- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PPM1G
Gene Name  | PPM1G (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PPM1G, PPM1C | |
| Protein Name | PPM1G |
|
| Alternative Name(s) |
Protein phosphatase 1G;3.1.3.16;Protein phosphatase 1C;Protein phosphatase 2C isoform gamma;PP2C-gamma;Protein phosphatase magnesium-dependent 1 gamma; | |
| EntrezGene ID | 5496 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | O15355 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 (BRENDA ) | |
| Molecular Weight | 59272 Dalton | |
| Protein Length | 546 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000115241 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: PPM | Historic class: PSTPs --> PP2C | CATH ID: 3.60.40.10 | SCOP Fold: PPM | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Membrane | |||
| Function (UniProt annotation) | |||
| NA | |||
| Catalytic Activity (UniProt annotation) | |||
| [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPDIIK DQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVDNEEAALLHEEATMTIEELLTRY GQNCHKGPPHSKSGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTAKAYTGFSSNSERGTEAGQVGEPGIPTGEAGPS CSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEEEDGYSSEEAENEEDEDDTEEAEEDDEEEEEEMMVPGMEGK EEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAI GDHFYKRNKNLPPEEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELL DQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0004722 | F:protein serine/threonine phosphatase activity |
| GO:0005634 | C:nucleus |
| GO:0005654 | C:nucleoplasm |
| GO:0005737 | C:cytoplasm |
| GO:0006470 | P:protein dephosphorylation |
| GO:0007050 | P:cell cycle arrest |
| GO:0016020 | C:membrane |
| GO:0035970 | P:peptidyl-threonine dephosphorylation |
| GO:0046872 | F:metal ion binding |
Download FASTA sequences of PPM1G-substrates in Humans
| Substrate Gene Name | Substrate UniProt_AC | DephosphoSite and sequence (+/-5) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| SMN1 | Q16637 | NA | In vitro and in vivo | 17984321, | Europe PMC |  |
| DDX20 | Q9UHI6 | NA | In vitro and in vivo | 17984321, | Europe PMC | |
| HIST1H2AG | P0C0S8 | NA | In vitro | 17074886, | Europe PMC | |
| H2AFX | P16104 | Ser-140 _KATQAsQEY-- | In vitro | 17074886, | Europe PMC | |
| COIL | P38432 | NA | In vitro | 19435804, | Europe PMC | |
| HIST1H2BM | Q99879 | NA | In vitro | 17074886, | Europe PMC | |
[Feedback|Contribution]
[ Feedback|Contribution]
[Feedback|Contribution]
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AHCYL1 | Co-fractionation | physical | 22939629, 26344197, (Europe PMC) | NA | BioGRID |
| AHSA1 | Affinity Capture-Western | physical | 22504172, (Europe PMC) | NA | BioGRID |
| APEH | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| BAP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| BARD1 | Affinity Capture-MS | physical | 22990118, (Europe PMC) | NA | BioGRID |
| BTRC | Proximity Label-MS | physical | 25900982, (Europe PMC) | NA | BioGRID |
| CAND1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CARS | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CERKL | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| COPA | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| COPB2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| COPE | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CPA6 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ECT2 | Affinity Capture-MS | physical | 22990118, (Europe PMC) | NA | BioGRID |
| EWSR1 | Proximity Label-MS | physical | 24999758, (Europe PMC) | NA | BioGRID |
| FAF1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| FBXL17 | Affinity Capture-MS | physical | 27234298, (Europe PMC) | NA | BioGRID |
| FBXO38 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GARS | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| GMPS | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| H2AFX | Affinity Capture-MS, Affinity Capture-Western | physical | 18406329, 28514442, (Europe PMC) | NA | BioGRID |
| H2AFY2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| HIRIP3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| HIST1H2BA | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| HIST1H2BB | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| HIST1H2BD | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| HIST1H2BG | Proximity Label-MS | physical | 25281560, (Europe PMC) | NA | BioGRID |
| HIST1H4A | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| HIST3H3 | Protein-peptide | physical | 23281010, (Europe PMC) | NA | BioGRID |
| HSPA4 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| HSPH1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| IPO7 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| IPO8 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| IRF5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JMJD6 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| KYNU | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| LMNA | Proximity Label-MS | physical | 22412018, (Europe PMC) | NA | BioGRID |
| LRIF1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAPK11 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MAPK14 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MED4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MSL1 | Two-hybrid | physical | 19650074, (Europe PMC) | NA | BioGRID |
| MTNR1B | Reconstituted Complex, tandem affinity purification | association, physical | 17215244, 26514267, (Europe PMC) | 0.53 | BioGRID, IntAct |
| NCBP1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| NEPRO | Affinity Capture-MS | physical | 26472760, (Europe PMC) | NA | BioGRID |
| NPM1 | Affinity Capture-MS | physical | 23402259, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| OAS3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PAIP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PARP1 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PAWR | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PFDN4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PKN1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| POP1 | Affinity Capture-MS | physical | 24778252, (Europe PMC) | NA | BioGRID |
| PPAN | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| PSMA1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PTK7 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PUF60 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PUS1 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| RBM4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RBM45 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RCC1 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| RPS6KA1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RPS6KB2 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| S100P | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SARS | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SBK1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SHMT2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| SIRT7 | Affinity Capture-MS | physical | 22586326, (Europe PMC) | NA | BioGRID |
| SNX12 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SNX3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SPHK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25216046, 26186194, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SPR | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SRPK1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SRPK2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SRXN1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| STAM | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| STAT6 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| STMN1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| STMN2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SULT1A1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TCEANC2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| TERF1 | Two-hybrid, bimolecular fluorescence complementation, pull down | physical, physical association | 21044950, (Europe PMC) | 0.51 | BioGRID, IntAct |
| TERF2 | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TERF2IP | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TFEB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| THOP1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TLE3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TNS2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| TPD52L2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TROVE2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| TTC1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| TTC9C | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| UBE2C | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| UGP2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| USP36 | Affinity Capture-MS | physical | 19615732, (Europe PMC) | NA | BioGRID |
| USP49 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| USP7 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti tag coimmunoprecipitation | physical, physical association | 19615732, 22361354, 27880917, (Europe PMC) | 0.40 | BioGRID, IntAct |
| VPS29 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| WWP2 | Affinity Capture-MS, Affinity Capture-Western | physical | 25071155, (Europe PMC) | NA | BioGRID |
| XPO7 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| YEATS4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZNF223 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZNF263 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| BCAR1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CDC25A | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| CDK7 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CDK8 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CHEK2 | tandem affinity purification | association | 23178491, (Europe PMC) | 0.35 | IntAct |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FBXO38 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GRWD1 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| HADHA | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| HIF1AN | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| HIST1H2AB | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| HIST1H2AH | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| HIST1H2BJ | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| HIST1H2BK | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| HIST1H3A | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| HIST2H2AB | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| HIST2H2AC | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| HTR2C | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| IFI16 | anti tag coimmunoprecipitation | association | 25665578, (Europe PMC) | 0.35 | IntAct |
| ILKAP | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| IRF5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ITGA9 | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KPNB1 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| LARP7 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| LRIF1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LRPAP1 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| MAP1S | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| MTNR1B | Reconstituted Complex, tandem affinity purification | association, physical | 17215244, 26514267, (Europe PMC) | 0.53 | BioGRID, IntAct |
| NSUN2 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| OAS3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OTUB1 | anti tag coimmunoprecipitation | association | 26752685, (Europe PMC) | 0.35 | IntAct |
| PSMC4 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| PSMD2 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| PYHIN1 | anti tag coimmunoprecipitation | association | 25665578, (Europe PMC) | 0.35 | IntAct |
| RBM4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RBM45 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS3A | far western blotting | direct interaction | 17572683, (Europe PMC) | 0.44 | IntAct |
| RPS6KA1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SLX4 | anti tag coimmunoprecipitation | association | 19596235, (Europe PMC) | 0.35 | IntAct |
| SNRNP70 | far western blotting | direct interaction | 17572683, (Europe PMC) | 0.44 | IntAct |
| SNRPA | far western blotting | direct interaction | 17572683, (Europe PMC) | 0.44 | IntAct |
| SPHK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25216046, 26186194, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TERF1 | Two-hybrid, bimolecular fluorescence complementation, pull down | physical, physical association | 21044950, (Europe PMC) | 0.51 | BioGRID, IntAct |
| TERF2 | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TERF2IP | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TFAM | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| TFEB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TP53 | anti tag coimmunoprecipitation | association | 22653443, (Europe PMC) | 0.35 | IntAct, MINT |
| TP53BP1 | proximity-dependent biotin identification | association | 29656893, (Europe PMC) | 0.35 | IntAct |
| TRAF6 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| USP36 | anti tag coimmunoprecipitation | physical association | 19615732, (Europe PMC) | 0.40 | IntAct |
| USP49 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| USP7 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti tag coimmunoprecipitation | physical, physical association | 19615732, 22361354, 27880917, (Europe PMC) | 0.40 | BioGRID, IntAct |
| VPS52 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| XRCC5 | anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical association | 28330616, (Europe PMC) | 0.56 | IntAct |
| XRCC6 | anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical association | 28330616, (Europe PMC) | 0.56 | IntAct |
| YBX1 | far western blotting | direct interaction | 17572683, (Europe PMC) | 0.44 | IntAct |
| YEATS4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| RPS6KA1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TP53 | anti tag coimmunoprecipitation | association | 22653443, (Europe PMC) | 0.35 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AHCYL1 | Co-fractionation | physical | 22939629, 26344197, (Europe PMC) | NA | BioGRID |
| AHSA1 | Affinity Capture-Western | physical | 22504172, (Europe PMC) | NA | BioGRID |
| APEH | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| BAP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| BARD1 | Affinity Capture-MS | physical | 22990118, (Europe PMC) | NA | BioGRID |
| BCAR1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| BTRC | Proximity Label-MS | physical | 25900982, (Europe PMC) | NA | BioGRID |
| CAND1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CARS | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CDC25A | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| CDK7 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CDK8 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CERKL | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CHEK2 | tandem affinity purification | association | 23178491, (Europe PMC) | 0.35 | IntAct |
| COPA | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| COPB2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| COPE | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CPA6 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ECT2 | Affinity Capture-MS | physical | 22990118, (Europe PMC) | NA | BioGRID |
| EWSR1 | Proximity Label-MS | physical | 24999758, (Europe PMC) | NA | BioGRID |
| FAF1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| FBXL17 | Affinity Capture-MS | physical | 27234298, (Europe PMC) | NA | BioGRID |
| FBXO38 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GARS | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| GMPS | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| GRWD1 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| H2AFX | Affinity Capture-MS, Affinity Capture-Western | physical | 18406329, 28514442, (Europe PMC) | NA | BioGRID |
| H2AFY2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| HADHA | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| HIF1AN | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| HIRIP3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| HIST1H2AB | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| HIST1H2AH | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| HIST1H2BA | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| HIST1H2BB | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| HIST1H2BD | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| HIST1H2BG | Proximity Label-MS | physical | 25281560, (Europe PMC) | NA | BioGRID |
| HIST1H2BJ | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| HIST1H2BK | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| HIST1H3A | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| HIST1H4A | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| HIST2H2AB | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| HIST2H2AC | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| HIST3H3 | Protein-peptide | physical | 23281010, (Europe PMC) | NA | BioGRID |
| HSPA4 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| HSPH1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| HTR2C | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| IFI16 | anti tag coimmunoprecipitation | association | 25665578, (Europe PMC) | 0.35 | IntAct |
| ILKAP | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| IPO7 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| IPO8 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| IRF5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ITGA9 | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| JMJD6 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KPNB1 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| KYNU | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| LARP7 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| LMNA | Proximity Label-MS | physical | 22412018, (Europe PMC) | NA | BioGRID |
| LRIF1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LRPAP1 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| MAP1S | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| MAPK11 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MAPK14 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MED4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MSL1 | Two-hybrid | physical | 19650074, (Europe PMC) | NA | BioGRID |
| MTNR1B | Reconstituted Complex, tandem affinity purification | association, physical | 17215244, 26514267, (Europe PMC) | 0.53 | BioGRID, IntAct |
| NCBP1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| NEPRO | Affinity Capture-MS | physical | 26472760, (Europe PMC) | NA | BioGRID |
| NPM1 | Affinity Capture-MS | physical | 23402259, (Europe PMC) | NA | BioGRID |
| NSUN2 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| OAS3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OTUB1 | anti tag coimmunoprecipitation | association | 26752685, (Europe PMC) | 0.35 | IntAct |
| PAIP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PARP1 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PAWR | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PFDN4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PKN1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| POP1 | Affinity Capture-MS | physical | 24778252, (Europe PMC) | NA | BioGRID |
| PPAN | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| PSMA1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PSMC4 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| PSMD2 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| PTK7 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PUF60 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PUS1 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PYHIN1 | anti tag coimmunoprecipitation | association | 25665578, (Europe PMC) | 0.35 | IntAct |
| RBM4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RBM45 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RCC1 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| RPS3A | far western blotting | direct interaction | 17572683, (Europe PMC) | 0.44 | IntAct |
| RPS6KA1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RPS6KB2 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| S100P | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SARS | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SBK1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SHMT2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| SIRT7 | Affinity Capture-MS | physical | 22586326, (Europe PMC) | NA | BioGRID |
| SLX4 | anti tag coimmunoprecipitation | association | 19596235, (Europe PMC) | 0.35 | IntAct |
| SNRNP70 | far western blotting | direct interaction | 17572683, (Europe PMC) | 0.44 | IntAct |
| SNRPA | far western blotting | direct interaction | 17572683, (Europe PMC) | 0.44 | IntAct |
| SNX12 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SNX3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SPHK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25216046, 26186194, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SPR | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SRPK1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SRPK2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SRXN1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| STAM | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| STAT6 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| STMN1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| STMN2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SULT1A1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TCEANC2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| TERF1 | Two-hybrid, bimolecular fluorescence complementation, pull down | physical, physical association | 21044950, (Europe PMC) | 0.51 | BioGRID, IntAct |
| TERF2 | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TERF2IP | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TFAM | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| TFEB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| THOP1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TLE3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TNS2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| TP53 | anti tag coimmunoprecipitation | association | 22653443, (Europe PMC) | 0.35 | IntAct, MINT |
| TP53BP1 | proximity-dependent biotin identification | association | 29656893, (Europe PMC) | 0.35 | IntAct |
| TPD52L2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TRAF6 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TROVE2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| TTC1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| TTC9C | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| UBE2C | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| UGP2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| USP36 | Affinity Capture-MS | physical | 19615732, (Europe PMC) | NA | BioGRID |
| USP36 | anti tag coimmunoprecipitation | physical association | 19615732, (Europe PMC) | 0.40 | IntAct |
| USP49 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| USP7 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti tag coimmunoprecipitation | physical, physical association | 19615732, 22361354, 27880917, (Europe PMC) | 0.40 | BioGRID, IntAct |
| VPS29 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| VPS52 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| WWP2 | Affinity Capture-MS, Affinity Capture-Western | physical | 25071155, (Europe PMC) | NA | BioGRID |
| XPO7 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| XRCC5 | anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical association | 28330616, (Europe PMC) | 0.56 | IntAct |
| XRCC6 | anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical association | 28330616, (Europe PMC) | 0.56 | IntAct |
| YBX1 | far western blotting | direct interaction | 17572683, (Europe PMC) | 0.44 | IntAct |
| YEATS4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZNF223 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ZNF263 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| Phosphorylating Kinases | Phosphoresidues | Detection Method | PubMed IDs | Source |
| ATM | S183_GTGEEPGsQGLNGEA, | NA | NA | PhosphoSitePlus, |
| Unknown | S183_GTGEEPGsQGLNGEA, S195_GEAGPEDsTRETPSQ, S201_DSTRETPsQENGPTA, S327_KEEPGSDsGTTAVVA, S517_TAELQPEsGKRKLEE, S527_RKLEEVLsTEGAEEN, S537_GAEENGNsDKKKKAK, T199_PEDSTREtPSQENGP, | HTP, in vivo | 17287340, 17525332, 18077418, 18669648, 20068231,(Europe PMC) | HPRD, PhosphoELM, |