID CFL1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT CHD4 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct CHD6 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID CHD9 Reconstituted Complex, pull down physical, physical association 16554032 , (Europe PMC )0.40 BioGRID, IntAct CHUK Co-localization physical 15808510 , (Europe PMC )NA BioGRID CIRBP Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID CITED1 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down physical, physical association 11581164 , (Europe PMC )0.52 BioGRID, IntAct CLTC Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct CLTCL1 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct CNDP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID COPS5 Affinity Capture-Western physical 15899841 , (Europe PMC )NA BioGRID CORO1C Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID CREBBP Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11113179 , 11782371 , 14766010 , 16417649 , 17400812 , 18765668 , 9192902 , (Europe PMC )NA BioGRID CRIPAK Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 16278681 , (Europe PMC )0.40 BioGRID, IntAct CSRP1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT CTNNB1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 15304487 , (Europe PMC )0.40 BioGRID, IntAct CUEDC2 Affinity Capture-Western, anti tag coimmunoprecipitation, pull down physical, physical association 17347654 , 21572428 , (Europe PMC )0.52 BioGRID, IntAct, MINT CUL1 Affinity Capture-Western physical 23770852 , (Europe PMC )NA BioGRID CUL3 Affinity Capture-Western physical 18414007 , (Europe PMC )NA BioGRID CXCL1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT DAP3 Reconstituted Complex, pull down association, physical 10903152 , 21182203 , (Europe PMC )0.35 BioGRID, IntAct DARS Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct DBN1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct DCAF1 Affinity Capture-MS, Affinity Capture-Western physical 28068668 , (Europe PMC )NA BioGRID DCAF13 Affinity Capture-Western physical 28068668 , (Europe PMC )NA BioGRID DDX1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID DDX17 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 12738788 , 19995069 , 20348541 , 20663877 , 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct DDX18 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DDX21 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DDX27 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DDX3X Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 20348541 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct DDX3Y Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DDX5 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, affinity chromatography technology, cosedimentation through density gradient, pull down, tandem affinity purification association, physical 12738788 , 19995069 , 20308691 , 20663877 , 21182205 , 25604459 , (Europe PMC )0.64 BioGRID, IntAct DDX50 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DDX54 Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, cosedimentation through density gradient association, physical 12466272 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct DECR1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DEK Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DHX15 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DHX30 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DHX9 Affinity Capture-MS, Reconstituted Complex physical 20348541 , 21182205 , (Europe PMC )NA BioGRID DKC1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DNAAF4 Affinity Capture-Western physical 19423554 , (Europe PMC )NA BioGRID DNAH2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DNAJA2 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNAJA3 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNAJB1 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNAJB11 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DNAJB4 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNAJB6 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNAJC10 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNAJC7 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNAJC9 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNMT3L Reconstituted Complex physical 24952347 , (Europe PMC )NA BioGRID DNTTIP2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 15047147 , (Europe PMC )NA BioGRID DSG1 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DUT Two-hybrid physical 15604093 , (Europe PMC )NA BioGRID E2F1 Affinity Capture-Western physical 22216287 , (Europe PMC )NA BioGRID E2F6 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID EEF2 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID EFTUD2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EGFR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17284441 , 20935677 , 28065597 , (Europe PMC )0.40, 0.52 BioGRID, IntAct, MINT EHMT2 Reconstituted Complex physical 21984853 , (Europe PMC )NA BioGRID EIF2S2 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID EIF4A1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct EIF4A3 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID EIF4G1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EIF4G3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EIF5A Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID EIF6 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID ELMSAN1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct EMD Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EP300 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay physical, physical association 11581164 , 11782371 , 11867769 , 12479814 , 12574227 , 12714702 , 12738788 , 14761960 , 15308690 , 16645043 , 18765668 , 19838210 , 19887647 , 20348541 , 20388208 , 22227247 , 23065768 , 25728767 , (Europe PMC )0.59 BioGRID, IntAct EP400 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EPB41L5 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EPPK1 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID EPRS Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct EPSTI1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT ERBB2 Affinity Capture-Western physical 15173068 , (Europe PMC )NA BioGRID ERBB4 Affinity Capture-Western physical 19439407 , (Europe PMC )NA BioGRID ESR1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, FRET, Reconstituted Complex, Two-hybrid, affinity chromatography technology, bioluminescence resonance energy transfer, cosedimentation through density gradient, proximity ligation assay, pull down, transcriptional complementation assay, two hybrid, x-ray crystallography association, direct interaction, physical, physical association 11265755 , 11682626 , 12198596 , 12554772 , 18474858 , 19022902 , 19117995 , 20348541 , 20353944 , 21182205 , 23065768 , 23159625 , 23576398 , (Europe PMC )0.61, 0.84 BioGRID, IntAct ESR2 Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti bait coimmunoprecipitation, bioluminescence resonance energy transfer, cosedimentation through density gradient, pull down association, physical, physical association 10706629 , 12630920 , 19022902 , 19746436 , 21182203 , 9473491 , (Europe PMC )0.52, 0.53 BioGRID, IntAct ESRRA Reconstituted Complex physical 9395481 , (Europe PMC )NA BioGRID EWSR1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct EXOSC10 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EZH2 Affinity Capture-Western, Reconstituted Complex physical 17502350 , (Europe PMC )NA BioGRID FARSA Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID FBH1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID FBXO45 Affinity Capture-MS, Affinity Capture-Western physical 26487511 , (Europe PMC )NA BioGRID FHL1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 19401155 , 22094188 , (Europe PMC )0.40 BioGRID, IntAct FHL2 Two-hybrid physical 15666801 , (Europe PMC )NA BioGRID FIP1L1 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID FKBP4 Reconstituted Complex physical 9222609 , (Europe PMC )NA BioGRID FKBP5 Affinity Capture-MS, Reconstituted Complex physical 27483141 , 9222609 , (Europe PMC )NA BioGRID FKBPL Affinity Capture-Western physical 23912458 , (Europe PMC )NA BioGRID FLII Reconstituted Complex physical 19720835 , (Europe PMC )NA BioGRID FLNA Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct FLNB Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct FMR1 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID FOS Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17317669 , 25303530 , (Europe PMC )0.35 BioGRID, IntAct FOXA1 Affinity Capture-MS, Co-localization, anti tag coimmunoprecipitation association, physical 25303530 , 27926873 , 28336670 , (Europe PMC )0.35 BioGRID, IntAct FOXK2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 25740706 , (Europe PMC )NA BioGRID FOXO1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid physical, physical association 11353774 , 11435445 , 22266855 , (Europe PMC )0.51 BioGRID, IntAct FOXO4 Reconstituted Complex physical 11435445 , (Europe PMC )NA BioGRID FTSJ3 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID FUBP1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID FUS Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct G3BP1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct G3BP2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GADD45A Affinity Capture-Western physical 10872826 , (Europe PMC )NA BioGRID GADD45G Reconstituted Complex physical 10872826 , (Europe PMC )NA BioGRID GAPDH Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GBP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GCN1 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID GLCE Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT GLYR1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GNAI1 Co-localization physical 22230296 , (Europe PMC )NA BioGRID GNAI2 Co-localization physical 22230296 , (Europe PMC )NA BioGRID GNAI3 Co-localization physical 22230296 , (Europe PMC )NA BioGRID GNB1 Affinity Capture-MS physical 21182205 , 26487511 , (Europe PMC )NA BioGRID GNB2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , 26487511 , (Europe PMC )0.35 BioGRID, IntAct GNB4 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , 26487511 , (Europe PMC )0.35 BioGRID, IntAct GNL2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GNL3 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct GOLGA2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GRIP1 Reconstituted Complex, Two-hybrid, pull down direct interaction, physical, physical association 17545996 , 17932106 , 9773983 , (Europe PMC )0.61 BioGRID, IntAct, MINT GRWD1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID GSN Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 20308691 , 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct GSTM3 Affinity Capture-MS physical 23576398 , (Europe PMC )NA BioGRID GTF2B Reconstituted Complex physical 9259327 , (Europe PMC )NA BioGRID GTF2H1 Biochemical Activity, Reconstituted Complex physical 10949034 , (Europe PMC )NA BioGRID GTPBP4 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct H2AFX Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct H3F3A Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID H3F3B Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HACD3 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID HBP1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT HDAC1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 14506733 , 14722073 , 15140878 , 15557281 , 17312152 , 21182205 , 24051437 , (Europe PMC )0.46 BioGRID, IntAct HDAC2 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient association, physical 17312152 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct HDAC3 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex physical 14722073 , 16469706 , 20348541 , 26487511 , (Europe PMC )NA BioGRID HDAC4 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 16051668 , 19893013 , (Europe PMC )NA BioGRID HDAC5 Reconstituted Complex physical 19893013 , (Europe PMC )NA BioGRID HDAC7 Affinity Capture-Western physical 19917725 , (Europe PMC )NA BioGRID HDAC9 Reconstituted Complex physical 19893013 , (Europe PMC )NA BioGRID HDLBP Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HECTD1 Affinity Capture-MS, Affinity Capture-Western physical 26166704 , 26389696 , (Europe PMC )NA BioGRID HEXIM1 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 15940264 , (Europe PMC )NA BioGRID HIF1A Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID HIST1H2BC Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HIST1H2BD Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HIST1H2BE Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HIST1H2BF Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HIST1H2BG Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HIST1H2BI Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HIST2H2AC Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HNRNPA0 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 20348541 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPA1L2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPA2B1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA3 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPAB Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct HNRNPC Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HNRNPD Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct HNRNPF Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPH2 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID HNRNPK Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPM Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPR Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HOXC10 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID HOXD9 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID HPCAL1 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct HSP90AA1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 11911945 , 12962497 , 15538384 , 16037132 , 17699868 , 18388150 , 20353944 , 21503962 , 22939624 , 23912458 , 27483141 , 9222609 , (Europe PMC )NA BioGRID HSP90AB1 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 22939624 , 27483141 , (Europe PMC )0.40 BioGRID, IntAct HSP90B1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HSPA1A Affinity Capture-MS, Affinity Capture-Western physical 27483141 , (Europe PMC )NA BioGRID HSPA1L Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct HSPA2 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID HSPA4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 15538384 , 15556606 , 20348541 , 21503962 , 27483141 , 9222609 , (Europe PMC )NA BioGRID HSPA4L Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID HSPA5 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID HSPA6 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient, pull down association, physical 15538384 , 16037132 , 20308691 , 21182203 , 21182205 , 27483141 , 9774640 , (Europe PMC )0.60 BioGRID, IntAct HSPA9 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , 27483141 , (Europe PMC )0.35 BioGRID, IntAct HSPB1 Affinity Capture-MS, Reconstituted Complex physical 20348541 , 23576398 , (Europe PMC )NA BioGRID HSPB8 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID HSPD1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , 26389696 , (Europe PMC )0.35 BioGRID, IntAct HSPE1 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID HSPH1 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID IGF1R Affinity Capture-Western physical 14764897 , 16113100 , 24051437 , (Europe PMC )NA BioGRID IKBKE Affinity Capture-Western physical 26186972 , (Europe PMC )NA BioGRID ILF2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct ILF3 Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct ING1 Reconstituted Complex physical 14630091 , (Europe PMC )NA BioGRID IRS1 Affinity Capture-Western physical 12821935 , (Europe PMC )NA BioGRID IRS2 Affinity Capture-Western physical 12821935 , (Europe PMC )NA BioGRID ISL1 Affinity Capture-Western, Reconstituted Complex physical 11043578 , (Europe PMC )NA BioGRID JUN Affinity Capture-Western, Reconstituted Complex physical 11477071 , 17317669 , 23747343 , (Europe PMC )NA BioGRID JUP Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct KARS Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID KAT5 Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, pull down physical, physical association 11591700 , 17418098 , 22081016 , (Europe PMC )0.52 BioGRID, IntAct KAT6A Affinity Capture-Western physical 17697320 , (Europe PMC )NA BioGRID KDM1A Affinity Capture-Western physical 17289570 , (Europe PMC )NA BioGRID KDM4B Affinity Capture-MS, Affinity Capture-Western, Co-fractionation physical 21502505 , (Europe PMC )NA BioGRID KDM5A Affinity Capture-Western, Reconstituted Complex physical 11358960 , (Europe PMC )NA BioGRID KHDRBS1 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID KIF1A Two-hybrid physical 15604093 , (Europe PMC )NA BioGRID KLF5 Affinity Capture-Western, Reconstituted Complex physical 19569049 , (Europe PMC )NA BioGRID KLK5 Two-hybrid physical 25640309 , (Europe PMC )NA BioGRID KLK9 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT KMT2D Affinity Capture-MS, Affinity Capture-Western, Co-localization physical 16603732 , 21502505 , 28336670 , (Europe PMC )NA BioGRID KMT5B Biochemical Activity physical 24101509 , (Europe PMC )NA BioGRID KRT1 Affinity Capture-MS physical 23576398 , (Europe PMC )NA BioGRID KRT10 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID KRT18 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID KRT19 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID KRT8 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID LARS Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct LATS1 Affinity Capture-Western physical 28068668 , (Europe PMC )NA BioGRID LCOR Affinity Capture-Western, FRET, Reconstituted Complex, Two-hybrid physical 12535528 , (Europe PMC )NA BioGRID LDB1 Reconstituted Complex physical 19117995 , (Europe PMC )NA BioGRID LGALS7 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct LMO4 Affinity Capture-Western, Reconstituted Complex physical 16288053 , (Europe PMC )NA BioGRID LRIF1 Reconstituted Complex physical 17455211 , (Europe PMC )NA BioGRID LUC7L3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct LYAR Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MAPK1 Biochemical Activity, Reconstituted Complex physical 11358671 , 12093745 , (Europe PMC )NA BioGRID MAPKAPK2 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MARS Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct MBD2 Co-localization physical 20300195 , (Europe PMC )NA BioGRID MDM2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid physical, physical association 10766163 , 11178989 , 12897156 , 17545634 , (Europe PMC )0.51 BioGRID, IntAct MED1 Affinity Capture-Western, FRET, Reconstituted Complex, Two-hybrid, pull down physical, physical association 10760302 , 10770935 , 11867769 , 12738788 , 15886699 , 9653119 , (Europe PMC )0.40 BioGRID, IntAct MED10 Affinity Capture-Western, Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED12 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 11867769 , 26487511 , (Europe PMC )NA BioGRID MED13 Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED14 Affinity Capture-Western, Reconstituted Complex physical 10770935 , 11867769 , (Europe PMC )NA BioGRID MED16 Affinity Capture-Western, Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED17 Reconstituted Complex, pull down association, physical 11867769 , 21182203 , (Europe PMC )0.35 BioGRID, IntAct MED20 Affinity Capture-Western, Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED21 Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED23 Affinity Capture-Western, Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED24 Affinity Capture-Western, Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED25 Affinity Capture-Western, Two-hybrid physical 17641689 , 24960263 , (Europe PMC )NA BioGRID MED27 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID MED6 Affinity Capture-Western, Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED7 Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED9 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID MEN1 Affinity Capture-Western, Two-hybrid physical 16651450 , (Europe PMC )NA BioGRID MGMT Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11564893 , (Europe PMC )NA BioGRID MKI67 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID MMS19 Reconstituted Complex physical 11279242 , (Europe PMC )NA BioGRID MNAT1 Affinity Capture-Western, Reconstituted Complex physical 12527756 , (Europe PMC )NA BioGRID MPG Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 14761960 , (Europe PMC )NA BioGRID MPRIP Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID MRPS9 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MSH2 Affinity Capture-Western, Reconstituted Complex physical 15886699 , (Europe PMC )NA BioGRID MTA1 Affinity Capture-Western, Reconstituted Complex physical 11146623 , 12167865 , 12639951 , 16807247 , (Europe PMC )NA BioGRID MTA2 Affinity Capture-Western, Reconstituted Complex physical 16645043 , (Europe PMC )NA BioGRID MTCH2 Two-hybrid physical 15604093 , (Europe PMC )NA BioGRID MTDH Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MTHFD1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID MTOR Affinity Capture-Western, Biochemical Activity physical 26522726 , (Europe PMC )NA BioGRID MUC1 Affinity Capture-Western, Reconstituted Complex physical 16427018 , (Europe PMC )NA BioGRID MVP Affinity Capture-Western, Reconstituted Complex physical 9628887 , (Europe PMC )NA BioGRID MYBBP1A Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 20348541 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct MYC Affinity Capture-Western physical 16455494 , (Europe PMC )NA BioGRID MYH14 Affinity Capture-MS, affinity chromatography technology, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.53 BioGRID, IntAct MYH9 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct MYL6 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, phage display association, direct interaction, physical 20308691 , 21182205 , 21217774 , (Europe PMC )0.64 BioGRID, IntAct MYL6B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MYLK2 Affinity Capture-MS, pull down, tandem affinity purification association, physical 21182203 , 21182205 , 25604459 , (Europe PMC )0.64 BioGRID, IntAct MYO1B Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct MYO1C Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct MYO6 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MYOD1 Affinity Capture-Western physical 18765668 , (Europe PMC )NA BioGRID NAP1L4 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID NAT10 Affinity Capture-MS physical 21182205 , 26487511 , (Europe PMC )NA BioGRID NCAPD2 Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID NCAPD3 Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID NCAPG Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID NCAPG2 Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID NCAPH Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID NCAPH2 Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID NCCRP1 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct NCL Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 20348541 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct NCOA1 Affinity Capture-MS, Affinity Capture-Western, FRET, Protein-peptide, Reconstituted Complex, Two-hybrid, fluorescent resonance energy transfer, pull down, two hybrid physical, physical association 10454579 , 10598586 , 10731636 , 10760302 , 11003650 , 11014206 , 11113179 , 11358671 , 11376110 , 11682626 , 11867769 , 12554772 , 12574227 , 12630920 , 12714702 , 12738788 , 14715875 , 15140878 , 15604093 , 16606617 , 16957778 , 17363140 , 17627277 , 20608937 , 23975195 , 26487511 , 9121466 , 9192892 , 9192902 , 9259327 , 9427757 , 9773983 , 9774463 , (Europe PMC )0.80 BioGRID, IntAct, MINT NCOA2 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, FRET, Protein-peptide, Reconstituted Complex, Two-hybrid, pull down, transcriptional complementation assay, two hybrid association, physical, physical association 11014206 , 11265755 , 11376110 , 11937504 , 12554772 , 12612084 , 12630920 , 12714702 , 14766010 , 15657427 , 16645043 , 17697320 , 18499756 , 19460354 , 20348541 , 26487511 , 9192892 , 9430642 , 9774463 , (Europe PMC )0.58 BioGRID, IntAct NCOA3 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, FRET, Protein-peptide, Reconstituted Complex, Two-hybrid, cross-linking study, pull down association, physical, physical association 10490106 , 11050174 , 11353774 , 11376110 , 11389589 , 12554772 , 12630920 , 12714702 , 14766010 , 15145444 , 15383283 , 16331275 , 16923966 , 17158759 , 17646391 , 18484708 , 18645020 , 19491275 , 20181721 , 20392877 , 21182203 , 25728767 , 26153859 , 26166704 , 26487511 , 28844863 , 9192892 , 9346901 , 9765300 , (Europe PMC )0.69 BioGRID, IntAct NCOA4 Reconstituted Complex physical 9892017 , (Europe PMC )NA BioGRID NCOA6 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 10567404 , 10681503 , 10866662 , 11773444 , 16794079 , 26487511 , (Europe PMC )0.37 BioGRID, IntAct NCOA7 Reconstituted Complex physical 11971969 , 9259327 , (Europe PMC )NA BioGRID NCOR1 Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, pull down association, physical 12145334 , 12738788 , 16469706 , 17400812 , 21182203 , 24051437 , (Europe PMC )0.35 BioGRID, IntAct NCOR2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12738788 , 14715875 , 20392877 , 9171229 , (Europe PMC )NA BioGRID NDC80 Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID NELFB Affinity Capture-Western, Reconstituted Complex physical 15342491 , (Europe PMC )NA BioGRID NFYA Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID NME2 Affinity Capture-MS physical 23576398 , (Europe PMC )NA BioGRID NONO Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct NOP2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct NOP56 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct NOP58 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct NPM1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient, pull down association, physical 20308691 , 20348541 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct NPPA Two-hybrid physical 15604093 , (Europe PMC )NA BioGRID NR0B2 Reconstituted Complex, Two-hybrid physical 11861507 , 9773978 , (Europe PMC )NA BioGRID NR1H4 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17333335 , 25675114 , (Europe PMC )0.40 BioGRID, IntAct NR2C1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 12093804 , (Europe PMC )0.40 BioGRID, IntAct NR2C2 Reconstituted Complex physical 11844790 , (Europe PMC )NA BioGRID NR2F1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12093745 , 9395481 , (Europe PMC )NA BioGRID NR2F6 Reconstituted Complex physical 10713182 , (Europe PMC )NA BioGRID NRIP1 Affinity Capture-Western, Far Western, Reconstituted Complex, Two-hybrid, cross-linking study, pull down association, physical, physical association 16439465 , 21182203 , 26153859 , 26166704 , 7641693 , 8887632 , 9115274 , 9192902 , (Europe PMC )0.56 BioGRID, IntAct NSD1 Two-hybrid physical 23975195 , (Europe PMC )NA BioGRID NSD2 Biochemical Activity physical 24101509 , (Europe PMC )NA BioGRID NSD3 Two-hybrid physical 25640309 , (Europe PMC )NA BioGRID NSF Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID NUDT21 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID NUMA1 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID NUP153 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct OTUB1 Affinity Capture-Western, Biochemical Activity physical 19383985 , (Europe PMC )NA BioGRID P4HB Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID PA2G4 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID PABPC1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct PAGR1 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down physical, physical association 19039327 , (Europe PMC )0.52 BioGRID, IntAct, MINT PAK1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 12374744 , 16452229 , (Europe PMC )NA BioGRID PAK6 Reconstituted Complex physical 11773441 , (Europe PMC )NA BioGRID PARP1 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient association, physical 16794079 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct PATZ1 Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID PBX1 Co-localization physical 28336670 , (Europe PMC )NA BioGRID PDIA3 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID PDLIM1 Affinity Capture-Western physical 19117995 , (Europe PMC )NA BioGRID PELP1 Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 11481323 , 14963108 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct PFN1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, pull down association, physical 23576398 , (Europe PMC )0.35 BioGRID, IntAct PGAM5 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct PGC Reconstituted Complex physical 15784253 , (Europe PMC )NA BioGRID PGK2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PGR Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, chromatin immunoprecipitation assay, confocal microscopy, cross-linking study, pull down, two hybrid association, colocalization, direct interaction, physical, physical association 12612073 , 22396492 , 26153859 , (Europe PMC )0.37, 0.59, 0.77 BioGRID, IntAct PHB Reconstituted Complex physical 17932104 , (Europe PMC )NA BioGRID PHB2 Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid physical 10938099 , 12943695 , 15140878 , 17932104 , 24051437 , 26052702 , (Europe PMC )NA BioGRID PIAS1 Two-hybrid physical 15666801 , (Europe PMC )NA BioGRID PIAS2 Reconstituted Complex physical 11117529 , (Europe PMC )NA BioGRID PIK3CA Affinity Capture-Western physical 11029009 , 24051437 , (Europe PMC )NA BioGRID PIK3R1 Affinity Capture-Western, anti bait coimmunoprecipitation, proximity ligation assay association, physical, physical association 11029009 , 11689445 , 17043237 , 23065768 , (Europe PMC )0.56 BioGRID, IntAct PIK3R2 Affinity Capture-Western physical 15020686 , (Europe PMC )NA BioGRID PLEC Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct PNMT Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PNRC2 Two-hybrid, beta lactamase complementation, two hybrid physical, physical association 11574675 , 15604093 , (Europe PMC )0.49 BioGRID, IntAct, MINT POF1B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct POLR2A Affinity Capture-Western, Co-localization, Reconstituted Complex physical 16957778 , 20308691 , 20348541 , (Europe PMC )NA BioGRID POLR2B Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2C Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2D Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2E Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2F Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2G Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2H Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2I Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2J Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2K Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2L Co-localization physical 16957778 , (Europe PMC )NA BioGRID POP1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct POU2F1 Reconstituted Complex physical 10480874 , (Europe PMC )NA BioGRID POU2F2 Reconstituted Complex physical 10480874 , (Europe PMC )NA BioGRID POU4F1 Reconstituted Complex, Two-hybrid physical 9448000 , (Europe PMC )NA BioGRID POU4F2 Reconstituted Complex, Two-hybrid physical 9448000 , (Europe PMC )NA BioGRID PPARGC1A Reconstituted Complex, two hybrid physical, physical association 10748020 , 12522104 , (Europe PMC )0.37 BioGRID, IntAct PPARGC1B Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 11854298 , 17631495 , (Europe PMC )0.37 BioGRID, IntAct PPIA Affinity Capture-MS physical 23576398 , (Europe PMC )NA BioGRID PPIB Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID PPID Reconstituted Complex physical 9222609 , (Europe PMC )NA BioGRID PPP1CA Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct PPP1CC Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct PPP1R14C Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PPP2CA Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID PPP2CB Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID PPP2R1A Affinity Capture-MS, Reconstituted Complex physical 20348541 , 26389696 , (Europe PMC )NA BioGRID PPP2R3A Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID PPP5C Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 14764652 , (Europe PMC )0.63 BioGRID, IntAct PQBP1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID PRDM2 Affinity Capture-Western, Two-hybrid physical 10706618 , 15282304 , 19746436 , (Europe PMC )NA BioGRID PRDX2 Affinity Capture-MS physical 23576398 , (Europe PMC )NA BioGRID PRKCSH Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct PRKCZ Affinity Capture-Western physical 18313384 , (Europe PMC )NA BioGRID PRKDC Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology association, physical 16794079 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct PRMT1 Reconstituted Complex physical 11050077 , (Europe PMC )NA BioGRID PRMT2 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, fluorescence microscopy, pull down, two hybrid colocalization, direct interaction, physical, physical association 12039952 , 22093364 , (Europe PMC )0.75 BioGRID, IntAct, MINT PRPF19 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID PRPF4B Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct PRPF8 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID PRR12 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID PSIP1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct PSMB9 Co-localization, pull down physical, physical association 16957778 , (Europe PMC )0.40 BioGRID, IntAct, MINT PSMC3IP Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSMC5 Reconstituted Complex physical 8598193 , (Europe PMC )NA BioGRID PSMD1 Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct PSPC1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID PTEN Reconstituted Complex physical 15205473 , (Europe PMC )NA BioGRID PTGES3 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 18388150 , 27483141 , 9222609 , (Europe PMC )NA BioGRID PTMA Reconstituted Complex physical 12943695 , (Europe PMC )NA BioGRID RABGEF1 Affinity Capture-Western physical 21356307 , (Europe PMC )NA BioGRID RAC3 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, phage display, pull down, two hybrid direct interaction, physical, physical association 21217774 , (Europe PMC )0.64 BioGRID, IntAct RACK1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID RAD50 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID RAD51 Affinity Capture-Western physical 25499220 , (Europe PMC )NA BioGRID RAN Affinity Capture-Western physical 22266855 , (Europe PMC )NA BioGRID RANBP9 Reconstituted Complex physical 16595702 , (Europe PMC )NA BioGRID RBBP4 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 18577416 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct RBBP5 Affinity Capture-MS, Affinity Capture-Western, pull down association, physical 16603732 , 21502505 , (Europe PMC )0.35 BioGRID, IntAct RBBP6 Affinity Capture-Western physical 20184719 , (Europe PMC )NA BioGRID RBBP7 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 18577416 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct RBCK1 Affinity Capture-Western, Reconstituted Complex physical 23042805 , 23912458 , (Europe PMC )NA BioGRID RBFOX2 Reconstituted Complex, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 11875103 , (Europe PMC )0.58 BioGRID, IntAct RBM14 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RBM23 Reconstituted Complex physical 15694343 , (Europe PMC )NA BioGRID RBM28 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RBM39 Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, cosedimentation through density gradient association, physical 11704680 , 15694343 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RBMX Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RBX1 Affinity Capture-Western physical 23770852 , (Europe PMC )NA BioGRID RDX Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RELA Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down direct interaction, physical, physical association 16331275 , 16497877 , 17932106 , 19350539 , 7651415 , (Europe PMC )0.78 BioGRID, IntAct REXO4 Reconstituted Complex physical 10908561 , (Europe PMC )NA BioGRID RLIM Affinity Capture-Western, Reconstituted Complex physical 19117995 , (Europe PMC )NA BioGRID RNF31 Affinity Capture-Western physical 24441041 , (Europe PMC )NA BioGRID RNF4 Two-hybrid physical 9710597 , (Europe PMC )NA BioGRID RNF40 Affinity Capture-Western physical 24441044 , (Europe PMC )NA BioGRID RPL10 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID RPL10A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL11 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL12 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL13 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL13A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL14 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL17 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL18 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL18A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL19 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL21 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL22 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL23A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL24 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL27A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL28 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL29 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL3 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL36 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL36A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL36AL Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.60 BioGRID, IntAct RPL37A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL4 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL5 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL6 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL7 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL7A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL8 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , 26487511 , (Europe PMC )0.46 BioGRID, IntAct RPL9 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPLP0 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, pull down, tandem affinity purification association, physical 20308691 , 21182203 , 21182205 , 25604459 , (Europe PMC )0.69 BioGRID, IntAct RPN1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPN2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS12 Affinity Capture-MS, affinity chromatography technology, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.53 BioGRID, IntAct RPS13 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPS14 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct RPS15A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPS16 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS18 Affinity Capture-MS, cosedimentation through density gradient, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct RPS2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS20 Affinity Capture-MS, affinity chromatography technology, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct RPS23 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS24 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPS26 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct RPS3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPS3A Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID RPS4X Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, pull down, tandem affinity purification association, physical 20308691 , 21182203 , 21182205 , 25604459 , (Europe PMC )0.69 BioGRID, IntAct RPS6 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS6KA1 Biochemical Activity physical 9528769 , (Europe PMC )NA BioGRID RPS6KA3 Affinity Capture-Western physical 11432835 , (Europe PMC )NA BioGRID RPS8 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS9 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPSA Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID RPTOR Affinity Capture-Western physical 26522726 , (Europe PMC )NA BioGRID RRP12 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RRP1B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RSL1D1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RTCB Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID RUVBL1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RUVBL2 Affinity Capture-MS, affinity chromatography technology, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.53 BioGRID, IntAct S100A7 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct S100A8 Affinity Capture-MS, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.53 BioGRID, IntAct SAFB Affinity Capture-Western, Reconstituted Complex physical 10707955 , 15066997 , 21527249 , (Europe PMC )NA BioGRID SAFB2 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down direct interaction, physical, physical association 12660241 , (Europe PMC )0.54 BioGRID, IntAct SARNP Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SARS2 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SASH1 Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID SCYL2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SEC61B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SEPT2 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SEPT8 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SERBP1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SERPINB4 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SERPINB5 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT SERPINH1 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SET Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SETD7 Biochemical Activity, Protein-peptide physical 18471979 , 24101509 , (Europe PMC )NA BioGRID SF3B1 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SFN Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SFPQ Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct SGK3 Affinity Capture-RNA physical 21084382 , (Europe PMC )NA BioGRID SHC1 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 11773443 , 20935677 , (Europe PMC )0.40 BioGRID, IntAct SHMT2 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SHOC2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SIGLEC10 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SIN3A Affinity Capture-Western physical 16469706 , 19620290 , (Europe PMC )NA BioGRID SIN3B Affinity Capture-Western physical 16469706 , (Europe PMC )NA BioGRID SIRT1 Affinity Capture-Western physical 21920899 , (Europe PMC )NA BioGRID SKI Affinity Capture-Western physical 22227247 , (Europe PMC )NA BioGRID SKIL Affinity Capture-Western, Reconstituted Complex physical 22227247 , (Europe PMC )NA BioGRID SKP1 Affinity Capture-Western physical 23770852 , (Europe PMC )NA BioGRID SKP2 Affinity Capture-Western, Biochemical Activity physical 23770852 , (Europe PMC )NA BioGRID SLC25A20 Affinity Capture-Western physical 23178685 , (Europe PMC )NA BioGRID SLC25A5 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct SMAD2 Affinity Capture-Western, Reconstituted Complex physical 11555647 , 20207742 , (Europe PMC )NA BioGRID SMAD3 Affinity Capture-Western physical 20207742 , (Europe PMC )NA BioGRID SMARCA2 Two-hybrid physical 9099865 , (Europe PMC )NA BioGRID SMARCA4 Reconstituted Complex, Two-hybrid physical 11003650 , 9099865 , (Europe PMC )NA BioGRID SMARCD1 Reconstituted Complex physical 12917342 , (Europe PMC )NA BioGRID SMARCD3 Reconstituted Complex physical 17363140 , (Europe PMC )NA BioGRID SMARCE1 Affinity Capture-Western, Reconstituted Complex physical 12145209 , 16538531 , 17363140 , (Europe PMC )NA BioGRID SMC1A Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SMC2 Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID SMC3 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SMC4 Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID SMURF1 Affinity Capture-Western, Reconstituted Complex physical 20207742 , (Europe PMC )NA BioGRID SMYD2 Biochemical Activity physical 24101509 , (Europe PMC )NA BioGRID SMYD3 Affinity Capture-Western, Reconstituted Complex physical 19509295 , (Europe PMC )NA BioGRID SND1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SNRPD1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SNRPN Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID SNX6 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SOS2 Affinity Capture-Western physical 15173068 , (Europe PMC )NA BioGRID SP1 Affinity Capture-Western, Co-localization, Reconstituted Complex, cross-linking study, pull down direct interaction, physical 10681512 , 15084343 , 15557281 , 15705965 , 15987735 , 16439465 , 16651265 , 17312152 , 17656465 , 18765668 , 19652226 , 9328340 , (Europe PMC )0.56 BioGRID, IntAct SP2 Affinity Capture-Western physical 15987735 , (Europe PMC )NA BioGRID SP3 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down direct interaction, physical 10816575 , 16651265 , (Europe PMC )0.56 BioGRID, IntAct SPOP Affinity Capture-Western physical 18414007 , 25766326 , (Europe PMC )NA BioGRID SPTAN1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SPTBN1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRA1 Far Western physical 20398657 , (Europe PMC )NA BioGRID SRC Affinity Capture-Western, Co-localization, FRET, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity ligation assay, pull down association, physical, physical association 11013076 , 11032808 , 11564893 , 12630920 , 14766010 , 14963108 , 15020686 , 15784253 , 16957778 , 17043237 , 17284441 , 17400812 , 17627277 , 17921256 , 20935677 , 23065768 , 24051437 , 24498420 , (Europe PMC )0.40, 0.86 BioGRID, IntAct, MINT SRPK1 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID SRPK2 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID SRRM1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct SRRM2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRSF1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct SRSF2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct SRSF3 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRSF5 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRSF6 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRSF7 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct STAT3 Affinity Capture-Western physical 11429412 , (Europe PMC )NA BioGRID STAT5A Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down physical, physical association 11682624 , 15304355 , (Europe PMC )0.52 BioGRID, IntAct, MINT STAU1 Affinity Capture-MS, affinity chromatography technology, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct STOM Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID STUB1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 15538384 , 16037132 , 18388150 , 27483141 , (Europe PMC )NA BioGRID SUPT16H Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SUPT6H Affinity Capture-Western physical 24441044 , (Europe PMC )NA BioGRID SUV39H1 Biochemical Activity physical 24101509 , (Europe PMC )NA BioGRID SUZ12 Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID SVIL Two-hybrid physical 11792840 , (Europe PMC )NA BioGRID SYNCRIP Affinity Capture-MS, Reconstituted Complex, cosedimentation through density gradient association, physical 20348541 , 21182205 , 26487511 , (Europe PMC )0.35 BioGRID, IntAct TAB2 Affinity Capture-Western, Reconstituted Complex physical 16469706 , 22249258 , 27992601 , (Europe PMC )NA BioGRID TAB3 Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID TADA3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12034840 , 18089809 , 20413580 , (Europe PMC )NA BioGRID TAF1A Reconstituted Complex physical 12511607 , (Europe PMC )NA BioGRID TAF1B Affinity Capture-Western, Reconstituted Complex physical 12511607 , (Europe PMC )NA BioGRID TAF2 Two-hybrid physical 9765300 , (Europe PMC )NA BioGRID TBK1 Affinity Capture-Western physical 26186972 , (Europe PMC )NA BioGRID TBL1XR1 Affinity Capture-Western physical 16469706 , (Europe PMC )NA BioGRID TBL2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct TBP Reconstituted Complex physical 11595744 , 9259327 , (Europe PMC )NA BioGRID TCERG1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID TCOF1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct TDG Affinity Capture-Western, Reconstituted Complex physical 12874288 , (Europe PMC )NA BioGRID TECR Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct TF Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct TFF1 Phenotypic Enhancement genetic 18313384 , (Europe PMC )NA BioGRID TFRC Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct THEM6 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct THRAP3 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID TIA1 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID TMOD3 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID TOP1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct TOP2A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct TOP2B Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient association, physical 16794079 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct TOPBP1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID TP53 Affinity Capture-Western, Reconstituted Complex physical 10766163 , 17545634 , 26556313 , (Europe PMC )NA BioGRID TRAF3 Affinity Capture-Western physical 26186972 , (Europe PMC )NA BioGRID TRAF6 Affinity Capture-Western physical 19331827 , (Europe PMC )NA BioGRID TRAM1 Reconstituted Complex, Two-hybrid physical 11014206 , 12612084 , (Europe PMC )NA BioGRID TRIM24 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10598587 , 21164480 , 21182203 , 8598193 , 9115274 , 9259327 , 9774463 , (Europe PMC )0.64 BioGRID, IntAct TRIM25 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 17418098 , (Europe PMC )NA BioGRID TRIP12 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct TRIP4 Reconstituted Complex physical 10454579 , (Europe PMC )NA BioGRID TRRAP Reconstituted Complex, Two-hybrid physical 12738788 , (Europe PMC )NA BioGRID TSC1 Affinity Capture-Western physical 15851513 , (Europe PMC )NA BioGRID TSC2 Affinity Capture-Western, Reconstituted Complex physical 15039427 , 15851513 , (Europe PMC )NA BioGRID TTC5 Affinity Capture-Western physical 21147850 , (Europe PMC )NA BioGRID TTK Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID TUBA1A Affinity Capture-Western physical 15556606 , (Europe PMC )NA BioGRID TUBA1C Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID TUBB Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID TUBB1 Affinity Capture-MS, Affinity Capture-Western physical 15556606 , (Europe PMC )NA BioGRID TUBG1 Affinity Capture-Western physical 25499220 , (Europe PMC )NA BioGRID TXNRD1 Affinity Capture-MS, confocal microscopy, fluorescence recovery after photobleaching, pull down colocalization, physical, physical association 15199063 , 26389696 , (Europe PMC )0.56 BioGRID, IntAct U2AF2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct U2SURP Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct UBAP2L Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct UBE2I Biochemical Activity, Two-hybrid physical 15666801 , 15961505 , (Europe PMC )NA BioGRID UBE3A Affinity Capture-Western physical 16314411 , 16772533 , 22865929 , (Europe PMC )NA BioGRID UBE3C Affinity Capture-MS, Affinity Capture-Western physical 26389696 , (Europe PMC )NA BioGRID UBE4B Two-hybrid physical 25640309 , (Europe PMC )NA BioGRID UBTF Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct UIMC1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 17311814 , (Europe PMC )NA BioGRID UNC45A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct UPF1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct USP16 Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID UTP3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct VAV3 Reconstituted Complex, pull down physical, physical association 18518979 , (Europe PMC )0.40 BioGRID, IntAct VCP Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID VPS13D Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID WBP2 Affinity Capture-Western, Reconstituted Complex physical 16772533 , (Europe PMC )NA BioGRID WDR18 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct WDR36 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct WDR5 Affinity Capture-MS, Affinity Capture-Western physical 16603732 , 21502505 , (Europe PMC )NA BioGRID WIPI1 Reconstituted Complex physical 15602573 , (Europe PMC )NA BioGRID XBP1 Affinity Capture-Western, Reconstituted Complex physical 12954762 , (Europe PMC )NA BioGRID XPO1 Affinity Capture-Western physical 22266855 , (Europe PMC )NA BioGRID XRCC5 Affinity Capture-Western physical 16794079 , (Europe PMC )NA BioGRID XRCC6 Affinity Capture-Western physical 16794079 , (Europe PMC )NA BioGRID YARS Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID YBX1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct YBX3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct YTHDF1 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID YTHDF2 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID YWHAQ Reconstituted Complex physical 11266503 , (Europe PMC )NA BioGRID ZBTB16 Reconstituted Complex physical 14521715 , (Europe PMC )NA BioGRID ZDHHC21 Affinity Capture-Western physical 22031296 , (Europe PMC )NA BioGRID ZDHHC7 Affinity Capture-Western physical 22031296 , (Europe PMC )NA BioGRID ZNF131 Affinity Capture-Western physical 23159625 , (Europe PMC )NA BioGRID ZNF182 Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID ZNF398 Reconstituted Complex physical 11779858 , (Europe PMC )NA BioGRID ZNF512B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCC5 pull down association 21182203 , (Europe PMC )0.35 IntAct ACTB Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient, pull down association, physical 20308691 , 20348541 , 21182203 , 21182205 , (Europe PMC )0.64 BioGRID, IntAct ACTC1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct ACTN1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ACTN4 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct ACTR2 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology association, physical 20308691 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct ACTR3 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology association, physical 20308691 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct AHNAK Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct AIFM1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct AKAP13 Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid direct interaction, physical, physical association 9627117 , (Europe PMC )0.59 BioGRID, IntAct AKAP8 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct ALKBH7 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ANGPTL4 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT ANXA2 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ANXA2P2 cosedimentation through density gradient association 21182205 , (Europe PMC )0.35 IntAct AP2M1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct APOD Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ARG1 Affinity Capture-MS, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct ARID5A Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 15941852 , (Europe PMC )0.63 BioGRID, IntAct ARSB Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ASF1A phage display, two hybrid direct interaction, physical association 21217774 , (Europe PMC )0.53 IntAct ASH2L Affinity Capture-MS, Affinity Capture-Western, pull down association, physical 16603732 , 21502505 , (Europe PMC )0.35 BioGRID, IntAct ASXL1 pull down, two hybrid direct interaction, physical association 16606617 , (Europe PMC )0.53 IntAct ATAD2 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array direct interaction, physical, physical association 17998543 , 25640309 , (Europe PMC )0.66 BioGRID, IntAct, MINT ATAD3A affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct ATAD3C pull down association 21182203 , (Europe PMC )0.35 IntAct ATF1 phage display direct interaction 21217774 , (Europe PMC )0.44 IntAct ATP5F1B affinity chromatography technology, tandem affinity purification association 21182205 , 25604459 , (Europe PMC )0.53 IntAct ATP9A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct BAP1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT BCLAF1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct BLCAP phage display, two hybrid direct interaction, physical association 21217774 , (Europe PMC )0.53 IntAct BRCA1 Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down direct interaction, physical, physical association 11244506 , 11493692 , 11782371 , 12400015 , 15674350 , 16061635 , 16860316 , 17505062 , 19887647 , 20060929 , 25499220 , (Europe PMC )0.76 BioGRID, IntAct, MINT BRI3BP affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct BTF3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid physical, physical association 18025262 , (Europe PMC )0.51 BioGRID, IntAct BUD13 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct C20orf197 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct C4A cross-linking study physical association 26153859 , (Europe PMC )0.40 IntAct CACUL1 anti tag coimmunoprecipitation, fluorescence microscopy, pull down colocalization, direct interaction, physical association 23178685 , (Europe PMC )0.57 IntAct, MINT CAD tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct CAPRIN1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct CAPZB Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct CAV1 Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 11563984 , 19595769 , 22230296 , 23634843 , (Europe PMC )0.40 BioGRID, IntAct CBR1 Affinity Capture-MS, pull down association, physical 23576398 , 26487511 , (Europe PMC )0.35 BioGRID, IntAct CCDC6 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct CCT3 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct CCT7 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct CEBPB pull down direct interaction 7651415 , (Europe PMC )0.44 IntAct CFAP47 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct CFL1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT CHD4 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct CHD9 Reconstituted Complex, pull down physical, physical association 16554032 , (Europe PMC )0.40 BioGRID, IntAct CITED1 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down physical, physical association 11581164 , (Europe PMC )0.52 BioGRID, IntAct CLTC Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct CLTCL1 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct COPG2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct CRIPAK Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 16278681 , (Europe PMC )0.40 BioGRID, IntAct CSRP1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT CTNNB1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 15304487 , (Europe PMC )0.40 BioGRID, IntAct CUEDC2 Affinity Capture-Western, anti tag coimmunoprecipitation, pull down physical, physical association 17347654 , 21572428 , (Europe PMC )0.52 BioGRID, IntAct, MINT CXCL1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT DAP3 Reconstituted Complex, pull down association, physical 10903152 , 21182203 , (Europe PMC )0.35 BioGRID, IntAct DARS Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct DBN1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct DCTN2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct DDX17 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 12738788 , 19995069 , 20348541 , 20663877 , 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct DDX18 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DDX21 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DDX27 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DDX3X Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 20348541 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct DDX3Y Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DDX5 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, affinity chromatography technology, cosedimentation through density gradient, pull down, tandem affinity purification association, physical 12738788 , 19995069 , 20308691 , 20663877 , 21182205 , 25604459 , (Europe PMC )0.64 BioGRID, IntAct DDX50 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DDX54 Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, cosedimentation through density gradient association, physical 12466272 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct DECR1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DEK Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DHX15 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DHX30 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DHX9 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct DKC1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DNAH2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DNAJA1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct DNAJB11 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DNM1L phage display, two hybrid direct interaction, physical association 21217774 , (Europe PMC )0.53 IntAct DSG1 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DYNC1H1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct EBI-2878106 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct EBI-4399559 comigration in sds page, mass spectrometry studies of complexes covalent binding, direct interaction 17392432 , (Europe PMC )0.56 IntAct EDF1 phage display direct interaction 21217774 , (Europe PMC )0.44 IntAct EFTUD2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EGFR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17284441 , 20935677 , 28065597 , (Europe PMC )0.40, 0.52 BioGRID, IntAct, MINT EIF4A1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct EIF4G1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EIF4G3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ELMSAN1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct EMD Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ENSG00000054598 chromatin immunoprecipitation assay association 25303530 , (Europe PMC )0.35 IntAct ENSG00000101040 chromatin immunoprecipitation assay association 26153859 , (Europe PMC )0.35 IntAct ENSG00000110092 chromatin immunoprecipitation assay association 22396492 , (Europe PMC )0.35 IntAct ENSG00000111305 chromatin immunoprecipitation assay association 26153859 , (Europe PMC )0.35 IntAct ENSG00000136997 chromatin immunoprecipitation assay association 22396492 , 25303530 , (Europe PMC )0.53 IntAct ENSG00000145901 chromatin immunoprecipitation assay association 25303530 , (Europe PMC )0.35 IntAct ENSG00000147862 chromatin immunoprecipitation assay association 26153859 , (Europe PMC )0.35 IntAct ENSG00000160182 chromatin immunoprecipitation assay association 15304487 , 15380516 , 19487245 , 25303530 , (Europe PMC )0.73 IntAct ENSG00000168646 chromatin immunoprecipitation assay association 15304487 , (Europe PMC )0.35 IntAct ENSG00000196208 chromatin immunoprecipitation assay association 25303530 , (Europe PMC )0.35 IntAct ENSG00000196620 chromatin immunoprecipitation assay association 19487245 , (Europe PMC )0.35 IntAct ENSG00000219481 chromatin immunoprecipitation assay association 26153859 , (Europe PMC )0.35 IntAct EP300 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay physical, physical association 11581164 , 11782371 , 11867769 , 12479814 , 12574227 , 12714702 , 12738788 , 14761960 , 15308690 , 16645043 , 18765668 , 19838210 , 19887647 , 20348541 , 20388208 , 22227247 , 23065768 , 25728767 , (Europe PMC )0.59 BioGRID, IntAct EP400 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EPB41L5 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EPPK1 cosedimentation through density gradient association 21182205 , (Europe PMC )0.35 IntAct EPRS Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct EPSTI1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT ESR1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, FRET, Reconstituted Complex, Two-hybrid, affinity chromatography technology, bioluminescence resonance energy transfer, cosedimentation through density gradient, proximity ligation assay, pull down, transcriptional complementation assay, two hybrid, x-ray crystallography association, direct interaction, physical, physical association 11265755 , 11682626 , 12198596 , 12554772 , 18474858 , 19022902 , 19117995 , 20348541 , 20353944 , 21182205 , 23065768 , 23159625 , 23576398 , (Europe PMC )0.61, 0.84 BioGRID, IntAct ESR2 Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti bait coimmunoprecipitation, bioluminescence resonance energy transfer, cosedimentation through density gradient, pull down association, physical, physical association 10706629 , 12630920 , 19022902 , 19746436 , 21182203 , 9473491 , (Europe PMC )0.52, 0.53 BioGRID, IntAct ESRRB fluorescent resonance energy transfer physical association 19755138 , (Europe PMC )0.40 IntAct EWSR1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct EXOSC10 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EXOSC4 pull down association 21182203 , (Europe PMC )0.35 IntAct FASN tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct FHL1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 19401155 , 22094188 , (Europe PMC )0.40 BioGRID, IntAct FLNA Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct FLNB Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct FMR1 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct FOS Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17317669 , 25303530 , (Europe PMC )0.35 BioGRID, IntAct FOXA1 Affinity Capture-MS, Co-localization, anti tag coimmunoprecipitation association, physical 25303530 , 27926873 , 28336670 , (Europe PMC )0.35 BioGRID, IntAct FOXO1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid physical, physical association 11353774 , 11435445 , 22266855 , (Europe PMC )0.51 BioGRID, IntAct FTSJ3 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct FUS Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct G3BP1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct G3BP2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GALK1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct GAPDH Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GATA3 anti tag coimmunoprecipitation, chromatin immunoprecipitation assay, cross-linking study association, physical association 25303530 , 26153859 , (Europe PMC )0.62 IntAct GLCE Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT GLYR1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GNB1 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct GNB2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , 26487511 , (Europe PMC )0.35 BioGRID, IntAct GNB4 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , 26487511 , (Europe PMC )0.35 BioGRID, IntAct GNL2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GNL3 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct GOLGA2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GRHL2 cross-linking study physical association 26153859 , (Europe PMC )0.40 IntAct GRIP1 Reconstituted Complex, Two-hybrid, pull down direct interaction, physical, physical association 17545996 , 17932106 , 9773983 , (Europe PMC )0.61 BioGRID, IntAct, MINT GSN Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 20308691 , 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct GTPBP4 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct H2AFX Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct HACD3 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct HAX1 phage display, two hybrid direct interaction, physical association 21217774 , (Europe PMC )0.53 IntAct HBP1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT HDAC1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 14506733 , 14722073 , 15140878 , 15557281 , 17312152 , 21182205 , 24051437 , (Europe PMC )0.46 BioGRID, IntAct HDAC2 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient association, physical 17312152 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct HIF1A pull down association 21182205 , (Europe PMC )0.35 IntAct HNRNPA0 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 20348541 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPA1L2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPA2B1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA3 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPAB Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct HNRNPD Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct HNRNPF Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPK Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPM Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPR Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPU affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct HNRNPUL1 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct HPCAL1 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct HSP90AB1 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 22939624 , 27483141 , (Europe PMC )0.40 BioGRID, IntAct HSPA1L Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct HSPA5 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct HSPA8 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient, pull down association, physical 15538384 , 16037132 , 20308691 , 21182203 , 21182205 , 27483141 , 9774640 , (Europe PMC )0.60 BioGRID, IntAct HSPA9 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , 27483141 , (Europe PMC )0.35 BioGRID, IntAct HSPD1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , 26389696 , (Europe PMC )0.35 BioGRID, IntAct HUWE1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct HYOU1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct IARS tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct IL25 pull down association 21182203 , (Europe PMC )0.35 IntAct ILF2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct ILF3 Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct IMPDH2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct INTS1 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct IQGAP1 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct JMJD6 anti bait coimmunoprecipitation, demethylase assay, proximity ligation assay, pull down association, demethylation reaction, physical association 24498420 , (Europe PMC )0.66 IntAct JUP Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct KAT5 Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, pull down physical, physical association 11591700 , 17418098 , 22081016 , (Europe PMC )0.52 BioGRID, IntAct KATNAL2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KDM6B anti bait coimmunoprecipitation physical association 21841772 , (Europe PMC )0.40 IntAct, MINT KHDRBS1 cosedimentation through density gradient association 21182205 , (Europe PMC )0.35 IntAct KLK5 two hybrid array physical association 25640309 , (Europe PMC )0.37 IntAct, MINT KLK9 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT KMT2B pull down association, direct interaction 16603732 , (Europe PMC )0.52 IntAct KRT13 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KRT15 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KRT35 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KRT37 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KRT4 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KRT78 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KRT79 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct LACTB affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct LANCL1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct LARP1 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct LARP4 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct LARS Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct LGALS7 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct LINC00312 anti tag coimmunoprecipitation, pull down, two hybrid direct interaction, physical association 15474036 , (Europe PMC )0.59 IntAct, MINT LMTK3 anti bait coimmunoprecipitation, protein kinase assay phosphorylation reaction, physical association 21602804 , (Europe PMC )0.54 IntAct LPCAT1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct LRRFIP1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct LUC7L3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct LUZP2 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct LYAR Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct LYZ pull down association 21182203 , (Europe PMC )0.35 IntAct MACROD1 anti bait coimmunoprecipitation, pull down, two hybrid physical association 17914104 , (Europe PMC )0.58 IntAct MAP3K1 coimmunoprecipitation phosphorylation reaction 15556606 , (Europe PMC )0.44 IntAct, MINT MAPKAPK2 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MARS Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct MCM2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct MDM2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid physical, physical association 10766163 , 11178989 , 12897156 , 17545634 , (Europe PMC )0.51 BioGRID, IntAct MED1 Affinity Capture-Western, FRET, Reconstituted Complex, Two-hybrid, pull down physical, physical association 10760302 , 10770935 , 11867769 , 12738788 , 15886699 , 9653119 , (Europe PMC )0.40 BioGRID, IntAct MED17 Reconstituted Complex, pull down association, physical 11867769 , 21182203 , (Europe PMC )0.35 BioGRID, IntAct MED30 pull down association 21182203 , (Europe PMC )0.35 IntAct MED4 pull down association 21182203 , (Europe PMC )0.35 IntAct MKI67 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct MRPS15 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS17 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS2 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS22 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS27 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS31 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS35 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS6 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS9 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MTDH Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MYBBP1A Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 20348541 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct MYH14 Affinity Capture-MS, affinity chromatography technology, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.53 BioGRID, IntAct MYH9 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct MYL6 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, phage display association, direct interaction, physical 20308691 , 21182205 , 21217774 , (Europe PMC )0.64 BioGRID, IntAct MYL6B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MYLK2 Affinity Capture-MS, pull down, tandem affinity purification association, physical 21182203 , 21182205 , 25604459 , (Europe PMC )0.64 BioGRID, IntAct MYO1B Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct MYO1C Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct MYO6 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct NAT10 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct NCCRP1 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct NCL Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 20348541 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct NCOA1 Affinity Capture-MS, Affinity Capture-Western, FRET, Protein-peptide, Reconstituted Complex, Two-hybrid, fluorescent resonance energy transfer, pull down, two hybrid physical, physical association 10454579 , 10598586 , 10731636 , 10760302 , 11003650 , 11014206 , 11113179 , 11358671 , 11376110 , 11682626 , 11867769 , 12554772 , 12574227 , 12630920 , 12714702 , 12738788 , 14715875 , 15140878 , 15604093 , 16606617 , 16957778 , 17363140 , 17627277 , 20608937 , 23975195 , 26487511 , 9121466 , 9192892 , 9192902 , 9259327 , 9427757 , 9773983 , 9774463 , (Europe PMC )0.80 BioGRID, IntAct, MINT NCOA2 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, FRET, Protein-peptide, Reconstituted Complex, Two-hybrid, pull down, transcriptional complementation assay, two hybrid association, physical, physical association 11014206 , 11265755 , 11376110 , 11937504 , 12554772 , 12612084 , 12630920 , 12714702 , 14766010 , 15657427 , 16645043 , 17697320 , 18499756 , 19460354 , 20348541 , 26487511 , 9192892 , 9430642 , 9774463 , (Europe PMC )0.58 BioGRID, IntAct NCOA3 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, FRET, Protein-peptide, Reconstituted Complex, Two-hybrid, cross-linking study, pull down association, physical, physical association 10490106 , 11050174 , 11353774 , 11376110 , 11389589 , 12554772 , 12630920 , 12714702 , 14766010 , 15145444 , 15383283 , 16331275 , 16923966 , 17158759 , 17646391 , 18484708 , 18645020 , 19491275 , 20181721 , 20392877 , 21182203 , 25728767 , 26153859 , 26166704 , 26487511 , 28844863 , 9192892 , 9346901 , 9765300 , (Europe PMC )0.69 BioGRID, IntAct NCOA5 pull down physical association 11113208 , (Europe PMC )0.40 IntAct NCOA6 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 10567404 , 10681503 , 10866662 , 11773444 , 16794079 , 26487511 , (Europe PMC )0.37 BioGRID, IntAct NCOR1 Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, pull down association, physical 12145334 , 12738788 , 16469706 , 17400812 , 21182203 , 24051437 , (Europe PMC )0.35 BioGRID, IntAct NDRG2 phage display, two hybrid direct interaction, physical association 21217774 , (Europe PMC )0.53 IntAct NFKB1 anti bait coimmunoprecipitation, pull down direct interaction, physical association 19350539 , 7651415 , (Europe PMC )0.68 IntAct NFKB2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct NONO Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct NOP2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct NOP56 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct NOP58 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct NOS3 anti bait coimmunoprecipitation association 17921256 , (Europe PMC )0.35 IntAct NPM1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient, pull down association, physical 20308691 , 20348541 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct NR1H4 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17333335 , 25675114 , (Europe PMC )0.40 BioGRID, IntAct NR2C1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 12093804 , (Europe PMC )0.40 BioGRID, IntAct NRIP1 Affinity Capture-Western, Far Western, Reconstituted Complex, Two-hybrid, cross-linking study, pull down association, physical, physical association 16439465 , 21182203 , 26153859 , 26166704 , 7641693 , 8887632 , 9115274 , 9192902 , (Europe PMC )0.56 BioGRID, IntAct NSD3 two hybrid array physical association 25640309 , (Europe PMC )0.37 IntAct, MINT NUMA1 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct NUP153 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct PABPC1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct PABPC1L tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PABPC3 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PABPC5 pull down association 21182203 , (Europe PMC )0.35 IntAct PAGR1 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down physical, physical association 19039327 , (Europe PMC )0.52 BioGRID, IntAct, MINT PARP1 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient association, physical 16794079 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct PBXIP1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid association, direct interaction, physical association 17043237 , (Europe PMC )0.37, 0.58, 0.59 IntAct PDIA6 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PELP1 Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 11481323 , 14963108 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct PFN1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, pull down association, physical 23576398 , (Europe PMC )0.35 BioGRID, IntAct PGAM5 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct PGR Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, chromatin immunoprecipitation assay, confocal microscopy, cross-linking study, pull down, two hybrid association, colocalization, direct interaction, physical, physical association 12612073 , 22396492 , 26153859 , (Europe PMC )0.37, 0.59, 0.77 BioGRID, IntAct PHB2 pull down, two hybrid physical association 10359819 , (Europe PMC )0.51 IntAct PHGDH tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PIK3R1 Affinity Capture-Western, anti bait coimmunoprecipitation, proximity ligation assay association, physical, physical association 11029009 , 11689445 , 17043237 , 23065768 , (Europe PMC )0.56 BioGRID, IntAct PLA2G7 pull down association 21182203 , (Europe PMC )0.35 IntAct PLEC Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct PLOD3 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PNRC2 Two-hybrid, beta lactamase complementation, two hybrid physical, physical association 11574675 , 15604093 , (Europe PMC )0.49 BioGRID, IntAct, MINT POF1B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct POP1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct PPARGC1A Reconstituted Complex, two hybrid physical, physical association 10748020 , 12522104 , (Europe PMC )0.37 BioGRID, IntAct PPARGC1B Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 11854298 , 17631495 , (Europe PMC )0.37 BioGRID, IntAct PPP1CA Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct PPP1CC Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct PPP5C Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 14764652 , (Europe PMC )0.63 BioGRID, IntAct PPP6R1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PRDX3 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PRKCSH Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct PRKDC Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology association, physical 16794079 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct PRMT2 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, fluorescence microscopy, pull down, two hybrid colocalization, direct interaction, physical, physical association 12039952 , 22093364 , (Europe PMC )0.75 BioGRID, IntAct, MINT PRPF4B Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct PSIP1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct PSMB9 Co-localization, pull down physical, physical association 16957778 , (Europe PMC )0.40 BioGRID, IntAct, MINT PSMC1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PSMC2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PSMC3IP Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSMC4 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PSMD1 Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct PSMD2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PTCD3 pull down association 21182203 , (Europe PMC )0.35 IntAct PTPN1 phosphatase assay dephosphorylation reaction 7539106 , (Europe PMC )0.44 IntAct, MINT PTPN6 phosphatase assay dephosphorylation reaction 7539106 , (Europe PMC )0.44 IntAct, MINT RAC3 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, phage display, pull down, two hybrid direct interaction, physical, physical association 21217774 , (Europe PMC )0.64 BioGRID, IntAct RARA anti tag coimmunoprecipitation, chromatin immunoprecipitation assay, tandem affinity purification association 25303530 , 25604459 , (Europe PMC )0.60 IntAct RARB tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct RARG anti tag coimmunoprecipitation association 25303530 , (Europe PMC )0.35 IntAct RBBP4 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 18577416 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct RBBP5 Affinity Capture-MS, Affinity Capture-Western, pull down association, physical 16603732 , 21502505 , (Europe PMC )0.35 BioGRID, IntAct RBBP7 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 18577416 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct RBFOX2 Reconstituted Complex, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 11875103 , (Europe PMC )0.58 BioGRID, IntAct RBM14 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RBM28 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RBM39 Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, cosedimentation through density gradient association, physical 11704680 , 15694343 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RBMX Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RDX Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RELA Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down direct interaction, physical, physical association 16331275 , 16497877 , 17932106 , 19350539 , 7651415 , (Europe PMC )0.78 BioGRID, IntAct RPL10 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct RPL10A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL11 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL12 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL13 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL13A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL14 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL15 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct RPL17 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL18 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL18A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL19 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL21 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL22 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL23A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL24 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL27A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL28 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL29 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL3 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL36 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL36A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL36AL Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.60 BioGRID, IntAct RPL37A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL4 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL5 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL6 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL7 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL7A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL8 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , 26487511 , (Europe PMC )0.46 BioGRID, IntAct RPL9 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPLP0 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, pull down, tandem affinity purification association, physical 20308691 , 21182203 , 21182205 , 25604459 , (Europe PMC )0.69 BioGRID, IntAct RPLP0P6 pull down, tandem affinity purification association 21182203 , 25604459 , (Europe PMC )0.53 IntAct RPN1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPN2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS11 pull down association 21182203 , (Europe PMC )0.35 IntAct RPS12 Affinity Capture-MS, affinity chromatography technology, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.53 BioGRID, IntAct RPS13 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPS14 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct RPS15A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPS16 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS18 Affinity Capture-MS, cosedimentation through density gradient, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct RPS2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS20 Affinity Capture-MS, affinity chromatography technology, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct RPS23 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS24 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPS26 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct RPS26P11 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct RPS3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPS3A affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct RPS4X Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, pull down, tandem affinity purification association, physical 20308691 , 21182203 , 21182205 , 25604459 , (Europe PMC )0.69 BioGRID, IntAct RPS5 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct RPS6 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS8 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS9 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPSA affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct RRP12 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RRP1B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RSL1D1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RUVBL1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RUVBL2 Affinity Capture-MS, affinity chromatography technology, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.53 BioGRID, IntAct S100A7 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct S100A8 Affinity Capture-MS, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.53 BioGRID, IntAct SAFB2 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down direct interaction, physical, physical association 12660241 , (Europe PMC )0.54 BioGRID, IntAct SCYL2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SEC16A tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct SEC22B tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct SEC61B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SEMG1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct SEMG2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct SENP5 phage display, two hybrid direct interaction, physical association 21217774 , (Europe PMC )0.53 IntAct SERPINB4 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SERPINB5 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT SERPINH1 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SF1 pull down association 21182203 , (Europe PMC )0.35 IntAct SF3B1 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SFN Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SFPQ Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct SHC1 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 11773443 , 20935677 , (Europe PMC )0.40 BioGRID, IntAct SHOC2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SLC25A5 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct SLC25A6 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct SMARCD1 pull down physical association 12917342 , (Europe PMC )0.40 IntAct SNRPD1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SNW1 two hybrid physical association 19934264 , (Europe PMC )0.37 IntAct SP1 Affinity Capture-Western, Co-localization, Reconstituted Complex, cross-linking study, pull down direct interaction, physical 10681512 , 15084343 , 15557281 , 15705965 , 15987735 , 16439465 , 16651265 , 17312152 , 17656465 , 18765668 , 19652226 , 9328340 , (Europe PMC )0.56 BioGRID, IntAct SP3 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down direct interaction, physical 10816575 , 16651265 , (Europe PMC )0.56 BioGRID, IntAct SPTAN1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SPTBN1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRC Affinity Capture-Western, Co-localization, FRET, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity ligation assay, pull down association, physical, physical association 11013076 , 11032808 , 11564893 , 12630920 , 14766010 , 14963108 , 15020686 , 15784253 , 16957778 , 17043237 , 17284441 , 17400812 , 17627277 , 17921256 , 20935677 , 23065768 , 24051437 , 24498420 , (Europe PMC )0.40, 0.86 BioGRID, IntAct, MINT SRPK1 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct SRPK2 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct SRRM1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct SRRM2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRSF1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct SRSF2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct SRSF3 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRSF5 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRSF6 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRSF7 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct STAT1 anti tag coimmunoprecipitation association 25303530 , (Europe PMC )0.35 IntAct STAT5A Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down physical, physical association 11682624 , 15304355 , (Europe PMC )0.52 BioGRID, IntAct, MINT STAU1 Affinity Capture-MS, affinity chromatography technology, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct SUMO2 cross-linking study physical association 26153859 , (Europe PMC )0.40 IntAct SUPT16H Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SYNCRIP Affinity Capture-MS, Reconstituted Complex, cosedimentation through density gradient association, physical 20348541 , 21182205 , 26487511 , (Europe PMC )0.35 BioGRID, IntAct TBL2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct TBR1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct TCOF1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct TECR Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct TF Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct TFAP2C anti tag coimmunoprecipitation association 25303530 , (Europe PMC )0.35 IntAct TFRC Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct THEM6 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct THRAP3 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct TOP1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct TOP2A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct TOP2B Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient association, physical 16794079 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct TRIM24 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10598587 , 21164480 , 21182203 , 8598193 , 9115274 , 9259327 , 9774463 , (Europe PMC )0.64 BioGRID, IntAct TRIP12 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct TRPS1 cross-linking study physical association 26153859 , (Europe PMC )0.40 IntAct TTN tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct TUBA1B tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct TUBAL3 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct TUBB3 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct TUBB6 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct TXNRD1 Affinity Capture-MS, confocal microscopy, fluorescence recovery after photobleaching, pull down colocalization, physical, physical association 15199063 , 26389696 , (Europe PMC )0.56 BioGRID, IntAct U2AF2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct U2SURP Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct UBAP2L Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct UBB affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct UBE4B two hybrid array physical association 25640309 , (Europe PMC )0.37 IntAct, MINT UBTF Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct UNC45A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct UPF1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct UTP14A pull down association 21182203 , (Europe PMC )0.35 IntAct UTP3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct UXT anti tag coimmunoprecipitation physical association 28106301 , (Europe PMC )0.40 IntAct VAV3 Reconstituted Complex, pull down physical, physical association 18518979 , (Europe PMC )0.40 BioGRID, IntAct VPS13D {ECO:0000312|EMBL:CAE75586.1, cosedimentation through density gradient association 21182205 , (Europe PMC )0.35 IntAct WDR18 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct WDR26 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct WDR36 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct WDR5B pull down association 16603732 , (Europe PMC )0.35 IntAct WRNIP1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct YBX1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct YBX3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct YTHDF2 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct YWHAZ tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct ZC3HAV1 pull down association 21182203 , (Europe PMC )0.35 IntAct ZNF366 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid direct interaction, physical association 17085477 , (Europe PMC )0.63 IntAct ZNF512B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ZNHIT3 pull down association 21182203 , (Europe PMC )0.35 IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ATAD2 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array direct interaction, physical, physical association 17998543 , 25640309 , (Europe PMC )0.66 BioGRID, IntAct, MINT BAP1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT BRCA1 Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down direct interaction, physical, physical association 11244506 , 11493692 , 11782371 , 12400015 , 15674350 , 16061635 , 16860316 , 17505062 , 19887647 , 20060929 , 25499220 , (Europe PMC )0.76 BioGRID, IntAct, MINT CACUL1 anti tag coimmunoprecipitation, fluorescence microscopy, pull down colocalization, direct interaction, physical association 23178685 , (Europe PMC )0.57 IntAct, MINT CFL1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT CSRP1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT CUEDC2 Affinity Capture-Western, anti tag coimmunoprecipitation, pull down physical, physical association 17347654 , 21572428 , (Europe PMC )0.52 BioGRID, IntAct, MINT CXCL1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT EGFR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17284441 , 20935677 , 28065597 , (Europe PMC )0.40, 0.52 BioGRID, IntAct, MINT EPSTI1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT GLCE Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT GRIP1 Reconstituted Complex, Two-hybrid, pull down direct interaction, physical, physical association 17545996 , 17932106 , 9773983 , (Europe PMC )0.61 BioGRID, IntAct, MINT HBP1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT KDM6B anti bait coimmunoprecipitation physical association 21841772 , (Europe PMC )0.40 IntAct, MINT KLK5 two hybrid array physical association 25640309 , (Europe PMC )0.37 IntAct, MINT KLK9 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT LINC00312 anti tag coimmunoprecipitation, pull down, two hybrid direct interaction, physical association 15474036 , (Europe PMC )0.59 IntAct, MINT MAP3K1 coimmunoprecipitation phosphorylation reaction 15556606 , (Europe PMC )0.44 IntAct, MINT NCOA1 Affinity Capture-MS, Affinity Capture-Western, FRET, Protein-peptide, Reconstituted Complex, Two-hybrid, fluorescent resonance energy transfer, pull down, two hybrid physical, physical association 10454579 , 10598586 , 10731636 , 10760302 , 11003650 , 11014206 , 11113179 , 11358671 , 11376110 , 11682626 , 11867769 , 12554772 , 12574227 , 12630920 , 12714702 , 12738788 , 14715875 , 15140878 , 15604093 , 16606617 , 16957778 , 17363140 , 17627277 , 20608937 , 23975195 , 26487511 , 9121466 , 9192892 , 9192902 , 9259327 , 9427757 , 9773983 , 9774463 , (Europe PMC )0.80 BioGRID, IntAct, MINT NSD3 two hybrid array physical association 25640309 , (Europe PMC )0.37 IntAct, MINT PAGR1 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down physical, physical association 19039327 , (Europe PMC )0.52 BioGRID, IntAct, MINT PNRC2 Two-hybrid, beta lactamase complementation, two hybrid physical, physical association 11574675 , 15604093 , (Europe PMC )0.49 BioGRID, IntAct, MINT PRMT2 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, fluorescence microscopy, pull down, two hybrid colocalization, direct interaction, physical, physical association 12039952 , 22093364 , (Europe PMC )0.75 BioGRID, IntAct, MINT PSMB9 Co-localization, pull down physical, physical association 16957778 , (Europe PMC )0.40 BioGRID, IntAct, MINT PSMC3IP Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT PTPN1 phosphatase assay dephosphorylation reaction 7539106 , (Europe PMC )0.44 IntAct, MINT PTPN6 phosphatase assay dephosphorylation reaction 7539106 , (Europe PMC )0.44 IntAct, MINT SERPINB5 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT SRC Affinity Capture-Western, Co-localization, FRET, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity ligation assay, pull down association, physical, physical association 11013076 , 11032808 , 11564893 , 12630920 , 14766010 , 14963108 , 15020686 , 15784253 , 16957778 , 17043237 , 17284441 , 17400812 , 17627277 , 17921256 , 20935677 , 23065768 , 24051437 , 24498420 , (Europe PMC )0.40, 0.86 BioGRID, IntAct, MINT STAT5A Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down physical, physical association 11682624 , 15304355 , (Europe PMC )0.52 BioGRID, IntAct, MINT UBE4B two hybrid array physical association 25640309 , (Europe PMC )0.37 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCC5 pull down association 21182203 , (Europe PMC )0.35 IntAct ACTB Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient, pull down association, physical 20308691 , 20348541 , 21182203 , 21182205 , (Europe PMC )0.64 BioGRID, IntAct ACTC1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct ACTN1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ACTN4 Affinity Capture-Western, Reconstituted Complex physical 21078666 , (Europe PMC )NA BioGRID ACTN4 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct ACTR2 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology association, physical 20308691 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct ACTR3 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology association, physical 20308691 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct AGFG1 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID AHNAK Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct AHR Affinity Capture-Western, Reconstituted Complex physical 10620335 , 12612060 , 15837795 , 19460354 , (Europe PMC )NA BioGRID AHRR Affinity Capture-Western physical 18565642 , (Europe PMC )NA BioGRID AIFM1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct AKAP13 Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid direct interaction, physical, physical association 9627117 , (Europe PMC )0.59 BioGRID, IntAct AKAP8 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct AKT1 Biochemical Activity physical 11139588 , (Europe PMC )NA BioGRID AKT2 Affinity Capture-Western, Biochemical Activity physical 11507039 , (Europe PMC )NA BioGRID ALKBH7 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ALYREF Affinity Capture-MS, Reconstituted Complex physical 20348541 , 26487511 , (Europe PMC )NA BioGRID ANGPTL4 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT ANIB1 Affinity Capture-Western physical 9774463 , (Europe PMC )NA BioGRID ANP32A Affinity Capture-Western physical 15308690 , (Europe PMC )NA BioGRID ANP32B Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID ANXA2 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ANXA2P2 cosedimentation through density gradient association 21182205 , (Europe PMC )0.35 IntAct AP2A2 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID AP2M1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct APOD Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ARFGAP2 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID ARG1 Affinity Capture-MS, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct ARHGDIA Affinity Capture-Western physical 21447808 , (Europe PMC )NA BioGRID ARID1A Reconstituted Complex physical 17363140 , (Europe PMC )NA BioGRID ARID5A Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 15941852 , (Europe PMC )0.63 BioGRID, IntAct ARNT Reconstituted Complex physical 15837795 , (Europe PMC )NA BioGRID ARSB Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ASCC1 Affinity Capture-Western physical 25219498 , (Europe PMC )NA BioGRID ASF1A phage display, two hybrid direct interaction, physical association 21217774 , (Europe PMC )0.53 IntAct ASH2L Affinity Capture-MS, Affinity Capture-Western, pull down association, physical 16603732 , 21502505 , (Europe PMC )0.35 BioGRID, IntAct ASXL1 pull down, two hybrid direct interaction, physical association 16606617 , (Europe PMC )0.53 IntAct ATAD2 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array direct interaction, physical, physical association 17998543 , 25640309 , (Europe PMC )0.66 BioGRID, IntAct, MINT ATAD3A Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID ATAD3A affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct ATAD3C pull down association 21182203 , (Europe PMC )0.35 IntAct ATF1 phage display direct interaction 21217774 , (Europe PMC )0.44 IntAct ATP5F1B Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID ATP5F1B affinity chromatography technology, tandem affinity purification association 21182205 , 25604459 , (Europe PMC )0.53 IntAct ATP9A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct BAG1 Affinity Capture-Western, Reconstituted Complex physical 15538384 , 18388150 , 8524784 , (Europe PMC )NA BioGRID BAP1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT BARD1 Affinity Capture-Western physical 20060929 , 25740706 , (Europe PMC )NA BioGRID BCAR1 Affinity Capture-Western physical 15020686 , 19331827 , (Europe PMC )NA BioGRID BCAS2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 15694360 , (Europe PMC )NA BioGRID BCAS3 Affinity Capture-Western, Reconstituted Complex physical 17505058 , (Europe PMC )NA BioGRID BCL3 Affinity Capture-Western physical 16331275 , (Europe PMC )NA BioGRID BCLAF1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct BCOR Affinity Capture-MS, Affinity Capture-Western physical 26487511 , (Europe PMC )NA BioGRID BLCAP phage display, two hybrid direct interaction, physical association 21217774 , (Europe PMC )0.53 IntAct BLOC1S1 Affinity Capture-Western, Reconstituted Complex physical 12639951 , (Europe PMC )NA BioGRID BRCA1 Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down direct interaction, physical, physical association 11244506 , 11493692 , 11782371 , 12400015 , 15674350 , 16061635 , 16860316 , 17505062 , 19887647 , 20060929 , 25499220 , (Europe PMC )0.76 BioGRID, IntAct, MINT BRI3BP Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID BRI3BP affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct BTF3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid physical, physical association 18025262 , (Europe PMC )0.51 BioGRID, IntAct BUD13 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct C20orf197 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct C4A cross-linking study physical association 26153859 , (Europe PMC )0.40 IntAct CACUL1 anti tag coimmunoprecipitation, fluorescence microscopy, pull down colocalization, direct interaction, physical association 23178685 , (Europe PMC )0.57 IntAct, MINT CAD tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct CALM1 Reconstituted Complex physical 11981030 , (Europe PMC )NA BioGRID CAPRIN1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct CAPZB Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct CARM1 Affinity Capture-Western physical 28844863 , (Europe PMC )NA BioGRID CAT Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID CAV1 Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 11563984 , 19595769 , 22230296 , 23634843 , (Europe PMC )0.40 BioGRID, IntAct CBLL1 Affinity Capture-Western, Two-hybrid physical 20608937 , (Europe PMC )NA BioGRID CBR1 Affinity Capture-MS, pull down association, physical 23576398 , 26487511 , (Europe PMC )0.35 BioGRID, IntAct CCDC6 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct CCNC Affinity Capture-Western, Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID CCND1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 16061635 , 9039267 , (Europe PMC )NA BioGRID CCNH Affinity Capture-Western physical 12527756 , (Europe PMC )NA BioGRID CCNT1 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 15940264 , (Europe PMC )NA BioGRID CCT2 Affinity Capture-MS, Reconstituted Complex physical 20348541 , 26487511 , (Europe PMC )NA BioGRID CCT3 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct CCT7 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct CDC25B Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11689696 , (Europe PMC )NA BioGRID CDK11B Affinity Capture-Western, Reconstituted Complex physical 19122208 , (Europe PMC )NA BioGRID CDK2 Affinity Capture-Western, Biochemical Activity physical 23770852 , (Europe PMC )NA BioGRID CDK7 Biochemical Activity physical 10949034 , (Europe PMC )NA BioGRID CDK8 Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID CDKN1A Affinity Capture-Western, Reconstituted Complex physical 12897156 , 15743834 , 17911387 , (Europe PMC )NA BioGRID CEBPA Reconstituted Complex physical 9817600 , (Europe PMC )NA BioGRID CEBPB Affinity Capture-Western, Co-localization, Reconstituted Complex physical 16651265 , 19652226 , 7651415 , 9817600 , (Europe PMC )NA BioGRID CEBPB pull down direct interaction 7651415 , (Europe PMC )0.44 IntAct CENPS-CORT Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID CEP290 Affinity Capture-MS physical 23576398 , (Europe PMC )NA BioGRID CFAP47 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct CFL1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT CHD4 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct CHD6 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID CHD9 Reconstituted Complex, pull down physical, physical association 16554032 , (Europe PMC )0.40 BioGRID, IntAct CHUK Co-localization physical 15808510 , (Europe PMC )NA BioGRID CIRBP Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID CITED1 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down physical, physical association 11581164 , (Europe PMC )0.52 BioGRID, IntAct CLTC Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct CLTCL1 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct CNDP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID COPG2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct COPS5 Affinity Capture-Western physical 15899841 , (Europe PMC )NA BioGRID CORO1C Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID CREBBP Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11113179 , 11782371 , 14766010 , 16417649 , 17400812 , 18765668 , 9192902 , (Europe PMC )NA BioGRID CRIPAK Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 16278681 , (Europe PMC )0.40 BioGRID, IntAct CSRP1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT CTNNB1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 15304487 , (Europe PMC )0.40 BioGRID, IntAct CUEDC2 Affinity Capture-Western, anti tag coimmunoprecipitation, pull down physical, physical association 17347654 , 21572428 , (Europe PMC )0.52 BioGRID, IntAct, MINT CUL1 Affinity Capture-Western physical 23770852 , (Europe PMC )NA BioGRID CUL3 Affinity Capture-Western physical 18414007 , (Europe PMC )NA BioGRID CXCL1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT DAP3 Reconstituted Complex, pull down association, physical 10903152 , 21182203 , (Europe PMC )0.35 BioGRID, IntAct DARS Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct DBN1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct DCAF1 Affinity Capture-MS, Affinity Capture-Western physical 28068668 , (Europe PMC )NA BioGRID DCAF13 Affinity Capture-Western physical 28068668 , (Europe PMC )NA BioGRID DCTN2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct DDX1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID DDX17 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 12738788 , 19995069 , 20348541 , 20663877 , 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct DDX18 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DDX21 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DDX27 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DDX3X Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 20348541 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct DDX3Y Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DDX5 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, affinity chromatography technology, cosedimentation through density gradient, pull down, tandem affinity purification association, physical 12738788 , 19995069 , 20308691 , 20663877 , 21182205 , 25604459 , (Europe PMC )0.64 BioGRID, IntAct DDX50 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DDX54 Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, cosedimentation through density gradient association, physical 12466272 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct DECR1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DEK Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DHX15 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DHX30 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DHX9 Affinity Capture-MS, Reconstituted Complex physical 20348541 , 21182205 , (Europe PMC )NA BioGRID DHX9 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct DKC1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct DNAAF4 Affinity Capture-Western physical 19423554 , (Europe PMC )NA BioGRID DNAH2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DNAJA1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct DNAJA2 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNAJA3 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNAJB1 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNAJB11 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DNAJB4 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNAJB6 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNAJC10 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNAJC7 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNAJC9 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID DNM1L phage display, two hybrid direct interaction, physical association 21217774 , (Europe PMC )0.53 IntAct DNMT3L Reconstituted Complex physical 24952347 , (Europe PMC )NA BioGRID DNTTIP2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 15047147 , (Europe PMC )NA BioGRID DSG1 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct DUT Two-hybrid physical 15604093 , (Europe PMC )NA BioGRID DYNC1H1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct E2F1 Affinity Capture-Western physical 22216287 , (Europe PMC )NA BioGRID E2F6 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID EBI-2878106 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct EBI-4399559 comigration in sds page, mass spectrometry studies of complexes covalent binding, direct interaction 17392432 , (Europe PMC )0.56 IntAct EDF1 phage display direct interaction 21217774 , (Europe PMC )0.44 IntAct EEF2 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID EFTUD2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EGFR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17284441 , 20935677 , 28065597 , (Europe PMC )0.40, 0.52 BioGRID, IntAct, MINT EHMT2 Reconstituted Complex physical 21984853 , (Europe PMC )NA BioGRID EIF2S2 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID EIF4A1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct EIF4A3 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID EIF4G1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EIF4G3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EIF5A Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID EIF6 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID ELMSAN1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct EMD Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ENSG00000054598 chromatin immunoprecipitation assay association 25303530 , (Europe PMC )0.35 IntAct ENSG00000101040 chromatin immunoprecipitation assay association 26153859 , (Europe PMC )0.35 IntAct ENSG00000110092 chromatin immunoprecipitation assay association 22396492 , (Europe PMC )0.35 IntAct ENSG00000111305 chromatin immunoprecipitation assay association 26153859 , (Europe PMC )0.35 IntAct ENSG00000136997 chromatin immunoprecipitation assay association 22396492 , 25303530 , (Europe PMC )0.53 IntAct ENSG00000145901 chromatin immunoprecipitation assay association 25303530 , (Europe PMC )0.35 IntAct ENSG00000147862 chromatin immunoprecipitation assay association 26153859 , (Europe PMC )0.35 IntAct ENSG00000160182 chromatin immunoprecipitation assay association 15304487 , 15380516 , 19487245 , 25303530 , (Europe PMC )0.73 IntAct ENSG00000168646 chromatin immunoprecipitation assay association 15304487 , (Europe PMC )0.35 IntAct ENSG00000196208 chromatin immunoprecipitation assay association 25303530 , (Europe PMC )0.35 IntAct ENSG00000196620 chromatin immunoprecipitation assay association 19487245 , (Europe PMC )0.35 IntAct ENSG00000219481 chromatin immunoprecipitation assay association 26153859 , (Europe PMC )0.35 IntAct EP300 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay physical, physical association 11581164 , 11782371 , 11867769 , 12479814 , 12574227 , 12714702 , 12738788 , 14761960 , 15308690 , 16645043 , 18765668 , 19838210 , 19887647 , 20348541 , 20388208 , 22227247 , 23065768 , 25728767 , (Europe PMC )0.59 BioGRID, IntAct EP400 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EPB41L5 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EPPK1 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID EPPK1 cosedimentation through density gradient association 21182205 , (Europe PMC )0.35 IntAct EPRS Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct EPSTI1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT ERBB2 Affinity Capture-Western physical 15173068 , (Europe PMC )NA BioGRID ERBB4 Affinity Capture-Western physical 19439407 , (Europe PMC )NA BioGRID ESR1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, FRET, Reconstituted Complex, Two-hybrid, affinity chromatography technology, bioluminescence resonance energy transfer, cosedimentation through density gradient, proximity ligation assay, pull down, transcriptional complementation assay, two hybrid, x-ray crystallography association, direct interaction, physical, physical association 11265755 , 11682626 , 12198596 , 12554772 , 18474858 , 19022902 , 19117995 , 20348541 , 20353944 , 21182205 , 23065768 , 23159625 , 23576398 , (Europe PMC )0.61, 0.84 BioGRID, IntAct ESR2 Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti bait coimmunoprecipitation, bioluminescence resonance energy transfer, cosedimentation through density gradient, pull down association, physical, physical association 10706629 , 12630920 , 19022902 , 19746436 , 21182203 , 9473491 , (Europe PMC )0.52, 0.53 BioGRID, IntAct ESRRA Reconstituted Complex physical 9395481 , (Europe PMC )NA BioGRID ESRRB fluorescent resonance energy transfer physical association 19755138 , (Europe PMC )0.40 IntAct EWSR1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct EXOSC10 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct EXOSC4 pull down association 21182203 , (Europe PMC )0.35 IntAct EZH2 Affinity Capture-Western, Reconstituted Complex physical 17502350 , (Europe PMC )NA BioGRID FARSA Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID FASN tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct FBH1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID FBXO45 Affinity Capture-MS, Affinity Capture-Western physical 26487511 , (Europe PMC )NA BioGRID FHL1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 19401155 , 22094188 , (Europe PMC )0.40 BioGRID, IntAct FHL2 Two-hybrid physical 15666801 , (Europe PMC )NA BioGRID FIP1L1 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID FKBP4 Reconstituted Complex physical 9222609 , (Europe PMC )NA BioGRID FKBP5 Affinity Capture-MS, Reconstituted Complex physical 27483141 , 9222609 , (Europe PMC )NA BioGRID FKBPL Affinity Capture-Western physical 23912458 , (Europe PMC )NA BioGRID FLII Reconstituted Complex physical 19720835 , (Europe PMC )NA BioGRID FLNA Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct FLNB Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct FMR1 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID FMR1 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct FOS Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17317669 , 25303530 , (Europe PMC )0.35 BioGRID, IntAct FOXA1 Affinity Capture-MS, Co-localization, anti tag coimmunoprecipitation association, physical 25303530 , 27926873 , 28336670 , (Europe PMC )0.35 BioGRID, IntAct FOXK2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 25740706 , (Europe PMC )NA BioGRID FOXO1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid physical, physical association 11353774 , 11435445 , 22266855 , (Europe PMC )0.51 BioGRID, IntAct FOXO4 Reconstituted Complex physical 11435445 , (Europe PMC )NA BioGRID FTSJ3 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID FTSJ3 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct FUBP1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID FUS Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct G3BP1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct G3BP2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GADD45A Affinity Capture-Western physical 10872826 , (Europe PMC )NA BioGRID GADD45G Reconstituted Complex physical 10872826 , (Europe PMC )NA BioGRID GALK1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct GAPDH Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GATA3 anti tag coimmunoprecipitation, chromatin immunoprecipitation assay, cross-linking study association, physical association 25303530 , 26153859 , (Europe PMC )0.62 IntAct GBP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GCN1 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID GLCE Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT GLYR1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GNAI1 Co-localization physical 22230296 , (Europe PMC )NA BioGRID GNAI2 Co-localization physical 22230296 , (Europe PMC )NA BioGRID GNAI3 Co-localization physical 22230296 , (Europe PMC )NA BioGRID GNB1 Affinity Capture-MS physical 21182205 , 26487511 , (Europe PMC )NA BioGRID GNB1 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct GNB2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , 26487511 , (Europe PMC )0.35 BioGRID, IntAct GNB4 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , 26487511 , (Europe PMC )0.35 BioGRID, IntAct GNL2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GNL3 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct GOLGA2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct GRHL2 cross-linking study physical association 26153859 , (Europe PMC )0.40 IntAct GRIP1 Reconstituted Complex, Two-hybrid, pull down direct interaction, physical, physical association 17545996 , 17932106 , 9773983 , (Europe PMC )0.61 BioGRID, IntAct, MINT GRWD1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID GSN Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 20308691 , 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct GSTM3 Affinity Capture-MS physical 23576398 , (Europe PMC )NA BioGRID GTF2B Reconstituted Complex physical 9259327 , (Europe PMC )NA BioGRID GTF2H1 Biochemical Activity, Reconstituted Complex physical 10949034 , (Europe PMC )NA BioGRID GTPBP4 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct H2AFX Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct H3F3A Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID H3F3B Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HACD3 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID HACD3 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct HAX1 phage display, two hybrid direct interaction, physical association 21217774 , (Europe PMC )0.53 IntAct HBP1 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT HDAC1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 14506733 , 14722073 , 15140878 , 15557281 , 17312152 , 21182205 , 24051437 , (Europe PMC )0.46 BioGRID, IntAct HDAC2 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient association, physical 17312152 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct HDAC3 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex physical 14722073 , 16469706 , 20348541 , 26487511 , (Europe PMC )NA BioGRID HDAC4 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 16051668 , 19893013 , (Europe PMC )NA BioGRID HDAC5 Reconstituted Complex physical 19893013 , (Europe PMC )NA BioGRID HDAC7 Affinity Capture-Western physical 19917725 , (Europe PMC )NA BioGRID HDAC9 Reconstituted Complex physical 19893013 , (Europe PMC )NA BioGRID HDLBP Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HECTD1 Affinity Capture-MS, Affinity Capture-Western physical 26166704 , 26389696 , (Europe PMC )NA BioGRID HEXIM1 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 15940264 , (Europe PMC )NA BioGRID HIF1A Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID HIF1A pull down association 21182205 , (Europe PMC )0.35 IntAct HIST1H2BC Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HIST1H2BD Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HIST1H2BE Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HIST1H2BF Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HIST1H2BG Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HIST1H2BI Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HIST2H2AC Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HNRNPA0 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 20348541 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPA1L2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPA2B1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA3 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPAB Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct HNRNPC Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HNRNPD Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct HNRNPF Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPH2 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID HNRNPK Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPM Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPR Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct HNRNPU affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct HNRNPUL1 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct HOXC10 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID HOXD9 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID HPCAL1 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct HSP90AA1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 11911945 , 12962497 , 15538384 , 16037132 , 17699868 , 18388150 , 20353944 , 21503962 , 22939624 , 23912458 , 27483141 , 9222609 , (Europe PMC )NA BioGRID HSP90AB1 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 22939624 , 27483141 , (Europe PMC )0.40 BioGRID, IntAct HSP90B1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID HSPA1A Affinity Capture-MS, Affinity Capture-Western physical 27483141 , (Europe PMC )NA BioGRID HSPA1L Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct HSPA2 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID HSPA4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 15538384 , 15556606 , 20348541 , 21503962 , 27483141 , 9222609 , (Europe PMC )NA BioGRID HSPA4L Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID HSPA5 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID HSPA5 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct HSPA6 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient, pull down association, physical 15538384 , 16037132 , 20308691 , 21182203 , 21182205 , 27483141 , 9774640 , (Europe PMC )0.60 BioGRID, IntAct HSPA9 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , 27483141 , (Europe PMC )0.35 BioGRID, IntAct HSPB1 Affinity Capture-MS, Reconstituted Complex physical 20348541 , 23576398 , (Europe PMC )NA BioGRID HSPB8 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID HSPD1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , 26389696 , (Europe PMC )0.35 BioGRID, IntAct HSPE1 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID HSPH1 Affinity Capture-MS physical 27483141 , (Europe PMC )NA BioGRID HUWE1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct HYOU1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct IARS tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct IGF1R Affinity Capture-Western physical 14764897 , 16113100 , 24051437 , (Europe PMC )NA BioGRID IKBKE Affinity Capture-Western physical 26186972 , (Europe PMC )NA BioGRID IL25 pull down association 21182203 , (Europe PMC )0.35 IntAct ILF2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct ILF3 Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct IMPDH2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct ING1 Reconstituted Complex physical 14630091 , (Europe PMC )NA BioGRID INTS1 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct IQGAP1 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct IRS1 Affinity Capture-Western physical 12821935 , (Europe PMC )NA BioGRID IRS2 Affinity Capture-Western physical 12821935 , (Europe PMC )NA BioGRID ISL1 Affinity Capture-Western, Reconstituted Complex physical 11043578 , (Europe PMC )NA BioGRID JMJD6 anti bait coimmunoprecipitation, demethylase assay, proximity ligation assay, pull down association, demethylation reaction, physical association 24498420 , (Europe PMC )0.66 IntAct JUN Affinity Capture-Western, Reconstituted Complex physical 11477071 , 17317669 , 23747343 , (Europe PMC )NA BioGRID JUP Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct KARS Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID KAT5 Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, pull down physical, physical association 11591700 , 17418098 , 22081016 , (Europe PMC )0.52 BioGRID, IntAct KAT6A Affinity Capture-Western physical 17697320 , (Europe PMC )NA BioGRID KATNAL2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KDM1A Affinity Capture-Western physical 17289570 , (Europe PMC )NA BioGRID KDM4B Affinity Capture-MS, Affinity Capture-Western, Co-fractionation physical 21502505 , (Europe PMC )NA BioGRID KDM5A Affinity Capture-Western, Reconstituted Complex physical 11358960 , (Europe PMC )NA BioGRID KDM6B anti bait coimmunoprecipitation physical association 21841772 , (Europe PMC )0.40 IntAct, MINT KHDRBS1 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID KHDRBS1 cosedimentation through density gradient association 21182205 , (Europe PMC )0.35 IntAct KIF1A Two-hybrid physical 15604093 , (Europe PMC )NA BioGRID KLF5 Affinity Capture-Western, Reconstituted Complex physical 19569049 , (Europe PMC )NA BioGRID KLK5 Two-hybrid physical 25640309 , (Europe PMC )NA BioGRID KLK5 two hybrid array physical association 25640309 , (Europe PMC )0.37 IntAct, MINT KLK9 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT KMT2B pull down association, direct interaction 16603732 , (Europe PMC )0.52 IntAct KMT2D Affinity Capture-MS, Affinity Capture-Western, Co-localization physical 16603732 , 21502505 , 28336670 , (Europe PMC )NA BioGRID KMT5B Biochemical Activity physical 24101509 , (Europe PMC )NA BioGRID KRT1 Affinity Capture-MS physical 23576398 , (Europe PMC )NA BioGRID KRT10 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID KRT13 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KRT15 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KRT18 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID KRT19 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID KRT35 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KRT37 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KRT4 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KRT78 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KRT79 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct KRT8 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID LACTB affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct LANCL1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct LARP1 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct LARP4 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct LARS Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct LATS1 Affinity Capture-Western physical 28068668 , (Europe PMC )NA BioGRID LCOR Affinity Capture-Western, FRET, Reconstituted Complex, Two-hybrid physical 12535528 , (Europe PMC )NA BioGRID LDB1 Reconstituted Complex physical 19117995 , (Europe PMC )NA BioGRID LGALS7 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct LINC00312 anti tag coimmunoprecipitation, pull down, two hybrid direct interaction, physical association 15474036 , (Europe PMC )0.59 IntAct, MINT LMO4 Affinity Capture-Western, Reconstituted Complex physical 16288053 , (Europe PMC )NA BioGRID LMTK3 anti bait coimmunoprecipitation, protein kinase assay phosphorylation reaction, physical association 21602804 , (Europe PMC )0.54 IntAct LPCAT1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct LRIF1 Reconstituted Complex physical 17455211 , (Europe PMC )NA BioGRID LRRFIP1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct LUC7L3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct LUZP2 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct LYAR Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct LYZ pull down association 21182203 , (Europe PMC )0.35 IntAct MACROD1 anti bait coimmunoprecipitation, pull down, two hybrid physical association 17914104 , (Europe PMC )0.58 IntAct MAP3K1 coimmunoprecipitation phosphorylation reaction 15556606 , (Europe PMC )0.44 IntAct, MINT MAPK1 Biochemical Activity, Reconstituted Complex physical 11358671 , 12093745 , (Europe PMC )NA BioGRID MAPKAPK2 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MARS Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct MBD2 Co-localization physical 20300195 , (Europe PMC )NA BioGRID MCM2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct MDM2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid physical, physical association 10766163 , 11178989 , 12897156 , 17545634 , (Europe PMC )0.51 BioGRID, IntAct MED1 Affinity Capture-Western, FRET, Reconstituted Complex, Two-hybrid, pull down physical, physical association 10760302 , 10770935 , 11867769 , 12738788 , 15886699 , 9653119 , (Europe PMC )0.40 BioGRID, IntAct MED10 Affinity Capture-Western, Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED12 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 11867769 , 26487511 , (Europe PMC )NA BioGRID MED13 Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED14 Affinity Capture-Western, Reconstituted Complex physical 10770935 , 11867769 , (Europe PMC )NA BioGRID MED16 Affinity Capture-Western, Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED17 Reconstituted Complex, pull down association, physical 11867769 , 21182203 , (Europe PMC )0.35 BioGRID, IntAct MED20 Affinity Capture-Western, Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED21 Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED23 Affinity Capture-Western, Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED24 Affinity Capture-Western, Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED25 Affinity Capture-Western, Two-hybrid physical 17641689 , 24960263 , (Europe PMC )NA BioGRID MED27 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID MED30 pull down association 21182203 , (Europe PMC )0.35 IntAct MED4 pull down association 21182203 , (Europe PMC )0.35 IntAct MED6 Affinity Capture-Western, Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED7 Reconstituted Complex physical 11867769 , (Europe PMC )NA BioGRID MED9 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID MEN1 Affinity Capture-Western, Two-hybrid physical 16651450 , (Europe PMC )NA BioGRID MGMT Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11564893 , (Europe PMC )NA BioGRID MKI67 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID MKI67 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct MMS19 Reconstituted Complex physical 11279242 , (Europe PMC )NA BioGRID MNAT1 Affinity Capture-Western, Reconstituted Complex physical 12527756 , (Europe PMC )NA BioGRID MPG Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 14761960 , (Europe PMC )NA BioGRID MPRIP Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID MRPS15 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS17 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS2 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS22 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS27 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS31 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS35 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS6 pull down association 21182203 , (Europe PMC )0.35 IntAct MRPS9 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MSH2 Affinity Capture-Western, Reconstituted Complex physical 15886699 , (Europe PMC )NA BioGRID MTA1 Affinity Capture-Western, Reconstituted Complex physical 11146623 , 12167865 , 12639951 , 16807247 , (Europe PMC )NA BioGRID MTA2 Affinity Capture-Western, Reconstituted Complex physical 16645043 , (Europe PMC )NA BioGRID MTCH2 Two-hybrid physical 15604093 , (Europe PMC )NA BioGRID MTDH Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MTHFD1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID MTOR Affinity Capture-Western, Biochemical Activity physical 26522726 , (Europe PMC )NA BioGRID MUC1 Affinity Capture-Western, Reconstituted Complex physical 16427018 , (Europe PMC )NA BioGRID MVP Affinity Capture-Western, Reconstituted Complex physical 9628887 , (Europe PMC )NA BioGRID MYBBP1A Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 20348541 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct MYC Affinity Capture-Western physical 16455494 , (Europe PMC )NA BioGRID MYH14 Affinity Capture-MS, affinity chromatography technology, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.53 BioGRID, IntAct MYH9 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct MYL6 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, phage display association, direct interaction, physical 20308691 , 21182205 , 21217774 , (Europe PMC )0.64 BioGRID, IntAct MYL6B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MYLK2 Affinity Capture-MS, pull down, tandem affinity purification association, physical 21182203 , 21182205 , 25604459 , (Europe PMC )0.64 BioGRID, IntAct MYO1B Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct MYO1C Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct MYO6 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct MYOD1 Affinity Capture-Western physical 18765668 , (Europe PMC )NA BioGRID NAP1L4 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID NAT10 Affinity Capture-MS physical 21182205 , 26487511 , (Europe PMC )NA BioGRID NAT10 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct NCAPD2 Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID NCAPD3 Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID NCAPG Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID NCAPG2 Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID NCAPH Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID NCAPH2 Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID NCCRP1 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct NCL Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 20348541 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct NCOA1 Affinity Capture-MS, Affinity Capture-Western, FRET, Protein-peptide, Reconstituted Complex, Two-hybrid, fluorescent resonance energy transfer, pull down, two hybrid physical, physical association 10454579 , 10598586 , 10731636 , 10760302 , 11003650 , 11014206 , 11113179 , 11358671 , 11376110 , 11682626 , 11867769 , 12554772 , 12574227 , 12630920 , 12714702 , 12738788 , 14715875 , 15140878 , 15604093 , 16606617 , 16957778 , 17363140 , 17627277 , 20608937 , 23975195 , 26487511 , 9121466 , 9192892 , 9192902 , 9259327 , 9427757 , 9773983 , 9774463 , (Europe PMC )0.80 BioGRID, IntAct, MINT NCOA2 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, FRET, Protein-peptide, Reconstituted Complex, Two-hybrid, pull down, transcriptional complementation assay, two hybrid association, physical, physical association 11014206 , 11265755 , 11376110 , 11937504 , 12554772 , 12612084 , 12630920 , 12714702 , 14766010 , 15657427 , 16645043 , 17697320 , 18499756 , 19460354 , 20348541 , 26487511 , 9192892 , 9430642 , 9774463 , (Europe PMC )0.58 BioGRID, IntAct NCOA3 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, FRET, Protein-peptide, Reconstituted Complex, Two-hybrid, cross-linking study, pull down association, physical, physical association 10490106 , 11050174 , 11353774 , 11376110 , 11389589 , 12554772 , 12630920 , 12714702 , 14766010 , 15145444 , 15383283 , 16331275 , 16923966 , 17158759 , 17646391 , 18484708 , 18645020 , 19491275 , 20181721 , 20392877 , 21182203 , 25728767 , 26153859 , 26166704 , 26487511 , 28844863 , 9192892 , 9346901 , 9765300 , (Europe PMC )0.69 BioGRID, IntAct NCOA4 Reconstituted Complex physical 9892017 , (Europe PMC )NA BioGRID NCOA5 pull down physical association 11113208 , (Europe PMC )0.40 IntAct NCOA6 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 10567404 , 10681503 , 10866662 , 11773444 , 16794079 , 26487511 , (Europe PMC )0.37 BioGRID, IntAct NCOA7 Reconstituted Complex physical 11971969 , 9259327 , (Europe PMC )NA BioGRID NCOR1 Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, pull down association, physical 12145334 , 12738788 , 16469706 , 17400812 , 21182203 , 24051437 , (Europe PMC )0.35 BioGRID, IntAct NCOR2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12738788 , 14715875 , 20392877 , 9171229 , (Europe PMC )NA BioGRID NDC80 Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID NDRG2 phage display, two hybrid direct interaction, physical association 21217774 , (Europe PMC )0.53 IntAct NELFB Affinity Capture-Western, Reconstituted Complex physical 15342491 , (Europe PMC )NA BioGRID NFKB1 anti bait coimmunoprecipitation, pull down direct interaction, physical association 19350539 , 7651415 , (Europe PMC )0.68 IntAct NFKB2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct NFYA Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID NME2 Affinity Capture-MS physical 23576398 , (Europe PMC )NA BioGRID NONO Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct NOP2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct NOP56 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct NOP58 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct NOS3 anti bait coimmunoprecipitation association 17921256 , (Europe PMC )0.35 IntAct NPM1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient, pull down association, physical 20308691 , 20348541 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct NPPA Two-hybrid physical 15604093 , (Europe PMC )NA BioGRID NR0B2 Reconstituted Complex, Two-hybrid physical 11861507 , 9773978 , (Europe PMC )NA BioGRID NR1H4 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17333335 , 25675114 , (Europe PMC )0.40 BioGRID, IntAct NR2C1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 12093804 , (Europe PMC )0.40 BioGRID, IntAct NR2C2 Reconstituted Complex physical 11844790 , (Europe PMC )NA BioGRID NR2F1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12093745 , 9395481 , (Europe PMC )NA BioGRID NR2F6 Reconstituted Complex physical 10713182 , (Europe PMC )NA BioGRID NRIP1 Affinity Capture-Western, Far Western, Reconstituted Complex, Two-hybrid, cross-linking study, pull down association, physical, physical association 16439465 , 21182203 , 26153859 , 26166704 , 7641693 , 8887632 , 9115274 , 9192902 , (Europe PMC )0.56 BioGRID, IntAct NSD1 Two-hybrid physical 23975195 , (Europe PMC )NA BioGRID NSD2 Biochemical Activity physical 24101509 , (Europe PMC )NA BioGRID NSD3 Two-hybrid physical 25640309 , (Europe PMC )NA BioGRID NSD3 two hybrid array physical association 25640309 , (Europe PMC )0.37 IntAct, MINT NSF Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID NUDT21 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID NUMA1 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID NUMA1 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct NUP153 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct OTUB1 Affinity Capture-Western, Biochemical Activity physical 19383985 , (Europe PMC )NA BioGRID P4HB Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID PA2G4 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID PABPC1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct PABPC1L tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PABPC3 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PABPC5 pull down association 21182203 , (Europe PMC )0.35 IntAct PAGR1 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down physical, physical association 19039327 , (Europe PMC )0.52 BioGRID, IntAct, MINT PAK1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 12374744 , 16452229 , (Europe PMC )NA BioGRID PAK6 Reconstituted Complex physical 11773441 , (Europe PMC )NA BioGRID PARP1 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient association, physical 16794079 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct PATZ1 Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID PBX1 Co-localization physical 28336670 , (Europe PMC )NA BioGRID PBXIP1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid association, direct interaction, physical association 17043237 , (Europe PMC )0.37, 0.58, 0.59 IntAct PDIA3 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID PDIA6 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PDLIM1 Affinity Capture-Western physical 19117995 , (Europe PMC )NA BioGRID PELP1 Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, affinity chromatography technology, cosedimentation through density gradient association, physical 11481323 , 14963108 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct PFN1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, pull down association, physical 23576398 , (Europe PMC )0.35 BioGRID, IntAct PGAM5 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct PGC Reconstituted Complex physical 15784253 , (Europe PMC )NA BioGRID PGK2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PGR Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, chromatin immunoprecipitation assay, confocal microscopy, cross-linking study, pull down, two hybrid association, colocalization, direct interaction, physical, physical association 12612073 , 22396492 , 26153859 , (Europe PMC )0.37, 0.59, 0.77 BioGRID, IntAct PHB Reconstituted Complex physical 17932104 , (Europe PMC )NA BioGRID PHB2 Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid physical 10938099 , 12943695 , 15140878 , 17932104 , 24051437 , 26052702 , (Europe PMC )NA BioGRID PHB2 pull down, two hybrid physical association 10359819 , (Europe PMC )0.51 IntAct PHGDH tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PIAS1 Two-hybrid physical 15666801 , (Europe PMC )NA BioGRID PIAS2 Reconstituted Complex physical 11117529 , (Europe PMC )NA BioGRID PIK3CA Affinity Capture-Western physical 11029009 , 24051437 , (Europe PMC )NA BioGRID PIK3R1 Affinity Capture-Western, anti bait coimmunoprecipitation, proximity ligation assay association, physical, physical association 11029009 , 11689445 , 17043237 , 23065768 , (Europe PMC )0.56 BioGRID, IntAct PIK3R2 Affinity Capture-Western physical 15020686 , (Europe PMC )NA BioGRID PLA2G7 pull down association 21182203 , (Europe PMC )0.35 IntAct PLEC Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct PLOD3 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PNMT Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PNRC2 Two-hybrid, beta lactamase complementation, two hybrid physical, physical association 11574675 , 15604093 , (Europe PMC )0.49 BioGRID, IntAct, MINT POF1B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct POLR2A Affinity Capture-Western, Co-localization, Reconstituted Complex physical 16957778 , 20308691 , 20348541 , (Europe PMC )NA BioGRID POLR2B Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2C Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2D Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2E Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2F Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2G Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2H Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2I Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2J Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2K Co-localization physical 16957778 , (Europe PMC )NA BioGRID POLR2L Co-localization physical 16957778 , (Europe PMC )NA BioGRID POP1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct POU2F1 Reconstituted Complex physical 10480874 , (Europe PMC )NA BioGRID POU2F2 Reconstituted Complex physical 10480874 , (Europe PMC )NA BioGRID POU4F1 Reconstituted Complex, Two-hybrid physical 9448000 , (Europe PMC )NA BioGRID POU4F2 Reconstituted Complex, Two-hybrid physical 9448000 , (Europe PMC )NA BioGRID PPARGC1A Reconstituted Complex, two hybrid physical, physical association 10748020 , 12522104 , (Europe PMC )0.37 BioGRID, IntAct PPARGC1B Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 11854298 , 17631495 , (Europe PMC )0.37 BioGRID, IntAct PPIA Affinity Capture-MS physical 23576398 , (Europe PMC )NA BioGRID PPIB Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID PPID Reconstituted Complex physical 9222609 , (Europe PMC )NA BioGRID PPP1CA Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct PPP1CC Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct PPP1R14C Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PPP2CA Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID PPP2CB Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID PPP2R1A Affinity Capture-MS, Reconstituted Complex physical 20348541 , 26389696 , (Europe PMC )NA BioGRID PPP2R3A Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID PPP5C Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 14764652 , (Europe PMC )0.63 BioGRID, IntAct PPP6R1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PQBP1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID PRDM2 Affinity Capture-Western, Two-hybrid physical 10706618 , 15282304 , 19746436 , (Europe PMC )NA BioGRID PRDX2 Affinity Capture-MS physical 23576398 , (Europe PMC )NA BioGRID PRDX3 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PRKCSH Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct PRKCZ Affinity Capture-Western physical 18313384 , (Europe PMC )NA BioGRID PRKDC Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology association, physical 16794079 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct PRMT1 Reconstituted Complex physical 11050077 , (Europe PMC )NA BioGRID PRMT2 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, fluorescence microscopy, pull down, two hybrid colocalization, direct interaction, physical, physical association 12039952 , 22093364 , (Europe PMC )0.75 BioGRID, IntAct, MINT PRPF19 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID PRPF4B Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct PRPF8 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID PRR12 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID PSIP1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct PSMB9 Co-localization, pull down physical, physical association 16957778 , (Europe PMC )0.40 BioGRID, IntAct, MINT PSMC1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PSMC2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PSMC3IP Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT PSMC4 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PSMC5 Reconstituted Complex physical 8598193 , (Europe PMC )NA BioGRID PSMD1 Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct PSMD2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct PSPC1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID PTCD3 pull down association 21182203 , (Europe PMC )0.35 IntAct PTEN Reconstituted Complex physical 15205473 , (Europe PMC )NA BioGRID PTGES3 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 18388150 , 27483141 , 9222609 , (Europe PMC )NA BioGRID PTMA Reconstituted Complex physical 12943695 , (Europe PMC )NA BioGRID PTPN1 phosphatase assay dephosphorylation reaction 7539106 , (Europe PMC )0.44 IntAct, MINT PTPN6 phosphatase assay dephosphorylation reaction 7539106 , (Europe PMC )0.44 IntAct, MINT RABGEF1 Affinity Capture-Western physical 21356307 , (Europe PMC )NA BioGRID RAC3 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, phage display, pull down, two hybrid direct interaction, physical, physical association 21217774 , (Europe PMC )0.64 BioGRID, IntAct RACK1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID RAD50 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID RAD51 Affinity Capture-Western physical 25499220 , (Europe PMC )NA BioGRID RAN Affinity Capture-Western physical 22266855 , (Europe PMC )NA BioGRID RANBP9 Reconstituted Complex physical 16595702 , (Europe PMC )NA BioGRID RARA anti tag coimmunoprecipitation, chromatin immunoprecipitation assay, tandem affinity purification association 25303530 , 25604459 , (Europe PMC )0.60 IntAct RARB tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct RARG anti tag coimmunoprecipitation association 25303530 , (Europe PMC )0.35 IntAct RBBP4 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 18577416 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct RBBP5 Affinity Capture-MS, Affinity Capture-Western, pull down association, physical 16603732 , 21502505 , (Europe PMC )0.35 BioGRID, IntAct RBBP6 Affinity Capture-Western physical 20184719 , (Europe PMC )NA BioGRID RBBP7 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 18577416 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct RBCK1 Affinity Capture-Western, Reconstituted Complex physical 23042805 , 23912458 , (Europe PMC )NA BioGRID RBFOX2 Reconstituted Complex, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 11875103 , (Europe PMC )0.58 BioGRID, IntAct RBM14 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RBM23 Reconstituted Complex physical 15694343 , (Europe PMC )NA BioGRID RBM28 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RBM39 Affinity Capture-MS, Reconstituted Complex, Two-hybrid, affinity chromatography technology, cosedimentation through density gradient association, physical 11704680 , 15694343 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RBMX Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RBX1 Affinity Capture-Western physical 23770852 , (Europe PMC )NA BioGRID RDX Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RELA Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down direct interaction, physical, physical association 16331275 , 16497877 , 17932106 , 19350539 , 7651415 , (Europe PMC )0.78 BioGRID, IntAct REXO4 Reconstituted Complex physical 10908561 , (Europe PMC )NA BioGRID RLIM Affinity Capture-Western, Reconstituted Complex physical 19117995 , (Europe PMC )NA BioGRID RNF31 Affinity Capture-Western physical 24441041 , (Europe PMC )NA BioGRID RNF4 Two-hybrid physical 9710597 , (Europe PMC )NA BioGRID RNF40 Affinity Capture-Western physical 24441044 , (Europe PMC )NA BioGRID RPL10 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID RPL10 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct RPL10A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL11 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL12 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL13 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL13A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL14 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL15 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct RPL17 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL18 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL18A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL19 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL21 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL22 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL23A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL24 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL27A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL28 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL29 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL3 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL36 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL36A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL36AL Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.60 BioGRID, IntAct RPL37A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL4 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL5 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPL6 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL7 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL7A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPL8 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , 26487511 , (Europe PMC )0.46 BioGRID, IntAct RPL9 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPLP0 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, pull down, tandem affinity purification association, physical 20308691 , 21182203 , 21182205 , 25604459 , (Europe PMC )0.69 BioGRID, IntAct RPLP0P6 pull down, tandem affinity purification association 21182203 , 25604459 , (Europe PMC )0.53 IntAct RPN1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPN2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS11 pull down association 21182203 , (Europe PMC )0.35 IntAct RPS12 Affinity Capture-MS, affinity chromatography technology, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.53 BioGRID, IntAct RPS13 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPS14 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct RPS15A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPS16 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS18 Affinity Capture-MS, cosedimentation through density gradient, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct RPS2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS20 Affinity Capture-MS, affinity chromatography technology, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct RPS23 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS24 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPS26 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct RPS26P11 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct RPS3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RPS3A Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID RPS3A affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct RPS4X Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, pull down, tandem affinity purification association, physical 20308691 , 21182203 , 21182205 , 25604459 , (Europe PMC )0.69 BioGRID, IntAct RPS5 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct RPS6 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS6KA1 Biochemical Activity physical 9528769 , (Europe PMC )NA BioGRID RPS6KA3 Affinity Capture-Western physical 11432835 , (Europe PMC )NA BioGRID RPS8 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPS9 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 20308691 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct RPSA Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID RPSA affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct RPTOR Affinity Capture-Western physical 26522726 , (Europe PMC )NA BioGRID RRP12 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RRP1B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RSL1D1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct RTCB Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID RUVBL1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct RUVBL2 Affinity Capture-MS, affinity chromatography technology, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.53 BioGRID, IntAct S100A7 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct S100A8 Affinity Capture-MS, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.53 BioGRID, IntAct SAFB Affinity Capture-Western, Reconstituted Complex physical 10707955 , 15066997 , 21527249 , (Europe PMC )NA BioGRID SAFB2 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down direct interaction, physical, physical association 12660241 , (Europe PMC )0.54 BioGRID, IntAct SARNP Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SARS2 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SASH1 Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID SCYL2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SEC16A tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct SEC22B tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct SEC61B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SEMG1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct SEMG2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct SENP5 phage display, two hybrid direct interaction, physical association 21217774 , (Europe PMC )0.53 IntAct SEPT2 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SEPT8 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SERBP1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SERPINB4 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SERPINB5 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT SERPINH1 Affinity Capture-MS, pull down association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SET Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SETD7 Biochemical Activity, Protein-peptide physical 18471979 , 24101509 , (Europe PMC )NA BioGRID SF1 pull down association 21182203 , (Europe PMC )0.35 IntAct SF3B1 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SFN Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SFPQ Reconstituted Complex, tandem affinity purification association, physical 20348541 , 25604459 , (Europe PMC )0.35 BioGRID, IntAct SGK3 Affinity Capture-RNA physical 21084382 , (Europe PMC )NA BioGRID SHC1 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 11773443 , 20935677 , (Europe PMC )0.40 BioGRID, IntAct SHMT2 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SHOC2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SIGLEC10 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SIN3A Affinity Capture-Western physical 16469706 , 19620290 , (Europe PMC )NA BioGRID SIN3B Affinity Capture-Western physical 16469706 , (Europe PMC )NA BioGRID SIRT1 Affinity Capture-Western physical 21920899 , (Europe PMC )NA BioGRID SKI Affinity Capture-Western physical 22227247 , (Europe PMC )NA BioGRID SKIL Affinity Capture-Western, Reconstituted Complex physical 22227247 , (Europe PMC )NA BioGRID SKP1 Affinity Capture-Western physical 23770852 , (Europe PMC )NA BioGRID SKP2 Affinity Capture-Western, Biochemical Activity physical 23770852 , (Europe PMC )NA BioGRID SLC25A20 Affinity Capture-Western physical 23178685 , (Europe PMC )NA BioGRID SLC25A5 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct SLC25A6 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct SMAD2 Affinity Capture-Western, Reconstituted Complex physical 11555647 , 20207742 , (Europe PMC )NA BioGRID SMAD3 Affinity Capture-Western physical 20207742 , (Europe PMC )NA BioGRID SMARCA2 Two-hybrid physical 9099865 , (Europe PMC )NA BioGRID SMARCA4 Reconstituted Complex, Two-hybrid physical 11003650 , 9099865 , (Europe PMC )NA BioGRID SMARCD1 Reconstituted Complex physical 12917342 , (Europe PMC )NA BioGRID SMARCD1 pull down physical association 12917342 , (Europe PMC )0.40 IntAct SMARCD3 Reconstituted Complex physical 17363140 , (Europe PMC )NA BioGRID SMARCE1 Affinity Capture-Western, Reconstituted Complex physical 12145209 , 16538531 , 17363140 , (Europe PMC )NA BioGRID SMC1A Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SMC2 Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID SMC3 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SMC4 Affinity Capture-Western physical 26166704 , (Europe PMC )NA BioGRID SMURF1 Affinity Capture-Western, Reconstituted Complex physical 20207742 , (Europe PMC )NA BioGRID SMYD2 Biochemical Activity physical 24101509 , (Europe PMC )NA BioGRID SMYD3 Affinity Capture-Western, Reconstituted Complex physical 19509295 , (Europe PMC )NA BioGRID SND1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SNRPD1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SNRPN Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID SNW1 two hybrid physical association 19934264 , (Europe PMC )0.37 IntAct SNX6 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID SOS2 Affinity Capture-Western physical 15173068 , (Europe PMC )NA BioGRID SP1 Affinity Capture-Western, Co-localization, Reconstituted Complex, cross-linking study, pull down direct interaction, physical 10681512 , 15084343 , 15557281 , 15705965 , 15987735 , 16439465 , 16651265 , 17312152 , 17656465 , 18765668 , 19652226 , 9328340 , (Europe PMC )0.56 BioGRID, IntAct SP2 Affinity Capture-Western physical 15987735 , (Europe PMC )NA BioGRID SP3 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down direct interaction, physical 10816575 , 16651265 , (Europe PMC )0.56 BioGRID, IntAct SPOP Affinity Capture-Western physical 18414007 , 25766326 , (Europe PMC )NA BioGRID SPTAN1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SPTBN1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRA1 Far Western physical 20398657 , (Europe PMC )NA BioGRID SRC Affinity Capture-Western, Co-localization, FRET, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity ligation assay, pull down association, physical, physical association 11013076 , 11032808 , 11564893 , 12630920 , 14766010 , 14963108 , 15020686 , 15784253 , 16957778 , 17043237 , 17284441 , 17400812 , 17627277 , 17921256 , 20935677 , 23065768 , 24051437 , 24498420 , (Europe PMC )0.40, 0.86 BioGRID, IntAct, MINT SRPK1 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID SRPK1 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct SRPK2 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID SRPK2 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct SRRM1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct SRRM2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRSF1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct SRSF2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct SRSF3 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRSF5 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRSF6 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SRSF7 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct STAT1 anti tag coimmunoprecipitation association 25303530 , (Europe PMC )0.35 IntAct STAT3 Affinity Capture-Western physical 11429412 , (Europe PMC )NA BioGRID STAT5A Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down physical, physical association 11682624 , 15304355 , (Europe PMC )0.52 BioGRID, IntAct, MINT STAU1 Affinity Capture-MS, affinity chromatography technology, pull down association, physical 21182203 , 21182205 , (Europe PMC )0.53 BioGRID, IntAct STOM Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID STUB1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 15538384 , 16037132 , 18388150 , 27483141 , (Europe PMC )NA BioGRID SUMO2 cross-linking study physical association 26153859 , (Europe PMC )0.40 IntAct SUPT16H Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct SUPT6H Affinity Capture-Western physical 24441044 , (Europe PMC )NA BioGRID SUV39H1 Biochemical Activity physical 24101509 , (Europe PMC )NA BioGRID SUZ12 Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID SVIL Two-hybrid physical 11792840 , (Europe PMC )NA BioGRID SYNCRIP Affinity Capture-MS, Reconstituted Complex, cosedimentation through density gradient association, physical 20348541 , 21182205 , 26487511 , (Europe PMC )0.35 BioGRID, IntAct TAB2 Affinity Capture-Western, Reconstituted Complex physical 16469706 , 22249258 , 27992601 , (Europe PMC )NA BioGRID TAB3 Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID TADA3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12034840 , 18089809 , 20413580 , (Europe PMC )NA BioGRID TAF1A Reconstituted Complex physical 12511607 , (Europe PMC )NA BioGRID TAF1B Affinity Capture-Western, Reconstituted Complex physical 12511607 , (Europe PMC )NA BioGRID TAF2 Two-hybrid physical 9765300 , (Europe PMC )NA BioGRID TBK1 Affinity Capture-Western physical 26186972 , (Europe PMC )NA BioGRID TBL1XR1 Affinity Capture-Western physical 16469706 , (Europe PMC )NA BioGRID TBL2 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct TBP Reconstituted Complex physical 11595744 , 9259327 , (Europe PMC )NA BioGRID TBR1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct TCERG1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID TCOF1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct TDG Affinity Capture-Western, Reconstituted Complex physical 12874288 , (Europe PMC )NA BioGRID TECR Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct TF Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct TFAP2C anti tag coimmunoprecipitation association 25303530 , (Europe PMC )0.35 IntAct TFF1 Phenotypic Enhancement genetic 18313384 , (Europe PMC )NA BioGRID TFRC Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct THEM6 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct THRAP3 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID THRAP3 affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct TIA1 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID TMOD3 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID TOP1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct TOP2A Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct TOP2B Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, cosedimentation through density gradient association, physical 16794079 , 21182205 , (Europe PMC )0.46 BioGRID, IntAct TOPBP1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID TP53 Affinity Capture-Western, Reconstituted Complex physical 10766163 , 17545634 , 26556313 , (Europe PMC )NA BioGRID TRAF3 Affinity Capture-Western physical 26186972 , (Europe PMC )NA BioGRID TRAF6 Affinity Capture-Western physical 19331827 , (Europe PMC )NA BioGRID TRAM1 Reconstituted Complex, Two-hybrid physical 11014206 , 12612084 , (Europe PMC )NA BioGRID TRIM24 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10598587 , 21164480 , 21182203 , 8598193 , 9115274 , 9259327 , 9774463 , (Europe PMC )0.64 BioGRID, IntAct TRIM25 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 17418098 , (Europe PMC )NA BioGRID TRIP12 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct TRIP4 Reconstituted Complex physical 10454579 , (Europe PMC )NA BioGRID TRPS1 cross-linking study physical association 26153859 , (Europe PMC )0.40 IntAct TRRAP Reconstituted Complex, Two-hybrid physical 12738788 , (Europe PMC )NA BioGRID TSC1 Affinity Capture-Western physical 15851513 , (Europe PMC )NA BioGRID TSC2 Affinity Capture-Western, Reconstituted Complex physical 15039427 , 15851513 , (Europe PMC )NA BioGRID TTC5 Affinity Capture-Western physical 21147850 , (Europe PMC )NA BioGRID TTK Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID TTN tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct TUBA1A Affinity Capture-Western physical 15556606 , (Europe PMC )NA BioGRID TUBA1B tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct TUBA1C Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID TUBAL3 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct TUBB Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID TUBB1 Affinity Capture-MS, Affinity Capture-Western physical 15556606 , (Europe PMC )NA BioGRID TUBB3 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct TUBB6 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct TUBG1 Affinity Capture-Western physical 25499220 , (Europe PMC )NA BioGRID TXNRD1 Affinity Capture-MS, confocal microscopy, fluorescence recovery after photobleaching, pull down colocalization, physical, physical association 15199063 , 26389696 , (Europe PMC )0.56 BioGRID, IntAct U2AF2 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct U2SURP Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct UBAP2L Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct UBB affinity chromatography technology, cosedimentation through density gradient association 21182205 , (Europe PMC )0.46 IntAct UBE2I Biochemical Activity, Two-hybrid physical 15666801 , 15961505 , (Europe PMC )NA BioGRID UBE3A Affinity Capture-Western physical 16314411 , 16772533 , 22865929 , (Europe PMC )NA BioGRID UBE3C Affinity Capture-MS, Affinity Capture-Western physical 26389696 , (Europe PMC )NA BioGRID UBE4B Two-hybrid physical 25640309 , (Europe PMC )NA BioGRID UBE4B two hybrid array physical association 25640309 , (Europe PMC )0.37 IntAct, MINT UBTF Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.46 BioGRID, IntAct UIMC1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 17311814 , (Europe PMC )NA BioGRID UNC45A Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct UPF1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct USP16 Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID UTP14A pull down association 21182203 , (Europe PMC )0.35 IntAct UTP3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct UXT anti tag coimmunoprecipitation physical association 28106301 , (Europe PMC )0.40 IntAct VAV3 Reconstituted Complex, pull down physical, physical association 18518979 , (Europe PMC )0.40 BioGRID, IntAct VCP Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID VPS13D Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID VPS13D {ECO:0000312|EMBL:CAE75586.1, cosedimentation through density gradient association 21182205 , (Europe PMC )0.35 IntAct WBP2 Affinity Capture-Western, Reconstituted Complex physical 16772533 , (Europe PMC )NA BioGRID WDR18 Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct WDR26 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct WDR36 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct WDR5 Affinity Capture-MS, Affinity Capture-Western physical 16603732 , 21502505 , (Europe PMC )NA BioGRID WDR5B pull down association 16603732 , (Europe PMC )0.35 IntAct WIPI1 Reconstituted Complex physical 15602573 , (Europe PMC )NA BioGRID WRNIP1 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct XBP1 Affinity Capture-Western, Reconstituted Complex physical 12954762 , (Europe PMC )NA BioGRID XPO1 Affinity Capture-Western physical 22266855 , (Europe PMC )NA BioGRID XRCC5 Affinity Capture-Western physical 16794079 , (Europe PMC )NA BioGRID XRCC6 Affinity Capture-Western physical 16794079 , (Europe PMC )NA BioGRID YARS Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID YBX1 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct YBX3 Affinity Capture-MS, affinity chromatography technology association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct YTHDF1 Affinity Capture-MS physical 26487511 , (Europe PMC )NA BioGRID YTHDF2 Affinity Capture-MS physical 21182205 , (Europe PMC )NA BioGRID YTHDF2 affinity chromatography technology association 21182205 , (Europe PMC )0.35 IntAct YWHAQ Reconstituted Complex physical 11266503 , (Europe PMC )NA BioGRID YWHAZ tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct ZBTB16 Reconstituted Complex physical 14521715 , (Europe PMC )NA BioGRID ZC3HAV1 pull down association 21182203 , (Europe PMC )0.35 IntAct ZDHHC21 Affinity Capture-Western physical 22031296 , (Europe PMC )NA BioGRID ZDHHC7 Affinity Capture-Western physical 22031296 , (Europe PMC )NA BioGRID ZNF131 Affinity Capture-Western physical 23159625 , (Europe PMC )NA BioGRID ZNF182 Affinity Capture-MS physical 26389696 , (Europe PMC )NA BioGRID ZNF366 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid direct interaction, physical association 17085477 , (Europe PMC )0.63 IntAct ZNF398 Reconstituted Complex physical 11779858 , (Europe PMC )NA BioGRID ZNF512B Affinity Capture-MS, cosedimentation through density gradient association, physical 21182205 , (Europe PMC )0.35 BioGRID, IntAct ZNHIT3 pull down association 21182203 , (Europe PMC )0.35 IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
ABL1 Y219_SIQGHNDyMCPATNQ , Y52_DSSKPAVyNYPEGAA , NA NA PhosphoSitePlus , AKT1 S167_GGRERLAsTNDKGSM , S305_IKRSKKNsLALSLTA , in vitro, in vivo 11139588 ,(Europe PMC )HPRD, PhosphoSitePlus , AKT2 S167_GGRERLAsTNDKGSM , in vitro, in vivo 11139588 , 11432835 , 11507039 , 9528769 ,(Europe PMC )HPRD, PhosphoSitePlus , AURKA S167_GGRERLAsTNDKGSM , S305_IKRSKKNsLALSLTA , NA NA PhosphoSitePlus , CDK2 S104_FPPLNSVsPSPLMLL , S106_PLNSVSPsPLMLLHP , S118_LHPPPQLsPFLQPHG , S294_RAANLWPsPLMIKRS , NA NA PhosphoSitePlus , CDK3 S104_FPPLNSVsPSPLMLL , S106_PLNSVSPsPLMLLHP , S118_LHPPPQLsPFLQPHG , NA NA PhosphoSitePlus , CDK7 S118_LHPPPQLsPFLQPHG , LTP, in vivo 10949034 , 12118371 , 15461668 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , CDK_group S104_FPPLNSVsPSPLMLL , S106_PLNSVSPsPLMLLHP , LTP 10428798 , 10949034 ,(Europe PMC )PhosphoELM , CHUK S118_LHPPPQLsPFLQPHG , NA NA PhosphoSitePlus , CSNK2A1 S167_GGRERLAsTNDKGSM , S282_EGRGEVGsAGDMRAA , S559_PTSRGGAsVEETDQS , NA NA PhosphoSitePlus , GSK-3_beta S102_GGFPPLNsVSPSPLM , S104_FPPLNSVsPSPLMLL , S106_PLNSVSPsPLMLLHP , S118_LHPPPQLsPFLQPHG , LTP 10949034 , 16076840 ,(Europe PMC )PhosphoELM , GSK3B S102_GGFPPLNsVSPSPLM , S104_FPPLNSVsPSPLMLL , S106_PLNSVSPsPLMLLHP , S118_LHPPPQLsPFLQPHG , NA NA PhosphoSitePlus , IKBKE S167_GGRERLAsTNDKGSM , NA NA PhosphoSitePlus , LCK Y537_CKNVVPLyDLLLEML , in vitro, in vivo 7539106 ,(Europe PMC )HPRD, PhosphoSitePlus , Lck Y537_CKNVVPLyDLLLEML , LTP 7539106 ,(Europe PMC )PhosphoELM , MAPK1 S104_FPPLNSVsPSPLMLL , S106_PLNSVSPsPLMLLHP , S118_LHPPPQLsPFLQPHG , LTP 10409727 , 12093745 , 15059947 , 9528769 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , MAPK14 S118_LHPPPQLsPFLQPHG , S294_RAANLWPsPLMIKRS , T311_NSLALSLtADQMVSA , LTP, in vitro, in vivo 12138194 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , MAPK3 S104_FPPLNSVsPSPLMLL , S106_PLNSVSPsPLMLLHP , S118_LHPPPQLsPFLQPHG , LTP 7491495 ,(Europe PMC )PhosphoELM , PhosphoSitePlus , MAPK_group S118_LHPPPQLsPFLQPHG , T311_NSLALSLtADQMVSA , LTP 12093745 , 12118371 , 12138194 ,(Europe PMC )PhosphoELM , MNAT1 S102_GGFPPLNsVSPSPLM , S104_FPPLNSVsPSPLMLL , S106_PLNSVSPsPLMLLHP , in vitro 10949034 , 8308015 ,(Europe PMC )HPRD, MTOR S104_FPPLNSVsPSPLMLL , S106_PLNSVSPsPLMLLHP , NA NA PhosphoSitePlus , PAK1 S305_IKRSKKNsLALSLTA , LTP, in vitro, in vivo 12374744 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , PAK4 S305_IKRSKKNsLALSLTA , NA NA PhosphoSitePlus , PKA_group S236_IDKNRRKsCQACRLR , LTP 9891036 ,(Europe PMC )PhosphoELM , PKB_beta S167_GGRERLAsTNDKGSM , LTP 11139588 ,(Europe PMC )PhosphoELM , PRKACA S236_IDKNRRKsCQACRLR , S305_IKRSKKNsLALSLTA , NA NA PhosphoSitePlus , RPS6KA1 S118_LHPPPQLsPFLQPHG , S167_GGRERLAsTNDKGSM , in vitro, in vivo 11139588 , 11432835 , 11507039 , 12093745 , 9528769 ,(Europe PMC )HPRD, PhosphoSitePlus , RPS6KA3 S167_GGRERLAsTNDKGSM , in vitro, in vivo 11139588 , 11432835 , 11507039 , 9528769 ,(Europe PMC )HPRD, PhosphoSitePlus , RPS6KB1 S167_GGRERLAsTNDKGSM , NA NA PhosphoSitePlus , RSK_group S118_LHPPPQLsPFLQPHG , S167_GGRERLAsTNDKGSM , LTP 11432835 , 7838153 ,(Europe PMC )PhosphoELM , SRC Y537_CKNVVPLyDLLLEML , LTP, in vitro, in vivo 7539106 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , TBK1 S305_IKRSKKNsLALSLTA , NA NA PhosphoSitePlus , Unknown S102_GGFPPLNsVSPSPLM , S104_FPPLNSVsPSPLMLL , S106_PLNSVSPsPLMLLHP , S118_LHPPPQLsPFLQPHG , S154_PAFYRPNsDNRRQGG , S167_GGRERLAsTNDKGSM , S212_CKAFFKRsIQGHNDY , S236_IDKNRRKsCQACRLR , S282_EGRGEVGsAGDMRAA , S294_RAANLWPsPLMIKRS , S305_IKRSKKNsLALSLTA , S46_LGEVYLDsSKPAVYN , S47_GEVYLDSsKPAVYNY , S554_HRLHAPTsRGGASVE , S559_PTSRGGAsVEETDQS , T311_NSLALSLtADQMVSA , Y219_SIQGHNDyMCPATNQ , Y52_DSSKPAVyNYPEGAA , Y537_CKNVVPLyDLLLEML , LTP 10949034 , 15193262 , 15528270 , 16452229 , 16741565 , 17627277 , 18984578 , 20043841 , 20101225 , 8308015 , 9528769 ,(Europe PMC )PhosphoELM ,