Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PTPRE
Gene Name  | PTPRE (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PTPRE | |
| Protein Name | PTPRE |
|
| Alternative Name(s) |
Receptor-type tyrosine-protein phosphatase epsilon;Protein-tyrosine phosphatase epsilon;R-PTP-epsilon;3.1.3.48; | |
| EntrezGene ID | 5791 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P23469 (protein sequence) | |
| Enzyme Class | EC 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 80642 Dalton | |
| Protein Length | 700 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000132334 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class I Cys-based PTPs --> Family: R-PTP | Historic class: Class I Cys-based PTPs --> Classical PTPs --> Receptor-type PTPs (R-PTPs) | CATH ID: 3.90.190.10 | SCOP Fold: CC1 | |
| Phosphatase activity | active | Catalytic signature motif: HCSAGVGR | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Isoform 1: Cell membrane; Single-pass type Imembrane protein Isoform 2: Cytoplasm Note=Predominantlycytoplasmic A small fraction is also associated with nucleus andmembrane Insulin induces translocation to the membrane (Bysimilarity) Isoform 3: Cytoplasm | |||
| Function (UniProt annotation) | |||
| Isoform 1 plays a critical role in signalingtransduction pathways and phosphoprotein network topology in redblood cells May play a role in osteoclast formation and function(By similarity) Isoform 2 acts as a negative regulator of insulinreceptor (IR) signaling in skeletal muscle Regulates insulin-induced tyrosine phosphorylation of insulin receptor (IR) andinsulin receptor substrate 1 (IRS-1), phosphorylation of proteinkinase B and glycogen synthase kinase-3 and insulin inducedstimulation of glucose uptake (By similarity) Isoform 1 and isoform 2 act as a negative regulator ofFceRI-mediated signal transduction leading to cytokine productionand degranulation, most likely by acting at the level of SYK toaffect downstream events such as phosphorylation of SLP76 and LATand mobilization of Ca(2+) | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate | |||
| Protein Sequence | |||
| MEPLCPLLLVGFSLPLARALRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLLLLVLLLAAYFFRFRKQRKAVVS TSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENR EKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGPKQETVNDFWRMVWEQKSATIVMLTNLKERK EEKCHQYWPDQGCWTYGNIRVCVEDCVVLVDYTIRKFCIQPQLPDGCKAPRLVSQLHFTSWPDFGVPFTPIGMLKFLKKV KTLNPVHAGPIVVHCSAGVGRTGTFIVIDAMMAMMHAEQKVDVFEFVSRIRNQRPQMVQTDMQYTFIYQALLEYYLYGDT ELDVSSLEKHLQTMHGTTTHFDKIGLEEEFRKLTNVRIMKENMRTGNLPANMKKARVIQIIPYDFNRVILSMKRGQEYTD YINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTL SEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGIPAEGKGMIDLIAAVQKQQQQTGNHPITVHCSAGAGRTGTF IALSNILERVKAEGLLDVFQAVKSLRLQRPHMVQTLEQYEFCYKVVQDFIDIFSDYANFK |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0005001 | F:transmembrane receptor protein tyrosine phosphatase activity |
| GO:0005634 | C:nucleus |
| GO:0005737 | C:cytoplasm |
| GO:0005886 | C:plasma membrane |
| GO:0006470 | P:protein dephosphorylation |
| GO:0016021 | C:integral component of membrane |
| GO:0046627 | P:negative regulation of insulin receptor signaling pathway |
