- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
UBASH3B
Gene Name  | UBASH3B (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | UBASH3B, KIAA1959, STS1 | |
| Protein Name | UBASH3B |
|
| Alternative Name(s) |
Ubiquitin-associated and SH3 domain-containing protein B;3.1.3.48;Cbl-interacting protein p70;Suppressor of T-cell receptor signaling 1;STS-1;T-cell ubiquitin ligand 2;TULA-2;Tyrosine-protein phosphatase STS1/TULA2; | |
| EntrezGene ID | 84959 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q8TF42 (protein sequence) | |
| Enzyme Class | EC 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 72696 Dalton | |
| Protein Length | 649 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000154127 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: histidine phosphatase (HP) | Historic class: Phosphoglycerate mutase | CATH ID: 3.40.50.1240 | SCOP Fold: HP | |
| Phosphatase activity | active | Catalytic signature motif: RHGE | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Nucleus | |||
| Function (UniProt annotation) | |||
| Interferes with CBL-mediated down-regulation anddegradation of receptor-type tyrosine kinases Promotesaccumulation of activated target receptors, such as T-cellreceptors and EGFR, on the cell surface Exhibits tyrosinephosphatase activity toward several substrates including EGFR,FAK, SYK, and ZAP70 Down-regulates proteins that are duallymodified by both protein tyrosine phosphorylation andubiquitination | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate | |||
| Protein Sequence | |||
| MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALASTGGRSVQAACDWLFSHVGDP FLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKAHNIFPHITLCQFFMCEDSKVDALGEALQTTVSRWKCKFSA PLPLELYTSSNFIGLFVKEDSAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNIDVKLGC DWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTSLTTGCSGLLPENYITKADEC STWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFG KYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHN ILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEI ISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGF NWRETLLQE |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0005634 | C:nucleus |
| GO:0005737 | C:cytoplasm |
| GO:0006469 | P:negative regulation of protein kinase activity |
| GO:0009968 | P:negative regulation of signal transduction |
| GO:0031625 | F:ubiquitin protein ligase binding |
| GO:0038063 | P:collagen-activated tyrosine kinase receptor signaling pathway |
| GO:0042802 | F:identical protein binding |
| GO:0043393 | P:regulation of protein binding |
| GO:0045671 | P:negative regulation of osteoclast differentiation |
| GO:0045779 | P:negative regulation of bone resorption |
| GO:0051219 | F:phosphoprotein binding |
| GO:0051279 | P:regulation of release of sequestered calcium ion into cytosol |
| GO:0070527 | P:platelet aggregation |
| GO:0090331 | P:negative regulation of platelet aggregation |
Download FASTA sequences of UBASH3B-substrates in Humans
| Substrate Gene Name | Substrate UniProt_AC | DephosphoSite and sequence (+/-5) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| EGFR | P00533 | NA | In vitro | 17880946, | Europe PMC |  |
| CBL | P22681 | NA | In vitro | 17880946, | Europe PMC | |
| ZAP70 | P43403 | NA | In vitro | 14738763, | Europe PMC | |
| SYK | P43405 | Tyr-525_RADENyYKAQT; Tyr-526_ADENYyKAQTH | in vitro | 20585042 , | Europe PMC | |
| PTK2 | Q05397 | NA | N/A | UniProt, | Europe PMC | N/A |
[Feedback|Contribution]
[ Feedback|Contribution]
[Feedback|Contribution]
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACACA | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| ACTB | Affinity Capture-MS | physical | 19380743, 24189400, (Europe PMC) | NA | BioGRID |
| ACTG1 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| ACTN4 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| ARAP1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AURKB | Affinity Capture-Western, Co-localization, Reconstituted Complex | physical | 26766443, (Europe PMC) | NA | BioGRID |
| BCR | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CBL | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex | physical | 15159412, 16429130, 17675467, 17880946, 19380743, (Europe PMC) | NA | BioGRID |
| CBLB | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, , (Europe PMC) | 0.70 | BioGRID, IntAct |
| CCDC33 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CCT3 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CCT6A | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CCT6B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CCT7 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CCT8 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CHD4 | Affinity Capture-MS | physical | 9790534, (Europe PMC) | NA | BioGRID |
| CORO1C | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CRK | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSK | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CUL3 | Reconstituted Complex | physical | 26766443, (Europe PMC) | NA | BioGRID |
| DAZAP2 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, , (Europe PMC) | 0.70 | BioGRID, IntAct |
| DCD | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| DDX6 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| DMRT3 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| DNAJA1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| DOC2A | Affinity Capture-MS, Two-hybrid | physical | 24722188, 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DSC1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EEF1A1P5 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, tandem affinity purification | association, physical | 15159412, 17880946, 18271526, 23956138, 24189400, 24797263, (Europe PMC) | 0.46 | BioGRID, IntAct |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| ERRFI1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ESRRB | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| EWSR1 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| FAM168A | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 21516116, 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| FAM209A | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| GFAP | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| GRB2 | Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification | association, physical | 19380743, 22267732, 24189400, (Europe PMC) | 0.53 | BioGRID, IntAct |
| HDAC1 | Affinity Capture-MS | physical | 9790534, (Europe PMC) | NA | BioGRID |
| HIST1H1A | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIST1H1C | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HIST1H1D | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HIST1H1E | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HIST1H1T | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPA2B1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPF | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HNRNPH1 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HNRNPH2 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPU | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HSP90AA1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSP90AB1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA1B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA1L | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA5 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA7 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA8 | Affinity Capture-MS | physical | 19380743, 24189400, (Europe PMC) | NA | BioGRID |
| INPP5D | Affinity Capture-Western | physical | 22267732, (Europe PMC) | NA | BioGRID |
| INPPL1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IQGAP1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KHDRBS1 | Protein-peptide | physical | 22745667, (Europe PMC) | NA | BioGRID |
| KIF20A | Affinity Capture-Western, Co-localization | physical | 26766443, (Europe PMC) | NA | BioGRID |
| KRT1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT10 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT14 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT16 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT17 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT2 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT4 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT5 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT6A | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT6B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT73 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT79 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT8 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT9 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| LGALS3BP | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| MAP3K1 | Biochemical Activity | physical | 25260751, (Europe PMC) | NA | BioGRID |
| MAPT | Affinity Capture-Western, Biochemical Activity | physical | 16364302, (Europe PMC) | NA | BioGRID |
| MCCC2 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYH10 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| MYH9 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO1D | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NCK1 | Affinity Capture-Western | physical | 22267732, (Europe PMC) | NA | BioGRID |
| PKP4 | Two-hybrid | physical | 21516116, (Europe PMC) | NA | BioGRID |
| PRKN | Reconstituted Complex | physical | 17599067, (Europe PMC) | NA | BioGRID |
| RCHY1 | Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, 28514442, , (Europe PMC) | 0.70 | BioGRID, IntAct |
| RNF41 | Affinity Capture-Western, Reconstituted Complex | physical | 26390156, (Europe PMC) | NA | BioGRID |
| RPS27A | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| S100A8 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SAP30 | Affinity Capture-MS | physical | 9790534, (Europe PMC) | NA | BioGRID |
| SHC1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, 24189400, (Europe PMC) | 0.53 | BioGRID, IntAct |
| SLC25A48 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SPRY2 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SPTA1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SPTAN1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| SPTBN1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| SYK | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, phosphatase assay, pull down | dephosphorylation reaction, physical, physical association | 20585042, 22267732, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| TCP1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| TMEM255A | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TUBA1B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| TUBB | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| UBASH3A | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| UBASH3B | Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach | physical, physical association | 24189400, 25416956, , (Europe PMC) | 0.62 | BioGRID, IntAct |
| UBC | Affinity Capture-MS, Reconstituted Complex, pull down | physical, physical association | 15159412, 16429130, 17599067, 19380743, 28190767, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| UBE2C | Biochemical Activity | physical | 17588522, (Europe PMC) | NA | BioGRID |
| UBE2D1 | Biochemical Activity | physical | 17588522, (Europe PMC) | NA | BioGRID |
| UBE2D2 | Biochemical Activity | physical | 17588522, (Europe PMC) | NA | BioGRID |
| UBE2D3 | Biochemical Activity | physical | 17588522, (Europe PMC) | NA | BioGRID |
| UBE2E1 | Biochemical Activity | physical | 17588522, (Europe PMC) | NA | BioGRID |
| UBE2H | Biochemical Activity | physical | 17588522, (Europe PMC) | NA | BioGRID |
| VPS37B | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, , (Europe PMC) | 0.70 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| CBLB | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, , (Europe PMC) | 0.70 | BioGRID, IntAct |
| CRK | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSK | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DAZAP2 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, , (Europe PMC) | 0.70 | BioGRID, IntAct |
| DMRT3 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| DSC1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EGFR | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, tandem affinity purification | association, physical | 15159412, 17880946, 18271526, 23956138, 24189400, 24797263, (Europe PMC) | 0.46 | BioGRID, IntAct |
| ERBB2 | tandem affinity purification | association | 24189400, (Europe PMC) | 0.35 | IntAct |
| ERRFI1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM168A | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 21516116, 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| GRB2 | Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification | association, physical | 19380743, 22267732, 24189400, (Europe PMC) | 0.53 | BioGRID, IntAct |
| HIST1H1A | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIST1H1T | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPA2B1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPH2 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| INPPL1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MCCC2 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYH9 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO1D | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRKN | pull down | physical association | 17599067, (Europe PMC) | 0.40 | IntAct, MINT |
| RCHY1 | Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, 28514442, , (Europe PMC) | 0.70 | BioGRID, IntAct |
| S100A8 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SHC1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, 24189400, (Europe PMC) | 0.53 | BioGRID, IntAct |
| SLC25A48 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SPRY2 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SPTA1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SYK | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, phosphatase assay, pull down | dephosphorylation reaction, physical, physical association | 20585042, 22267732, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| UBASH3B | Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach | physical, physical association | 24189400, 25416956, , (Europe PMC) | 0.62 | BioGRID, IntAct |
| UBC | Affinity Capture-MS, Reconstituted Complex, pull down | physical, physical association | 15159412, 16429130, 17599067, 19380743, 28190767, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| VPS37B | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, , (Europe PMC) | 0.70 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| SYK | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, phosphatase assay, pull down | dephosphorylation reaction, physical, physical association | 20585042, 22267732, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| UBC | Affinity Capture-MS, Reconstituted Complex, pull down | physical, physical association | 15159412, 16429130, 17599067, 19380743, 28190767, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACACA | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| ACTB | Affinity Capture-MS | physical | 19380743, 24189400, (Europe PMC) | NA | BioGRID |
| ACTG1 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| ACTN4 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| ARAP1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AURKB | Affinity Capture-Western, Co-localization, Reconstituted Complex | physical | 26766443, (Europe PMC) | NA | BioGRID |
| BCR | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CBL | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex | physical | 15159412, 16429130, 17675467, 17880946, 19380743, (Europe PMC) | NA | BioGRID |
| CBLB | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, , (Europe PMC) | 0.70 | BioGRID, IntAct |
| CCDC33 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CCT3 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CCT6A | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CCT6B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CCT7 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CCT8 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CHD4 | Affinity Capture-MS | physical | 9790534, (Europe PMC) | NA | BioGRID |
| CORO1C | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CRK | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSK | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CUL3 | Reconstituted Complex | physical | 26766443, (Europe PMC) | NA | BioGRID |
| DAZAP2 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, , (Europe PMC) | 0.70 | BioGRID, IntAct |
| DCD | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| DDX6 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| DMRT3 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| DNAJA1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| DOC2A | Affinity Capture-MS, Two-hybrid | physical | 24722188, 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DSC1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EEF1A1P5 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, tandem affinity purification | association, physical | 15159412, 17880946, 18271526, 23956138, 24189400, 24797263, (Europe PMC) | 0.46 | BioGRID, IntAct |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| ERBB2 | tandem affinity purification | association | 24189400, (Europe PMC) | 0.35 | IntAct |
| ERRFI1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ESRRB | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| EWSR1 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| FAM168A | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 21516116, 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| FAM209A | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| GFAP | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| GRB2 | Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification | association, physical | 19380743, 22267732, 24189400, (Europe PMC) | 0.53 | BioGRID, IntAct |
| HDAC1 | Affinity Capture-MS | physical | 9790534, (Europe PMC) | NA | BioGRID |
| HIST1H1A | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIST1H1C | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HIST1H1D | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HIST1H1E | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HIST1H1T | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPA2B1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPF | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HNRNPH1 | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HNRNPH2 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPU | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| HSP90AA1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSP90AB1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA1B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA1L | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA5 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA7 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| HSPA8 | Affinity Capture-MS | physical | 19380743, 24189400, (Europe PMC) | NA | BioGRID |
| INPP5D | Affinity Capture-Western | physical | 22267732, (Europe PMC) | NA | BioGRID |
| INPPL1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IQGAP1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KHDRBS1 | Protein-peptide | physical | 22745667, (Europe PMC) | NA | BioGRID |
| KIF20A | Affinity Capture-Western, Co-localization | physical | 26766443, (Europe PMC) | NA | BioGRID |
| KRT1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT10 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT14 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT16 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT17 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT2 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT4 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT5 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT6A | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT6B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT73 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT79 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT8 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| KRT9 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| LGALS3BP | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| MAP3K1 | Biochemical Activity | physical | 25260751, (Europe PMC) | NA | BioGRID |
| MAPT | Affinity Capture-Western, Biochemical Activity | physical | 16364302, (Europe PMC) | NA | BioGRID |
| MCCC2 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYH10 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| MYH9 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO1D | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NCK1 | Affinity Capture-Western | physical | 22267732, (Europe PMC) | NA | BioGRID |
| PKP4 | Two-hybrid | physical | 21516116, (Europe PMC) | NA | BioGRID |
| PRKN | Reconstituted Complex | physical | 17599067, (Europe PMC) | NA | BioGRID |
| PRKN | pull down | physical association | 17599067, (Europe PMC) | 0.40 | IntAct, MINT |
| RCHY1 | Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, 28514442, , (Europe PMC) | 0.70 | BioGRID, IntAct |
| RNF41 | Affinity Capture-Western, Reconstituted Complex | physical | 26390156, (Europe PMC) | NA | BioGRID |
| RPS27A | Affinity Capture-MS | physical | 24189400, (Europe PMC) | NA | BioGRID |
| S100A8 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SAP30 | Affinity Capture-MS | physical | 9790534, (Europe PMC) | NA | BioGRID |
| SHC1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, 24189400, (Europe PMC) | 0.53 | BioGRID, IntAct |
| SLC25A48 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SPRY2 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SPTA1 | Affinity Capture-MS, tandem affinity purification | association, physical | 19380743, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SPTAN1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| SPTBN1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| SYK | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, phosphatase assay, pull down | dephosphorylation reaction, physical, physical association | 20585042, 22267732, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| TCP1 | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| TMEM255A | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TUBA1B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| TUBB | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| UBASH3A | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| UBASH3B | Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach | physical, physical association | 24189400, 25416956, , (Europe PMC) | 0.62 | BioGRID, IntAct |
| UBC | Affinity Capture-MS, Reconstituted Complex, pull down | physical, physical association | 15159412, 16429130, 17599067, 19380743, 28190767, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| UBE2C | Biochemical Activity | physical | 17588522, (Europe PMC) | NA | BioGRID |
| UBE2D1 | Biochemical Activity | physical | 17588522, (Europe PMC) | NA | BioGRID |
| UBE2D2 | Biochemical Activity | physical | 17588522, (Europe PMC) | NA | BioGRID |
| UBE2D3 | Biochemical Activity | physical | 17588522, (Europe PMC) | NA | BioGRID |
| UBE2E1 | Biochemical Activity | physical | 17588522, (Europe PMC) | NA | BioGRID |
| UBE2H | Biochemical Activity | physical | 17588522, (Europe PMC) | NA | BioGRID |
| VPS37B | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, , (Europe PMC) | 0.70 | BioGRID, IntAct |
| Phosphorylating Kinases | Phosphoresidues | Detection Method | PubMed IDs | Source |
| Unknown | S20_AAREELYsKVTPRRN, S46_SALDVLLsMGFPRAR, T23_EELYSKVtPRRNRQQ, Y19_MAAREELySKVTPRR, | HTP, in vivo | 16497976, 18669648, 19413330,(Europe PMC) | HPRD, PhosphoELM, |