- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
CSNK1E
Gene Name  | CSNK1E (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 4HOK |
| Synonyms | CSNK1E | |
| Protein Name | CSNK1E | |
| Alternative Name(s) | Casein kinase I isoform epsilon;CKI-epsilon;CKIe;2.7.11.1; | |
| Protein Family | Belongs to the protein kinase superfamily CK1 Ser/Thrprotein kinase family Casein kinase I subfamily | |
| EntrezGene ID | 1454 102800317 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P49674 (protein sequence) | |
| Enzyme Class | 2.7.11.1 (BRENDA ) | |
| Molecular Weight | 47315 Dalton | |
| Protein Length | 416 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000213923 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG1164 | eggNOG - ENOG410XPGP | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Nucleus | |||
| Function (UniProt annotation) | |||
| Casein kinases are operationally defined by theirpreferential utilization of acidic proteins such as caseins assubstrates Can phosphorylate a large number of proteinsParticipates in Wnt signaling Phosphorylates DVL1 and DVL2Central component of the circadian clock In balance with PP1,determines the circadian period length, through the regulation ofthe speed and rhythmicity of PER1 and PER2 phosphorylationControls PER1 and PER2 nuclear transport and degradation Inhibitscytokine-induced granuloytic differentiation | |||
| Catalytic Activity (UniProt annotation) | |||
| ATP + a protein = ADP + a phosphoprotein | |||
| Protein Sequence | |||
| MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVM VMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDAR THQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQL RGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAGNTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVS RIPASQTSVPFDHLGK | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000086 | P:G2/M transition of mitotic cell cycle |
| GO:0003723 | F:RNA binding |
| GO:0004672 | F:protein kinase activity |
| GO:0004674 | F:protein serine/threonine kinase activity |
| GO:0005524 | F:ATP binding |
| GO:0005634 | C:nucleus |
| GO:0005654 | C:nucleoplasm |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0006281 | P:DNA repair |
| GO:0006468 | P:protein phosphorylation |
| GO:0006897 | P:endocytosis |
| GO:0007165 | P:signal transduction |
| GO:0008360 | P:regulation of cell shape |
| GO:0010389 | P:regulation of G2/M transition of mitotic cell cycle |
| GO:0016055 | P:Wnt signaling pathway |
| GO:0018105 | P:peptidyl-serine phosphorylation |
| GO:0032091 | P:negative regulation of protein binding |
| GO:0032436 | P:positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| GO:0032922 | P:circadian regulation of gene expression |
| GO:0042752 | P:regulation of circadian rhythm |
| GO:0060070 | P:canonical Wnt signaling pathway |
| GO:0097711 | P:ciliary basal body-plasma membrane docking |
| GO:1903827 | P:regulation of cellular protein localization |
| GO:1905426 | P:positive regulation of Wnt-mediated midbrain dopaminergic neuron differentiation |
| GO:2000052 | P:positive regulation of non-canonical Wnt signaling pathway |
CSNK1E is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in CSNK1E (P49674) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PPP1CA | P62136 | NA | In vitro | 9430669, | Europe PMC |  |
| PPP1CB | P62140 | NA | In vitro | 9430669, | Europe PMC | |
| PPP1CC | P36873 | NA | In vitro | 9430669, | Europe PMC | |
| PPP2CA | P67775 | NA | In vitro | 9430669, | Europe PMC | |
| PPP2CB | P62714 | NA | In vitro | 9430669, | Europe PMC | |
| PPP3CA | Q08209 | NA | In vitro | 9430669, | Europe PMC | |
| PPP3CB | P16298 | NA | In vitro | 9430669, | Europe PMC | |
| PPP3CC | P48454 | NA | In vitro | 9430669, | Europe PMC | |
| PPP5C | P53041 | NA | In vitro | 16790549, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04068 | FoxO signaling pathway | The forkhead box O (FOXO) family of transcription factors regulates the expression of genes in cellular physiological events including apoptosis, cell-cycle control, glucose metabolism, oxidative stress resistance, and longevity. A central regulatory mechanism of FOXO proteins is phosphorylation by the serine-threonine kinase Akt/protein kinase B (Akt/PKB), downstream of phosphatidylinositol 3-kinase (PI3K), in response to insulin or several growth factors. Phosphorylation at three conserved residues results in the export of FOXO proteins from the nucleus to the cytoplasm, thereby decreasing expression of FOXO target genes. In contrast, the stress-activated c-Jun N-terminal kinase (JNK) and the energy sensing AMP-activated protein kinase (AMPK), upon oxidative and nutrient stress stimuli phosphorylate and activate FoxOs. Aside from PKB, JNK and AMPK, FOXOs are regulated by multiple players through several post-translational modifications, including phosphorylation, but also acetylation, methylation and ubiquitylation. |
| hsa04310 | Wnt signaling pathway | Wnt proteins are secreted morphogens that are required for basic developmental processes, such as cell-fate specification, progenitor-cell proliferation and the control of asymmetric cell division, in many different species and organs. There are at least three different Wnt pathways: the canonical pathway, the planar cell polarity (PCP) pathway and the Wnt/Ca2+ pathway. In the canonical Wnt pathway, the major effect of Wnt ligand binding to its receptor is the stabilization of cytoplasmic beta-catenin through inhibition of the bea-catenin degradation complex. Beta-catenin is then free to enter the nucleus and activate Wnt-regulated genes through its interaction with TCF (T-cell factor) family transcription factors and concomitant recruitment of coactivators. Planar cell polarity (PCP) signaling leads to the activation of the small GTPases RHOA (RAS homologue gene-family member A) and RAC1, which activate the stress kinase JNK (Jun N-terminal kinase) and ROCK (RHO-associated coiled-coil-containing protein kinase 1) and leads to remodelling of the cytoskeleton and changes in cell adhesion and motility. WNT-Ca2+ signalling is mediated through G proteins and phospholipases and leads to transient increases in cytoplasmic free calcium that subsequently activate the kinase PKC (protein kinase C) and CAMKII (calcium calmodulin mediated kinase II) and the phosphatase calcineurin. |
| hsa04340 | Hedgehog signaling pathway | The Hedgehog (Hh) signaling pathway has numerous roles in the control of cell proliferation, tissue patterning, stem cell maintenance and development. The primary cilium is an important center for transduction of the Hedgehog signal in vertebrates. In Hh's absence, the Ptch receptor localizes to the cilium, where it inhibits Smo activation. Gli proteins are phosphorylated by PKA, CKI and GSK3B and partially degraded into truncated Gli repressor form (GliR) that suppresses Hh target gene transcription in the nucleus. In Hh's presence, Ptch disappears from the cilium, and activated Smo contributes to the translocation of the protein complex Gli, Sufu, Kif7 to ciliary tip, where Gli dissociates from the negative regulator Sufu. The production of Gli activator form (GliA) occurs and the increased nuclear accumulation of GliA results in activation transcription of Hh target genes. |
| hsa04390 | Hippo signaling pathway | Hippo signaling is an evolutionarily conserved signaling pathway that controls organ size from flies to humans. In humans and mice, the pathway consists of the MST1 and MST2 kinases, their cofactor Salvador and LATS1 and LATS2. In response to high cell densities, activated LATS1/2 phosphorylates the transcriptional coactivators YAP and TAZ, promoting its cytoplasmic localization, leading to cell apoptosis and restricting organ size overgrowth. When the Hippo pathway is inactivated at low cell density, YAP/TAZ translocates into the nucleus to bind to the transcription enhancer factor (TEAD/TEF) family of transcriptional factors to promote cell growth and proliferation. YAP/TAZ also interacts with other transcriptional factors or signaling molecules, by which Hippo pathway-mediated processes are interconnected with those of other key signaling cascades, such as those mediated by TGF-beta and Wnt growth factors. |
| hsa04392 | Hippo signaling pathway - multiple species | Hippo signaling pathways control diverse aspects of cell proliferation, survival, and morphogenesis in eukaryotes. The core organization of these networks is conserved over a billion years of evolution, with related forms described in animals and fungi. In Drosophila and mammals, Hippo/MST co-operate with Mats/Mob1 and Salvador/WW45 to activate Warts/LATS, which negatively regulates Yorkie/YAP. Yorkie/YAP interact with Scalloped/TEAD to promote gene transcriptions and control organ size through the balance between cell proliferation and apoptosis. In C. elegans, WTS-1 YAP-1 EGL-44 axis is conserved and regulates thermotolerance and healthy lifespan. In S. cerevisiae, the LATS-related Dbf2 or Dbf20 kinase in complex with Mob1 controls mitotic exit and cytokinesis, and the Hippo/MST family of kinases, STE-20, modulates Tec1, the putative yeast TEAD ortholog. |
| hsa04710 | Circadian rhythm | Circadian rhythm is an internal biological clock, which enables to sustain an approximately 24-hour rhythm in the absence of environmental cues. In mammals, the circadian clock mechanism consists of cell-autonomous transcription-translation feedback loops that drive rhythmic, 24-hour expression patterns of core clock components. The first negative feedback loop is a rhythmic transcription of period genes (PER1, PER2, and PER3) and chryptochrome genes (CRY1 and CRY2). PER and CRY proteins form a heterodimer, which acts on the CLOCK/BMAL1 heterodimer to repress its own transcription. PER and CRY proteins are phosphorylated by casein kinase epsilon (CKIepsilon), which leads to degradation and restarting of the cycle. The second loop is a positive feedback loop driven by the CLOCK/BMAL1 heterodimer, which initiates transcription of target genes containing E-box cis-regulatory enhancer sequences. |
| hsa04068 | FoxO signaling pathway | The forkhead box O (FOXO) family of transcription factors regulates the expression of genes in cellular physiological events including apoptosis, cell-cycle control, glucose metabolism, oxidative stress resistance, and longevity. A central regulatory mechanism of FOXO proteins is phosphorylation by the serine-threonine kinase Akt/protein kinase B (Akt/PKB), downstream of phosphatidylinositol 3-kinase (PI3K), in response to insulin or several growth factors. Phosphorylation at three conserved residues results in the export of FOXO proteins from the nucleus to the cytoplasm, thereby decreasing expression of FOXO target genes. In contrast, the stress-activated c-Jun N-terminal kinase (JNK) and the energy sensing AMP-activated protein kinase (AMPK), upon oxidative and nutrient stress stimuli phosphorylate and activate FoxOs. Aside from PKB, JNK and AMPK, FOXOs are regulated by multiple players through several post-translational modifications, including phosphorylation, but also acetylation, methylation and ubiquitylation. |
| hsa04310 | Wnt signaling pathway | Wnt proteins are secreted morphogens that are required for basic developmental processes, such as cell-fate specification, progenitor-cell proliferation and the control of asymmetric cell division, in many different species and organs. There are at least three different Wnt pathways: the canonical pathway, the planar cell polarity (PCP) pathway and the Wnt/Ca2+ pathway. In the canonical Wnt pathway, the major effect of Wnt ligand binding to its receptor is the stabilization of cytoplasmic beta-catenin through inhibition of the bea-catenin degradation complex. Beta-catenin is then free to enter the nucleus and activate Wnt-regulated genes through its interaction with TCF (T-cell factor) family transcription factors and concomitant recruitment of coactivators. Planar cell polarity (PCP) signaling leads to the activation of the small GTPases RHOA (RAS homologue gene-family member A) and RAC1, which activate the stress kinase JNK (Jun N-terminal kinase) and ROCK (RHO-associated coiled-coil-containing protein kinase 1) and leads to remodelling of the cytoskeleton and changes in cell adhesion and motility. WNT-Ca2+ signalling is mediated through G proteins and phospholipases and leads to transient increases in cytoplasmic free calcium that subsequently activate the kinase PKC (protein kinase C) and CAMKII (calcium calmodulin mediated kinase II) and the phosphatase calcineurin. |
| hsa04340 | Hedgehog signaling pathway | The Hedgehog (Hh) signaling pathway has numerous roles in the control of cell proliferation, tissue patterning, stem cell maintenance and development. The primary cilium is an important center for transduction of the Hedgehog signal in vertebrates. In Hh's absence, the Ptch receptor localizes to the cilium, where it inhibits Smo activation. Gli proteins are phosphorylated by PKA, CKI and GSK3B and partially degraded into truncated Gli repressor form (GliR) that suppresses Hh target gene transcription in the nucleus. In Hh's presence, Ptch disappears from the cilium, and activated Smo contributes to the translocation of the protein complex Gli, Sufu, Kif7 to ciliary tip, where Gli dissociates from the negative regulator Sufu. The production of Gli activator form (GliA) occurs and the increased nuclear accumulation of GliA results in activation transcription of Hh target genes. |
| hsa04390 | Hippo signaling pathway | Hippo signaling is an evolutionarily conserved signaling pathway that controls organ size from flies to humans. In humans and mice, the pathway consists of the MST1 and MST2 kinases, their cofactor Salvador and LATS1 and LATS2. In response to high cell densities, activated LATS1/2 phosphorylates the transcriptional coactivators YAP and TAZ, promoting its cytoplasmic localization, leading to cell apoptosis and restricting organ size overgrowth. When the Hippo pathway is inactivated at low cell density, YAP/TAZ translocates into the nucleus to bind to the transcription enhancer factor (TEAD/TEF) family of transcriptional factors to promote cell growth and proliferation. YAP/TAZ also interacts with other transcriptional factors or signaling molecules, by which Hippo pathway-mediated processes are interconnected with those of other key signaling cascades, such as those mediated by TGF-beta and Wnt growth factors. |
| hsa04392 | Hippo signaling pathway - multiple species | Hippo signaling pathways control diverse aspects of cell proliferation, survival, and morphogenesis in eukaryotes. The core organization of these networks is conserved over a billion years of evolution, with related forms described in animals and fungi. In Drosophila and mammals, Hippo/MST co-operate with Mats/Mob1 and Salvador/WW45 to activate Warts/LATS, which negatively regulates Yorkie/YAP. Yorkie/YAP interact with Scalloped/TEAD to promote gene transcriptions and control organ size through the balance between cell proliferation and apoptosis. In C. elegans, WTS-1 YAP-1 EGL-44 axis is conserved and regulates thermotolerance and healthy lifespan. In S. cerevisiae, the LATS-related Dbf2 or Dbf20 kinase in complex with Mob1 controls mitotic exit and cytokinesis, and the Hippo/MST family of kinases, STE-20, modulates Tec1, the putative yeast TEAD ortholog. |
| hsa04710 | Circadian rhythm | Circadian rhythm is an internal biological clock, which enables to sustain an approximately 24-hour rhythm in the absence of environmental cues. In mammals, the circadian clock mechanism consists of cell-autonomous transcription-translation feedback loops that drive rhythmic, 24-hour expression patterns of core clock components. The first negative feedback loop is a rhythmic transcription of period genes (PER1, PER2, and PER3) and chryptochrome genes (CRY1 and CRY2). PER and CRY proteins form a heterodimer, which acts on the CLOCK/BMAL1 heterodimer to repress its own transcription. PER and CRY proteins are phosphorylated by casein kinase epsilon (CKIepsilon), which leads to degradation and restarting of the cycle. The second loop is a positive feedback loop driven by the CLOCK/BMAL1 heterodimer, which initiates transcription of target genes containing E-box cis-regulatory enhancer sequences. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-201688 | WNT mediated activation of DVL. | The three human Dishevelled (DVL) proteins play a central and overlapping role in the transduction of the WNT signaling cascade (Lee et al, 2008; reviewed in Gao and Chen 2010). DVL activity is regulated by phosphorylation, although the details are not completely worked out. DVL likely exists as a phosphoprotein even in the absence of WNT stimulation, and is further phosphorylated upon ligand binding. Casein kinase 1epsilon (CSNK1E), casein kinase 2 (CSNK2) and PAR1 have all been reported to phosphorylate DVL (Willert et al, 1997; Sun et al, 2001; Cong et al, 2004; Ossipova et al, 2005). Upon pathway activation, phosphorylated DVL translocates to the plasma membrane through an interaction between the DVL PDZ domain and the FZD KTxxxW motif (Wong et al, 2003; Umbhauer et al, 2000; Kikuchi et al, 2011). At the plasma membrane, DVL is believed to oligomerize through its DIX domain, providing a platform for AXIN recruitment; recruitment of AXIN is also facilitated by interaction with LRP (Schwarz-Romond et al, 2007; Mao et al, 2001). DVL interacts with phosphatidylinositol-4-kinase type II (PI4KII) and phophatidylinositol-4-phosphate 5-kinase type I (PIP5KI) to promote formation of phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2) in the membrane, which is required for the clustering and phosphorylation of LRP6 and the recruitment of AXIN (Pan et al, 2008; Qin et al, 2009) |
| R-HSA-2565942 | Regulation of PLK1 Activity at G2/M Transition. | The kinase activity of PLK1 is required for cell cycle progression as PLK1 phosphorylates and regulates a number of cellular proteins during mitosis. Centrosomic AURKA (Aurora A kinase), catalytically activated through AJUBA facilitated autophosphorylation on threonine residue T288 at G2/M transition (Hirota et al. 2003), activates PLK1 on centrosomes by phosphorylating threonine residue T210 of PLK1, critical for PLK1 activity (Jang et al. 2002), in the presence of BORA (Macurek et al. 2008, Seki et al. 2008). Once activated, PLK1 phosphorylates BORA and targets it for ubiquitination mediated degradation by SCF-beta-TrCP ubiquitin ligases. Degradation of BORA is thought to allow PLK1 to interact with other substrates (Seki, Coppinger, Du et al. 2008, Seki et al. 2008).The interaction of PLK1 with OPTN (optineurin) provides a negative-feedback mechanism for regulation of PLK1 activity. Phosphorylated PLK1 binds and phosphorylates OPTN associated with the Golgi membrane GTPase RAB8, promoting dissociation of OPTN from Golgi and translocation of OPTN to the nucleus. Phosphorylated OPTN facilitates the mitotic phosphorylation of the myosin phosphatase subunit PPP1R12A (MYPT1) and myosin phosphatase activation (Kachaner et al. 2012). The myosin phosphatase complex dephosphorylates threonine residue T210 of PLK1 and inactivates PLK1 (Yamashiro et al. 2008) |
| R-HSA-380259 | Loss of Nlp from mitotic centrosomes. | During interphase, Nlp interacts with gamma-tubulin ring complexes (gamma-TuRC), and is thought to contribute to the organization of interphase microtubules (Casenghi et al.,2003). Plk1 is activated at the onset of mitosis and phosphorylates Nlp triggering its displacement from the centrosome (Casenghi et al.,2003). Removal of Nlp appears to contribute to the establishment of a mitotic scaffold with enhanced microtubule nucleation activity |
| R-HSA-380270 | Recruitment of mitotic centrosome proteins and complexes. | The mitotic spindle becomes established once centrosomes have\r migrated to opposite poles and the nuclear envelope has broken down. During this stage, interphase centrosomes mature into mitotic centrosomes\r recruiting additional gamma TuRC complexes and acquiring mitosis-associated centrosomal proteins including NuMA, Plk1 and CDK11p58 (reviewed in Schatten 2008; Raynaud-Messina and Merdes 2007) |
| R-HSA-380284 | Loss of proteins required for interphase microtubule organization from the centrosome. | In addition to recruiting proteins and complexes necessary for increased microtubule nucleation, centrosomal maturation involves the loss of proteins involved in interphase microtubule organization and centrosome cohesion (Casenghi et al., 2003; Mayor et al., 2002) |
| R-HSA-380320 | Recruitment of NuMA to mitotic centrosomes. | The NuMA protein, which functions as a nuclear matrix protein in interphase (Merdes and Cleveland 1998), redistributes to the cytoplasm following nuclear envelope breakdown where it plays an essential role in formation and maintenance of the spindle poles (Gaglio, et al., 1995; Gaglio, et al., 1996; Merdes et al, 1996). The mitotic activation of NuMA involves Ran-GTP-dependent dissociation from importin (Nachury et al, 2001, Wiese et al, 2001). NuMA is transported to the mitotic poles where it forms an insoluble crescent around centrosomes tethering microtubules into the bipolar configuration of the mitotic apparatus (Merdes et al., 2000; Kisurina-Evgenieva et al, 2004). Although NuMA is not a bona fide constituent of the mitotic centrosome but rather a protein associated with microtubules at the spindle pole, specific splice variants of NuMA have been identified that associate with the centrosome during interphase (Tang et al, 1994) |
| R-HSA-400253 | Circadian Clock. | At the center of the mammalian circadian clock is a negative transcription/translation-based feedback loop: The BMAL1:CLOCK/NPAS2 (ARNTL:CLOCK/NPAS2) heterodimer transactivates CRY and PER genes by binding E-box elements in their promoters; the CRY and PER proteins then inhibit transactivation by BMAL1:CLOCK/NPAS2. BMAL1:CLOCK/NPAS2 activates transcription of CRY, PER, and several other genes in the morning. Levels of PER and CRY proteins rise during the day and inhibit expression of CRY, PER, and other BMAL1:CLOCK/NPAS2-activated genes in the afternoon and evening. During the night CRY and PER proteins are targeted for degradation by phosphorylation and polyubiquitination, allowing the cycle to commence again in the morning. Transcription of the BMAL1 (ARNTL) gene is controlled by ROR-alpha and REV-ERBA (NR1D1), both of which are targets of BMAL1:CLOCK/NPAS2 in mice and both of which compete for the same element (RORE) in the BMAL1 promoter. ROR-alpha (RORA) activates transcription of BMAL1; REV-ERBA represses transcription of BMAL1. This mutual control forms a secondary, reinforcing loop of the circadian clock. REV-ERBA shows strong circadian rhythmicity and confers circadian expression on BMAL1. BMAL1 can form heterodimers with either CLOCK or NPAS2, which act redundantly but show different tissue specificity. The BMAL1:CLOCK and BMAL1:NPAS2 heterodimers activate a set of genes that possess E-box elements (consensus CACGTG) in their promoters. This confers circadian expression on the genes. The PER genes (PER1, PER2, PER3) and CRY genes (CRY1, CRY2) are among those activated by BMAL1:CLOCK and BMAL1:NPAS2. PER and CRY mRNA accumulates during the morning and the proteins accumulate during the afternoon. PER and CRY proteins form complexes in the cytosol and these are bound by either CSNK1D or CSNK1E kinases which phosphorylate PER and CRY. The phosphorylated PER:CRY:kinase complex is translocated into the nucleus due to the nuclear localization signal of PER and CRY. Within the nucleus the PER:CRY complexes bind BMAL1:CLOCK and BMAL1:NPAS2, inhibiting their transactivation activity and their phosphorylation. This reduces expression of the target genes of BMAL1:CLOCK and BMAL1:NPAS2 during the afternoon and evening. PER:CRY complexes also traffic out of the nucleus into the cytosol due to the nuclear export signal of PER. During the night PER:CRY complexes are polyubiquitinated and degraded, allowing the cycle to begin again. Phosphorylated PER is bound by Beta-TrCP1, a cytosolic F-box type component of some SCF E3 ubiquitin ligases. CRY is bound by FBXL3, a nucleoplasmic F-box type component of some SCF E3 ubiquitin ligases. Phosphorylation of CRY1 by Adenosine monophosphate-activated kinase (AMPK) enhances degradation of CRY1. PER and CRY are subsequently polyubiquitinated and proteolyzed by the 26S proteasome.The circadian clock is cell-autonomous and some, but not all cells of the body exhibit circadian rhythms in metabolism, cell division, and gene transcription. The suprachiasmatic nucleus (SCN) in the hypothalamus is the major clock in the body and receives its major input from light (via retinal neurons) and a minor input from nutrient intake. The SCN and other brain tissues determine waking and feeding cycles and influence the clocks in other tissues by hormone secretion and nervous stimulation. Independently of the SCN, other tissues such as liver receive inputs from signals from the brain and from nutrients |
| R-HSA-5620912 | Anchoring of the basal body to the plasma membrane. | Cilium biogenesis is initiated by the docking of basal bodies, a centriole-derived organelle, to the plasma membrane (reviewed in Reiter et al, 2012). The centriole consists of a multiprotein core surrounded by a ring of nine microtubule triplets; the mother centriole additionally has 'distal' and 'subdistal appendages' that are critical for ciliogenesis (reviewed in Kim and Dynlacht, 2013; Firat-Karalar and Stearns, 2014; Bettencourt-Dias et al, 2011). Basal bodies initiate and anchor the extension of the axonemal microtubules and also associate with secretory vesicles which are thought to provide membrane components for the extension of the ciliary membrane (Sorokin, 1962; Sorokin, 1968; Bachmann-Gagescu et al, 2011; Tanos et al, 2013; reviewed in Ishikawa et al, 2011; Reiter et al, 2012). Basal bodies are attached to the plasma membrane through a proteinaceous network of transition fibers that form part of the 'transition zone' at the ciliary base. The transition zone acts as a selective barrier or ciliary pore, excluding vesicles and limiting the diffusion of proteins and lipids from the cytosol or plasma membrane (Deane et al, 2001; Craige et al, 2010; Garcia-Gonzalo et al, 2011; Ye et al, 2014; Joo et al, 2013; reviewed in Nachury et al, 2010; Hsiao et al, 2012; Reiter et al, 2012). In addition to the transition fibres, the transition zone also consists of the ciliary necklace (a row of protein particles at the ciliary membrane at the base of the cilium) and the Y-links (that connect the axonemal microtubules to the membrane at the ciliary necklace) (Williams et al, 2011; reviewed in Hsiao et al, 2012; Reiter et al, 2012) |
| R-HSA-6791226 | Major pathway of rRNA processing in the nucleolus and cytosol. | In humans, a 47S precursor rRNA (pre-rRNA) is transcribed by RNA polymerase I from rRNA-encoding genes (rDNA) at the boundary of the fibrillar center and the dense fibrillar components of the nucleolus (Stanek et al. 2001). The 47S precursor is processed over the course of about 5-8 minutes (Popov et al. 2013) by endoribonucleases and exoribonucleases to yield the 28S rRNA and 5.8S rRNA of the 60S subunit and the 18S rRNA of the 40S subunit (reviewed in Mullineus and Lafontaine 2012, Henras et al. 2015). As the pre-rRNA is being transcribed, a large protein complex, the small subunit (SSU) processome, assembles in the region of the 18S rRNA sequence, forming terminal knobs on the pre-rRNA (reviewed in Phipps et al. 2011, inferred from yeast in Dragon et al. 2002). The SSU processome contains both ribosomal proteins of the small subunit and processing factors which process the pre-rRNA and modify nucleotides. Through addition of subunits the SSU processome appears to be converted into the larger 90S pre-ribosome (inferred from yeast in Grandi et al. 2002). An analogous large subunit processome (LSU) assembles in the region of the 28S rRNA, however the LSU is less well characterized (inferred from yeast in McCann et al. 2015).Following cleavage of the pre-rRNA within internal transcribed spacer 1 (ITS1), the pre-ribosomal particle separates into a pre-60S subunit and a pre-40S subunit in the nucleolus (reviewed in Hernandez-Verdun et al. 2010, Phipps et al. 2011). The pre-60S and pre-40S ribosomal particles are then exported from the nucleus to the cytoplasm where the processing factors dissociate and recycle back to the nucleusNuclease digestions of the 47S pre-rRNA can follow several paths. In the major pathway, the ends of the 47S pre-rRNA are trimmed to yield the 45S pre-rRNA. Digestion at site 2 (also called site 2b in mouse, see Henras et al. 2015 for nomenclature) cleaves the 45S pre-rRNA to yield the 30S pre-rRNA containing the 18S rRNA of the small subunit and the 32S pre-rRNA containing the 5.8S rRNA and the 28S rRNA of the large subunit. The 32S pre-rRNA is digested in the nucleus to yield the 5.8S rRNA and the 28S rRNA while the 30S pre-rRNA is digested in the nucleus to yield the 18SE pre-rRNA which is then processed in the nucleus and cytosol to yield the 18S rRNA. At least 286 human proteins, 74 of which have no yeast homolog, are required for efficient processing of pre-rRNA in the nucleus (Tafforeau et al |
| R-HSA-8854518 | AURKA Activation by TPX2. | TPX2 binds to aurora kinase A (AURKA) at centrosomes and promotes its activation by facilitating AURKA active conformation and autophosphorylation of the AURKA threonine residue T288 (Bayliss et al. 2003, Xu et al. 2011, Giubettini et al. 2011, Dodson and Bayliss 2012) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ADAM22 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AHCYL1 | Affinity Capture-MS | physical | 23455922, (Europe PMC) | NA | BioGRID |
| AHCYL2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ALYREF | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ANKRD49 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ANKRD6 | Affinity Capture-Western | physical | 12183362, (Europe PMC) | NA | BioGRID |
| APC | Affinity Capture-MS, Co-localization | physical | 25241761, 29045831, (Europe PMC) | NA | BioGRID |
| APP | Reconstituted Complex | physical | 21244100, 21832049, (Europe PMC) | NA | BioGRID |
| ARHGAP22 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ARHGEF1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ARNTL | Biochemical Activity, Two-hybrid | physical | 11875063, 23555304, (Europe PMC) | NA | BioGRID |
| ATOH1 | Affinity Capture-MS, Affinity Capture-Western | physical | 27542412, (Europe PMC) | NA | BioGRID |
| AXIN1 | Affinity Capture-MS, Affinity Capture-Western, Phenotypic Suppression, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, two hybrid | association, colocalization, genetic, physical, physical association | 11884395, 21988832, 22682247, 26496610, (Europe PMC) | 0.69 | BioGRID, IntAct |
| BAIAP2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BBS10 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| BHLHE41 | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| BID | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| BMT2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| BTBD1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| BYSL | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| CACNG2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| CACNG4 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| CACNG5 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CADM4 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CAMKK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCDC61 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP128 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP131 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP162 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP290 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP72 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLOCK | Affinity Capture-Luminescence, Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| CLTC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CRY1 | Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 23555304, 26496610, 28514442, (Europe PMC) | 0.53 | BioGRID, IntAct |
| CRY2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 16790549, 26496610, 28514442, (Europe PMC) | 0.53 | BioGRID, IntAct |
| CSNK1A1 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSNK1D | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSNK1E | Biochemical Activity, Two-hybrid | physical | 16616143, 23555304, (Europe PMC) | NA | BioGRID |
| CSNK2B | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| CTNND1 | Affinity Capture-Western | physical | 21670201, (Europe PMC) | NA | BioGRID |
| CUL2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DBNDD2 | Affinity Capture-Western, Two-hybrid | physical | 16618118, (Europe PMC) | NA | BioGRID |
| DEC1 | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| DHX16 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DRICH1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DTD1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DVL1 | Affinity Capture-Western, anti tag coimmunoprecipitation, protein kinase assay, pull down | association, direct interaction, phosphorylation reaction, physical, physical association | 11425858, 11818547, (Europe PMC) | 0.64 | BioGRID, IntAct |
| DVL2 | Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid pooling approach | association, physical, physical association | 16189514, 23455922, (Europe PMC) | 0.55 | BioGRID, IntAct |
| DVL3 | Two-hybrid, two hybrid array, two hybrid bait and prey pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, 25910212, (Europe PMC) | 0.79 | BioGRID, IntAct |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| ELOB | Affinity Capture-MS | physical | 23455922, (Europe PMC) | NA | BioGRID |
| ENTR1 | Two-hybrid | physical | 21988832, (Europe PMC) | NA | BioGRID |
| FAM110A | Two-hybrid, two hybrid | physical, physical association | 21900206, 21988832, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| FAM110B | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM110C | Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid | association, physical, physical association | 21988832, 23455922, (Europe PMC) | 0.55 | BioGRID, IntAct |
| FAM199X | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM83B | Affinity Capture-MS | physical | 23455922, (Europe PMC) | NA | BioGRID |
| FAM83D | Affinity Capture-MS, Two-hybrid | physical | 21900206, 23455922, (Europe PMC) | NA | BioGRID |
| FAM83H | Affinity Capture-MS | physical | 23455922, 26496610, 28514442, (Europe PMC) | NA | BioGRID |
| FARP2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FBP1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FBXW11 | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| FKBPL | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| FOPNL | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FOXP2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| GAPVD1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GTF3C1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GTSE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HES1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| HMMR | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSPA8 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| JAK3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KAT7 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| KIAA0753 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KIF2A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KLHDC3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KLHL42 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| LDLRAD4 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| LPIN1 | Affinity Capture-Western | physical | 28049764, (Europe PMC) | NA | BioGRID |
| LTBR | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| MAPK9 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| MAVS | Affinity Capture-Western | physical | 26928339, (Europe PMC) | NA | BioGRID |
| MCC | Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid | association, physical, physical association | 17353931, 21900206, 23455922, 26496610, (Europe PMC) | 0.75 | BioGRID, IntAct, MINT |
| MICU2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| MIER1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MRPL4 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| MTA2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MTMR4 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MYC | Dosage Lethality | genetic | 22623531, (Europe PMC) | NA | BioGRID |
| MYCN | Synthetic Growth Defect | genetic | 22623531, (Europe PMC) | NA | BioGRID |
| NCOA3 | Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation | association, physical | 21577200, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NLRP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NOB1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NR1D2 | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| NSUN2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NXF2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| OCLN | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, imaging technique, protein kinase assay, proximity ligation assay, pull down, two hybrid | colocalization, phosphorylation reaction, physical, physical association | 16616143, 25241761, 28514442, (Europe PMC) | 0.73 | BioGRID, IntAct, MINT |
| OFD1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PCM1 | Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification | association, physical | 26496610, 26638075, (Europe PMC) | 0.53 | BioGRID, IntAct |
| PCMT1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| PDE4DIP | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| PER1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 10848614, 15917222, 16790549, 23455922, 23555304, 26496610, 28514442, (Europe PMC) | 0.64 | BioGRID, IntAct |
| PER2 | Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, protein kinase assay, two hybrid array, two hybrid prey pooling approach | association, phosphorylation reaction, physical, physical association | 16790549, 17218255, 23555304, 28514442, (Europe PMC) | 0.73 | BioGRID, IntAct |
| PER3 | Affinity Capture-Western | physical | 14701732, (Europe PMC) | NA | BioGRID |
| PNO1 | Co-fractionation, Two-hybrid, two hybrid | physical, physical association | 21900206, 26344197, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| POTEF | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| PPM1B | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PPP1CA | Biochemical Activity | physical | 17318175, (Europe PMC) | NA | BioGRID |
| PPP1CC | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| PPP1R14A | Reconstituted Complex | physical | 15003508, (Europe PMC) | NA | BioGRID |
| PPP2R5D | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| PPP2R5E | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| PPP6R3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRDX4 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRKAR2A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRKAR2B | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| PRMT5 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RAD54B | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RASAL2 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 26496610, (Europe PMC) | 0.53 | BioGRID, IntAct |
| RBX1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| REST | Affinity Capture-Western | physical | 24760862, (Europe PMC) | NA | BioGRID |
| RNF43 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| RORA | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| RORC | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| RP2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| RPS4Y2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| SAV1 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 24255178, (Europe PMC) | 0.53 | BioGRID, IntAct |
| SEC13 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC16A | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SGO2 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| SMARCD1 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| SNX22 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SNX24 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SPICE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SSMEM1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| STK3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STOX2 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 26496610, (Europe PMC) | 0.53 | BioGRID, IntAct |
| TAOK1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TAZ | Affinity Capture-Western, Biochemical Activity | physical | 20858893, (Europe PMC) | NA | BioGRID |
| TEX264 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| TIAM1 | Affinity Capture-MS | physical | 25124033, (Europe PMC) | NA | BioGRID |
| TNFRSF1A | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| TNS2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TP53 | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TRA2A | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| TRAF3 | Affinity Capture-Western, Biochemical Activity | physical | 26928339, (Europe PMC) | NA | BioGRID |
| TRIM3 | Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 26496610, (Europe PMC) | 0.35, 0.49 | BioGRID, IntAct |
| UBE2S | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| UBXN7 | Affinity Capture-MS | physical | 26389662, (Europe PMC) | NA | BioGRID |
| UNC45A | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UQCC1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| USP39 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| USP9X | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| USP9Y | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VPS13B | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WDCP | Two-hybrid | physical | 21900206, (Europe PMC) | NA | BioGRID |
| WDR5 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WDR90 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WWC1 | Affinity Capture-MS | physical | 28720576, (Europe PMC) | NA | BioGRID |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| ZMYND8 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF227 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF618 | Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach | physical, physical association | 28514442, (Europe PMC) | 0.49 | BioGRID, IntAct |
| ZSWIM8 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACACA | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ADAM22 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AHCYL1 | tandem affinity purification | association | 23455922, (Europe PMC) | 0.35 | IntAct |
| AHCYL2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| APC | anti tag coimmunoprecipitation, protein kinase assay, proximity ligation assay | association, phosphorylation reaction, physical association | 11425858, 17218255, 25241761, (Europe PMC) | 0.75 | IntAct |
| ARHGEF1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| AXIN1 | Affinity Capture-MS, Affinity Capture-Western, Phenotypic Suppression, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, two hybrid | association, colocalization, genetic, physical, physical association | 11884395, 21988832, 22682247, 26496610, (Europe PMC) | 0.69 | BioGRID, IntAct |
| BAIAP2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BBS10 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| BID | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CADM4 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CAMKK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCDC61 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCNA1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| CEP128 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP131 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP162 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP290 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP72 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CRY1 | Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 23555304, 26496610, 28514442, (Europe PMC) | 0.53 | BioGRID, IntAct |
| CRY2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 16790549, 26496610, 28514442, (Europe PMC) | 0.53 | BioGRID, IntAct |
| CSNK1A1 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSNK1D | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CTNNB1 | protein kinase assay | phosphorylation reaction | 11425858, (Europe PMC) | 0.44 | IntAct |
| CUL2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DVL1 | Affinity Capture-Western, anti tag coimmunoprecipitation, protein kinase assay, pull down | association, direct interaction, phosphorylation reaction, physical, physical association | 11425858, 11818547, (Europe PMC) | 0.64 | BioGRID, IntAct |
| DVL2 | Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid pooling approach | association, physical, physical association | 16189514, 23455922, (Europe PMC) | 0.55 | BioGRID, IntAct |
| DVL3 | Two-hybrid, two hybrid array, two hybrid bait and prey pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, 25910212, (Europe PMC) | 0.79 | BioGRID, IntAct |
| ELOB | tandem affinity purification | association | 23455922, (Europe PMC) | 0.35 | IntAct |
| FAM110A | Two-hybrid, two hybrid | physical, physical association | 21900206, 21988832, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| FAM110B | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM110C | Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid | association, physical, physical association | 21988832, 23455922, (Europe PMC) | 0.55 | BioGRID, IntAct |
| FAM199X | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM83B | tandem affinity purification | association | 23455922, (Europe PMC) | 0.35 | IntAct |
| FAM83D | tandem affinity purification, two hybrid | association, physical association | 21900206, 23455922, (Europe PMC) | 0.55 | IntAct, MINT |
| FAM83H | anti tag coimmunoprecipitation, tandem affinity purification | association | 23455922, 26496610, (Europe PMC) | 0.53 | IntAct |
| FARP2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FBP1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FOPNL | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GAPVD1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GTF3C1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GTSE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HES1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| HMMR | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSP90AB1 | anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.52 | IntAct |
| JAK3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KAT7 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| KIAA0753 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KIF2A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KLHDC3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LRRK2 | protein kinase assay | phosphorylation reaction | 25500533, (Europe PMC) | 0.44 | IntAct |
| MCC | Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid | association, physical, physical association | 17353931, 21900206, 23455922, 26496610, (Europe PMC) | 0.75 | BioGRID, IntAct, MINT |
| MDM2 | anti tag coimmunoprecipitation, pull down | physical association | 20708156, (Europe PMC) | 0.52 | IntAct |
| MIER1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MTA2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NCOA3 | Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation | association, physical | 21577200, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OCLN | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, imaging technique, protein kinase assay, proximity ligation assay, pull down, two hybrid | colocalization, phosphorylation reaction, physical, physical association | 16616143, 25241761, 28514442, (Europe PMC) | 0.73 | BioGRID, IntAct, MINT |
| OFD1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PCM1 | Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification | association, physical | 26496610, 26638075, (Europe PMC) | 0.53 | BioGRID, IntAct |
| PER1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 10848614, 15917222, 16790549, 23455922, 23555304, 26496610, 28514442, (Europe PMC) | 0.64 | BioGRID, IntAct |
| PER2 | Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, protein kinase assay, two hybrid array, two hybrid prey pooling approach | association, phosphorylation reaction, physical, physical association | 16790549, 17218255, 23555304, 28514442, (Europe PMC) | 0.73 | BioGRID, IntAct |
| PNO1 | Co-fractionation, Two-hybrid, two hybrid | physical, physical association | 21900206, 26344197, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PPP5C | anti tag coimmunoprecipitation | association | 16790549, (Europe PMC) | 0.35 | IntAct |
| PPP6R3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRDX4 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRKAR2A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRMT5 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMD2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| PTBP3 | anti bait coimmunoprecipitation | association | 22575643, (Europe PMC) | 0.35 | IntAct, MINT |
| PTPRD | protein array | direct interaction | 22305495, (Europe PMC) | 0.44 | IntAct, MINT |
| RAD54B | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RASAL2 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 26496610, (Europe PMC) | 0.53 | BioGRID, IntAct |
| RBX1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RIPK4 | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| SAV1 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 24255178, (Europe PMC) | 0.53 | BioGRID, IntAct |
| SDCCAG3 | two hybrid | physical association | 21988832, (Europe PMC) | 0.37 | IntAct |
| SEC13 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC16A | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SNX22 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SNX24 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SPICE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STK3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STOX2 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 26496610, (Europe PMC) | 0.53 | BioGRID, IntAct |
| TAOK1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TNS2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TP53 | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TRIM3 | Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 26496610, (Europe PMC) | 0.35, 0.49 | BioGRID, IntAct |
| UNC45A | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| USP9X | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| USP9Y | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VPS13B | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WDCP | two hybrid | physical association | 21900206, (Europe PMC) | 0.37 | IntAct, MINT |
| WDR5 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WDR90 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAH | pull down | physical association | 19860830, (Europe PMC) | 0.40 | IntAct, MINT |
| ZMYND8 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF227 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF618 | Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach | physical, physical association | 28514442, (Europe PMC) | 0.49 | BioGRID, IntAct |
| ZSWIM8 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| BBS10 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CADM4 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FAM110A | Two-hybrid, two hybrid | physical, physical association | 21900206, 21988832, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| FAM83D | tandem affinity purification, two hybrid | association, physical association | 21900206, 23455922, (Europe PMC) | 0.55 | IntAct, MINT |
| FBP1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GTF3C1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| HES1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KAT7 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MCC | Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid | association, physical, physical association | 17353931, 21900206, 23455922, 26496610, (Europe PMC) | 0.75 | BioGRID, IntAct, MINT |
| OCLN | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, imaging technique, protein kinase assay, proximity ligation assay, pull down, two hybrid | colocalization, phosphorylation reaction, physical, physical association | 16616143, 25241761, 28514442, (Europe PMC) | 0.73 | BioGRID, IntAct, MINT |
| PNO1 | Co-fractionation, Two-hybrid, two hybrid | physical, physical association | 21900206, 26344197, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PTBP3 | anti bait coimmunoprecipitation | association | 22575643, (Europe PMC) | 0.35 | IntAct, MINT |
| PTPRD | protein array | direct interaction | 22305495, (Europe PMC) | 0.44 | IntAct, MINT |
| RBX1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TAOK1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| WDCP | two hybrid | physical association | 21900206, (Europe PMC) | 0.37 | IntAct, MINT |
| YWHAH | pull down | physical association | 19860830, (Europe PMC) | 0.40 | IntAct, MINT |
| ZMYND8 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF227 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACACA | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ADAM22 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AHCYL1 | Affinity Capture-MS | physical | 23455922, (Europe PMC) | NA | BioGRID |
| AHCYL1 | tandem affinity purification | association | 23455922, (Europe PMC) | 0.35 | IntAct |
| AHCYL2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ALYREF | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ANKRD49 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ANKRD6 | Affinity Capture-Western | physical | 12183362, (Europe PMC) | NA | BioGRID |
| APC | Affinity Capture-MS, Co-localization | physical | 25241761, 29045831, (Europe PMC) | NA | BioGRID |
| APC | anti tag coimmunoprecipitation, protein kinase assay, proximity ligation assay | association, phosphorylation reaction, physical association | 11425858, 17218255, 25241761, (Europe PMC) | 0.75 | IntAct |
| APP | Reconstituted Complex | physical | 21244100, 21832049, (Europe PMC) | NA | BioGRID |
| ARHGAP22 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ARHGEF1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ARNTL | Biochemical Activity, Two-hybrid | physical | 11875063, 23555304, (Europe PMC) | NA | BioGRID |
| ATOH1 | Affinity Capture-MS, Affinity Capture-Western | physical | 27542412, (Europe PMC) | NA | BioGRID |
| AXIN1 | Affinity Capture-MS, Affinity Capture-Western, Phenotypic Suppression, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, two hybrid | association, colocalization, genetic, physical, physical association | 11884395, 21988832, 22682247, 26496610, (Europe PMC) | 0.69 | BioGRID, IntAct |
| BAIAP2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BBS10 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| BHLHE41 | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| BID | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| BMT2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| BTBD1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| BYSL | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| CACNG2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| CACNG4 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| CACNG5 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CADM4 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CAMKK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCDC61 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCNA1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| CEP128 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP131 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP162 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP290 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP72 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLOCK | Affinity Capture-Luminescence, Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| CLTC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CRY1 | Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 23555304, 26496610, 28514442, (Europe PMC) | 0.53 | BioGRID, IntAct |
| CRY2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 16790549, 26496610, 28514442, (Europe PMC) | 0.53 | BioGRID, IntAct |
| CSNK1A1 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSNK1D | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSNK1E | Biochemical Activity, Two-hybrid | physical | 16616143, 23555304, (Europe PMC) | NA | BioGRID |
| CSNK2B | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| CTNNB1 | protein kinase assay | phosphorylation reaction | 11425858, (Europe PMC) | 0.44 | IntAct |
| CTNND1 | Affinity Capture-Western | physical | 21670201, (Europe PMC) | NA | BioGRID |
| CUL2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DBNDD2 | Affinity Capture-Western, Two-hybrid | physical | 16618118, (Europe PMC) | NA | BioGRID |
| DEC1 | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| DHX16 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DRICH1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DTD1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DVL1 | Affinity Capture-Western, anti tag coimmunoprecipitation, protein kinase assay, pull down | association, direct interaction, phosphorylation reaction, physical, physical association | 11425858, 11818547, (Europe PMC) | 0.64 | BioGRID, IntAct |
| DVL2 | Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid pooling approach | association, physical, physical association | 16189514, 23455922, (Europe PMC) | 0.55 | BioGRID, IntAct |
| DVL3 | Two-hybrid, two hybrid array, two hybrid bait and prey pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, 25910212, (Europe PMC) | 0.79 | BioGRID, IntAct |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| ELOB | Affinity Capture-MS | physical | 23455922, (Europe PMC) | NA | BioGRID |
| ELOB | tandem affinity purification | association | 23455922, (Europe PMC) | 0.35 | IntAct |
| ENTR1 | Two-hybrid | physical | 21988832, (Europe PMC) | NA | BioGRID |
| FAM110A | Two-hybrid, two hybrid | physical, physical association | 21900206, 21988832, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| FAM110B | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM110C | Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid | association, physical, physical association | 21988832, 23455922, (Europe PMC) | 0.55 | BioGRID, IntAct |
| FAM199X | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM83B | Affinity Capture-MS | physical | 23455922, (Europe PMC) | NA | BioGRID |
| FAM83B | tandem affinity purification | association | 23455922, (Europe PMC) | 0.35 | IntAct |
| FAM83D | Affinity Capture-MS, Two-hybrid | physical | 21900206, 23455922, (Europe PMC) | NA | BioGRID |
| FAM83D | tandem affinity purification, two hybrid | association, physical association | 21900206, 23455922, (Europe PMC) | 0.55 | IntAct, MINT |
| FAM83H | Affinity Capture-MS | physical | 23455922, 26496610, 28514442, (Europe PMC) | NA | BioGRID |
| FAM83H | anti tag coimmunoprecipitation, tandem affinity purification | association | 23455922, 26496610, (Europe PMC) | 0.53 | IntAct |
| FARP2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FBP1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FBXW11 | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| FKBPL | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| FOPNL | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FOXP2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| GAPVD1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GTF3C1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GTSE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HES1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| HMMR | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSP90AB1 | anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.52 | IntAct |
| HSPA8 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| JAK3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KAT7 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| KIAA0753 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KIF2A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KLHDC3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KLHL42 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| LDLRAD4 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| LPIN1 | Affinity Capture-Western | physical | 28049764, (Europe PMC) | NA | BioGRID |
| LRRK2 | protein kinase assay | phosphorylation reaction | 25500533, (Europe PMC) | 0.44 | IntAct |
| LTBR | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| MAPK9 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| MAVS | Affinity Capture-Western | physical | 26928339, (Europe PMC) | NA | BioGRID |
| MCC | Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid | association, physical, physical association | 17353931, 21900206, 23455922, 26496610, (Europe PMC) | 0.75 | BioGRID, IntAct, MINT |
| MDM2 | anti tag coimmunoprecipitation, pull down | physical association | 20708156, (Europe PMC) | 0.52 | IntAct |
| MICU2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| MIER1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MRPL4 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| MTA2 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MTMR4 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MYC | Dosage Lethality | genetic | 22623531, (Europe PMC) | NA | BioGRID |
| MYCN | Synthetic Growth Defect | genetic | 22623531, (Europe PMC) | NA | BioGRID |
| NCOA3 | Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation | association, physical | 21577200, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NLRP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NOB1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NR1D2 | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| NSUN2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NXF2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| OCLN | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, imaging technique, protein kinase assay, proximity ligation assay, pull down, two hybrid | colocalization, phosphorylation reaction, physical, physical association | 16616143, 25241761, 28514442, (Europe PMC) | 0.73 | BioGRID, IntAct, MINT |
| OFD1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PCM1 | Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification | association, physical | 26496610, 26638075, (Europe PMC) | 0.53 | BioGRID, IntAct |
| PCMT1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| PDE4DIP | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| PER1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 10848614, 15917222, 16790549, 23455922, 23555304, 26496610, 28514442, (Europe PMC) | 0.64 | BioGRID, IntAct |
| PER2 | Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, protein kinase assay, two hybrid array, two hybrid prey pooling approach | association, phosphorylation reaction, physical, physical association | 16790549, 17218255, 23555304, 28514442, (Europe PMC) | 0.73 | BioGRID, IntAct |
| PER3 | Affinity Capture-Western | physical | 14701732, (Europe PMC) | NA | BioGRID |
| PNO1 | Co-fractionation, Two-hybrid, two hybrid | physical, physical association | 21900206, 26344197, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| POTEF | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| PPM1B | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PPP1CA | Biochemical Activity | physical | 17318175, (Europe PMC) | NA | BioGRID |
| PPP1CC | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| PPP1R14A | Reconstituted Complex | physical | 15003508, (Europe PMC) | NA | BioGRID |
| PPP2R5D | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| PPP2R5E | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| PPP5C | anti tag coimmunoprecipitation | association | 16790549, (Europe PMC) | 0.35 | IntAct |
| PPP6R3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRDX4 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRKAR2A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRKAR2B | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| PRMT5 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMD2 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| PTBP3 | anti bait coimmunoprecipitation | association | 22575643, (Europe PMC) | 0.35 | IntAct, MINT |
| PTPRD | protein array | direct interaction | 22305495, (Europe PMC) | 0.44 | IntAct, MINT |
| RAD54B | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RASAL2 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 26496610, (Europe PMC) | 0.53 | BioGRID, IntAct |
| RBX1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| REST | Affinity Capture-Western | physical | 24760862, (Europe PMC) | NA | BioGRID |
| RIPK4 | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| RNF43 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| RORA | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| RORC | Two-hybrid | physical | 23555304, (Europe PMC) | NA | BioGRID |
| RP2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| RPS4Y2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| SAV1 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 24255178, (Europe PMC) | 0.53 | BioGRID, IntAct |
| SDCCAG3 | two hybrid | physical association | 21988832, (Europe PMC) | 0.37 | IntAct |
| SEC13 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC16A | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SGO2 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| SMARCD1 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| SNX22 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SNX24 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SPICE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SSMEM1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| STK3 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STOX2 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 23455922, 26496610, (Europe PMC) | 0.53 | BioGRID, IntAct |
| TAOK1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TAZ | Affinity Capture-Western, Biochemical Activity | physical | 20858893, (Europe PMC) | NA | BioGRID |
| TEX264 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| TIAM1 | Affinity Capture-MS | physical | 25124033, (Europe PMC) | NA | BioGRID |
| TNFRSF1A | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| TNS2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TP53 | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TRA2A | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| TRAF3 | Affinity Capture-Western, Biochemical Activity | physical | 26928339, (Europe PMC) | NA | BioGRID |
| TRIM3 | Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 26496610, (Europe PMC) | 0.35, 0.49 | BioGRID, IntAct |
| UBE2S | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| UBXN7 | Affinity Capture-MS | physical | 26389662, (Europe PMC) | NA | BioGRID |
| UNC45A | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UQCC1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| USP39 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| USP9X | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| USP9Y | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VPS13B | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WDCP | Two-hybrid | physical | 21900206, (Europe PMC) | NA | BioGRID |
| WDCP | two hybrid | physical association | 21900206, (Europe PMC) | 0.37 | IntAct, MINT |
| WDR5 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WDR90 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WWC1 | Affinity Capture-MS | physical | 28720576, (Europe PMC) | NA | BioGRID |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| YWHAH | pull down | physical association | 19860830, (Europe PMC) | 0.40 | IntAct, MINT |
| ZMYND8 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF227 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF618 | Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach | physical, physical association | 28514442, (Europe PMC) | 0.49 | BioGRID, IntAct |
| ZSWIM8 | Affinity Capture-MS, tandem affinity purification | association, physical | 23455922, (Europe PMC) | 0.35 | BioGRID, IntAct |