Top
DDX20
Localization (UniProt annotation) Cytoplasm Nucleus, gem Note=Localized insubnuclear structures next to coiled bodies, called Gemini ofCajal bodies (Gems) Function (UniProt annotation) The SMN complex plays a catalyst role in the assembly ofsmall nuclear ribonucleoproteins (snRNPs), the building blocks ofthe spliceosome Thereby, plays an important role in the splicingof cellular pre-mRNAs Most spliceosomal snRNPs contain a commonset of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF andSNRPG that assemble in a heptameric protein ring on the Sm site ofthe small nuclear RNA to form the core snRNP In the cytosol, theSm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped inan inactive 6S pICln-Sm complex by the chaperone CLNS1A thatcontrols the assembly of the core snRNP Dissociation by the SMNcomplex of CLNS1A from the trapped Sm proteins and their transferto an SMN-Sm complex triggers the assembly of core snRNPs andtheir transport to the nucleus May also play a role in themetabolism of small nucleolar ribonucleoprotein (snoRNPs) Catalytic Activity (UniProt annotation) ATP + H(2)O = ADP + phosphate Protein Sequence MAAAFEASGALAAVATAMPAEHVAVQVPAPEPTPGPVRILRTAQDLSSPRTRTGDVLLAEPADFESLLLSRPVLEGLRAA
GFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGL
ECHVFIGGTPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQML
AVSATYPEFLANALTKYMRDPTFVRLNSSDPSLIGLKQYYKVVNSYPLAHKVFEEKTQHLQELFSRIPFNQALVFSNLHS
RAQHLADILSSKGFPAECISGNMNQNQRLDAMAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRA
GRFGTLGLTVTYCCRGEEENMMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVKAAVHTYGIASVPNQPLKKQIQKIE
RTLQIQKAHGDHMASSRNNSVSGLSVKSKNNTKQKLPVKSHSECGIIEKATSPKELGCDRQSEEQMKNSVQTPVENSTNS
QHQVKEALPVSLPQIPCLSSFKIHQPYTLTFAELVEDYEHYIKEGLEKPVEIIRHYTGPGDQTVNPQNGFVRNKVIEQRV
PVLASSSQSGDSESDSDSYSSRTSSQSKGNKSYLEGSSDNQLKDSESTPVDDRISLEQPPNGSDTPNPEKYQESPGIQMK
TRLKEGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQ
RHPSWMAAYHMNTIYLQEMMHSNQ
ELM Motif Motif Instance
Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) hsa03013 RNA transport RNA transport from the nucleus to the cytoplasm is fundamental for gene expression. The different RNA species that are produced in the nucleus are exported through the nuclear pore complexes (NPCs) via mobile export receptors. The majority of RNAs, such as tRNAs, rRNAs, and U snRNAs, are transported by specific export receptors, which belong to the karyopherin-beta family proteins. A feature of karyopherins is their regulation by the small GTPase Ran. However, general mRNA export is mechanistically different. Nuclear export of mRNAs is functionally coupled to different steps in gene expression processes, such as transcription, splicing, 3'-end formation and even translation.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-191859 snRNP Assembly. Small nuclear ribonucleoproteins (snRNPs) are crucial for pre-mRNA processing to mRNAs. Each snRNP contains a small nuclear RNA (snRNA) and an extremely stable core of seven Sm proteins. The U6 snRNA differs from the other snRNAs; it binds seven Sm-like proteins and its assembly does not involve a cytoplasmic phase. The snRNP biogenesis pathway for all of the other snRNAs is complex, involving nuclear export of snRNA, Sm-core assembly in the cytoplasm and re-import of the mature snRNP. The assembly of the snRNA:Sm-core is carried out by the survival of motor neurons (SMN) complex. The SMN complex stringently scrutinizes RNAs for specific features that define them as snRNAs and binds the RNA-binding Sm proteins
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ALDH3A2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID AP3B1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct APP Reconstituted Complex physical 21244100 , 21832049 , (Europe PMC )NA BioGRID ATRX Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct BARD1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID CD2BP2 Affinity Capture-MS physical 28561026 , (Europe PMC )NA BioGRID CLN3 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct COMTD1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID COPA Affinity Capture-Western physical 21300694 , (Europe PMC )NA BioGRID COPS5 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CPSF7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CRY2 Affinity Capture-MS physical 25756610 , (Europe PMC )NA BioGRID CRYAB Affinity Capture-MS, Affinity Capture-Western, Two-hybrid physical 24023879 , 26186194 , (Europe PMC )NA BioGRID DCLRE1C Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID DDX20 Affinity Capture-Western physical 23752268 , (Europe PMC )NA BioGRID DHX9 Affinity Capture-Western physical 11149922 , (Europe PMC )NA BioGRID DICER1 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.35 BioGRID, IntAct EAF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct EGFR Affinity Capture-MS physical 23956138 , (Europe PMC )NA BioGRID EIF2AK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct FBL Affinity Capture-Western physical 11509230 , (Europe PMC )NA BioGRID GAPDHS Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GAR1 Affinity Capture-Western physical 11509230 , (Europe PMC )NA BioGRID GEMIN2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10601333 , 11714716 , 11914277 , 23221635 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT GEMIN4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, pull down, two hybrid array, two hybrid prey pooling approach association, direct interaction, physical, physical association 10725331 , 11714716 , 11914277 , 12668731 , 23752268 , 28514442 , (Europe PMC )0.83 BioGRID, IntAct, MINT GEMIN5 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 11714716 , 11914277 , 23221635 , 24923560 , 26496610 , 28514442 , (Europe PMC )0.60 BioGRID, IntAct, MINT GEMIN6 Affinity Capture-MS, Affinity Capture-Western physical 11748230 , 28514442 , (Europe PMC )NA BioGRID GEMIN7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct GEMIN8 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GIGYF2 Affinity Capture-MS physical 20696395 , (Europe PMC )NA BioGRID GSK3B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HDAC11 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.46 BioGRID, IntAct HDAC5 Affinity Capture-MS physical 21081666 , (Europe PMC )NA BioGRID ITCH Affinity Capture-Western physical 26908624 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID LSM11 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LSM2 Affinity Capture-Western, Reconstituted Complex physical 10601333 , (Europe PMC )NA BioGRID MCM3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MFAP1 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID MYC Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct NAF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct NANOG Affinity Capture-MS physical 26687479 , (Europe PMC )NA BioGRID NCBP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NSD2 Affinity Capture-MS physical 24923560 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NUFIP1 Reconstituted Complex, Two-hybrid physical 26275778 , (Europe PMC )NA BioGRID P2RY12 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PARP16 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PHAX Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PHB2 Affinity Capture-MS physical 17353931 , (Europe PMC )NA BioGRID PNKP Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct POLD1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct POLR1E Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct POU5F1 Affinity Capture-MS physical 26687479 , (Europe PMC )NA BioGRID PPP4R2 Affinity Capture-MS, Affinity Capture-Western physical 12668731 , (Europe PMC )NA BioGRID PRRC2A Two-hybrid, two hybrid physical, physical association 14667819 , (Europe PMC )0.37 BioGRID, IntAct PTPN9 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RBM14 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct RN7SL1 Protein-RNA physical 23221635 , (Europe PMC )NA BioGRID RNPS1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RNU1-1 Protein-RNA physical 23221635 , (Europe PMC )NA BioGRID RNU2-1 Protein-RNA physical 23221635 , (Europe PMC )NA BioGRID SCN2B Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID SIGLECL1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SLX1B Affinity Capture-MS physical 19596235 , (Europe PMC )NA BioGRID SMN1 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Co-purification, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10601333 , 10942426 , 11714716 , 11914277 , 12668731 , 19928837 , 21072240 , 21300694 , 22939629 , 23752268 , 26908624 , (Europe PMC )0.73 BioGRID, IntAct, MINT SMN2 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation physical 22939629 , 23112048 , 28514442 , (Europe PMC )NA BioGRID SNRNP70 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SNRPB Affinity Capture-Western, Reconstituted Complex physical 10601333 , (Europe PMC )NA BioGRID SNRPD1 Affinity Capture-Western, Reconstituted Complex physical 10601333 , (Europe PMC )NA BioGRID SNRPD2 Affinity Capture-Western, Reconstituted Complex physical 10601333 , (Europe PMC )NA BioGRID SNRPD3 Affinity Capture-Western, Reconstituted Complex physical 10601333 , (Europe PMC )NA BioGRID SNRPE Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 10601333 , 28514442 , (Europe PMC )NA BioGRID SNRPF Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 10601333 , 28514442 , (Europe PMC )NA BioGRID SNRPG Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 10601333 , 28514442 , (Europe PMC )NA BioGRID SNUPN Reconstituted Complex physical 12095920 , (Europe PMC )NA BioGRID SRP54 Affinity Capture-Western physical 23221635 , (Europe PMC )NA BioGRID SRP9 Affinity Capture-Western physical 23221635 , (Europe PMC )NA BioGRID STRAP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct TCF3 Affinity Capture-MS physical 22354994 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-MS, Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID UBL4A Affinity Capture-MS physical 23246001 , (Europe PMC )NA BioGRID USO1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID USP9X Affinity Capture-MS, Affinity Capture-Western physical 23112048 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ATRX Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct BRF2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CIAO1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CLN3 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct DICER1 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.35 BioGRID, IntAct EAF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct EIF2AK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct GEMIN2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10601333 , 11714716 , 11914277 , 23221635 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT GEMIN4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, pull down, two hybrid array, two hybrid prey pooling approach association, direct interaction, physical, physical association 10725331 , 11714716 , 11914277 , 12668731 , 23752268 , 28514442 , (Europe PMC )0.83 BioGRID, IntAct, MINT GEMIN5 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 11714716 , 11914277 , 23221635 , 24923560 , 26496610 , 28514442 , (Europe PMC )0.60 BioGRID, IntAct, MINT GEMIN7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct GSK3B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HDAC11 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.46 BioGRID, IntAct HSCB anti bait coimmunoprecipitation association 28380382 , (Europe PMC )0.35 IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP1LC3A anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct MCM3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MED19 anti tag coimmunoprecipitation association 15175163 , (Europe PMC )0.35 IntAct MED29 anti tag coimmunoprecipitation association 15175163 , (Europe PMC )0.35 IntAct MYC Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct NAF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct NCBP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PARP2 protein array adp ribosylation reaction 21812934 , (Europe PMC )0.44 IntAct, MINT PHB2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PNKP Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct POLD1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct POLR1E Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct PRKAB1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PRRC2A Two-hybrid, two hybrid physical, physical association 14667819 , (Europe PMC )0.37 BioGRID, IntAct PTP4A3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct RBM14 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct RNPS1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct SLX1A anti tag coimmunoprecipitation association 19596235 , (Europe PMC )0.35 IntAct SMN1 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Co-purification, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10601333 , 10942426 , 11714716 , 11914277 , 12668731 , 19928837 , 21072240 , 21300694 , 22939629 , 23752268 , 26908624 , (Europe PMC )0.73 BioGRID, IntAct, MINT STRAP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct TP53BP1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TPTE pull down association 28330616 , (Europe PMC )0.35 IntAct WRAP53 anti bait coimmunoprecipitation physical association 21072240 , (Europe PMC )0.40 IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source GEMIN4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, pull down, two hybrid array, two hybrid prey pooling approach association, direct interaction, physical, physical association 10725331 , 11714716 , 11914277 , 12668731 , 23752268 , 28514442 , (Europe PMC )0.83 BioGRID, IntAct, MINT GEMIN5 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 11714716 , 11914277 , 23221635 , 24923560 , 26496610 , 28514442 , (Europe PMC )0.60 BioGRID, IntAct, MINT JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PARP2 protein array adp ribosylation reaction 21812934 , (Europe PMC )0.44 IntAct, MINT SMN1 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Co-purification, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10601333 , 10942426 , 11714716 , 11914277 , 12668731 , 19928837 , 21072240 , 21300694 , 22939629 , 23752268 , 26908624 , (Europe PMC )0.73 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ALDH3A2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID AP3B1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct APP Reconstituted Complex physical 21244100 , 21832049 , (Europe PMC )NA BioGRID ATRX Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct BARD1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID BRF2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CD2BP2 Affinity Capture-MS physical 28561026 , (Europe PMC )NA BioGRID CIAO1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CLN3 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct COMTD1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID COPA Affinity Capture-Western physical 21300694 , (Europe PMC )NA BioGRID COPS5 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CPSF7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CRY2 Affinity Capture-MS physical 25756610 , (Europe PMC )NA BioGRID CRYAB Affinity Capture-MS, Affinity Capture-Western, Two-hybrid physical 24023879 , 26186194 , (Europe PMC )NA BioGRID DCLRE1C Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID DDX20 Affinity Capture-Western physical 23752268 , (Europe PMC )NA BioGRID DHX9 Affinity Capture-Western physical 11149922 , (Europe PMC )NA BioGRID DICER1 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.35 BioGRID, IntAct EAF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct EGFR Affinity Capture-MS physical 23956138 , (Europe PMC )NA BioGRID EIF2AK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct FBL Affinity Capture-Western physical 11509230 , (Europe PMC )NA BioGRID GAPDHS Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GAR1 Affinity Capture-Western physical 11509230 , (Europe PMC )NA BioGRID GEMIN2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10601333 , 11714716 , 11914277 , 23221635 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT GEMIN4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, pull down, two hybrid array, two hybrid prey pooling approach association, direct interaction, physical, physical association 10725331 , 11714716 , 11914277 , 12668731 , 23752268 , 28514442 , (Europe PMC )0.83 BioGRID, IntAct, MINT GEMIN5 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 11714716 , 11914277 , 23221635 , 24923560 , 26496610 , 28514442 , (Europe PMC )0.60 BioGRID, IntAct, MINT GEMIN6 Affinity Capture-MS, Affinity Capture-Western physical 11748230 , 28514442 , (Europe PMC )NA BioGRID GEMIN7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct GEMIN8 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GIGYF2 Affinity Capture-MS physical 20696395 , (Europe PMC )NA BioGRID GSK3B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HDAC11 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.46 BioGRID, IntAct HDAC5 Affinity Capture-MS physical 21081666 , (Europe PMC )NA BioGRID HSCB anti bait coimmunoprecipitation association 28380382 , (Europe PMC )0.35 IntAct ITCH Affinity Capture-Western physical 26908624 , (Europe PMC )NA BioGRID JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID LSM11 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LSM2 Affinity Capture-Western, Reconstituted Complex physical 10601333 , (Europe PMC )NA BioGRID MAP1LC3A anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct MCM3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MED19 anti tag coimmunoprecipitation association 15175163 , (Europe PMC )0.35 IntAct MED29 anti tag coimmunoprecipitation association 15175163 , (Europe PMC )0.35 IntAct MFAP1 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID MYC Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct NAF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct NANOG Affinity Capture-MS physical 26687479 , (Europe PMC )NA BioGRID NCBP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NSD2 Affinity Capture-MS physical 24923560 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NUFIP1 Reconstituted Complex, Two-hybrid physical 26275778 , (Europe PMC )NA BioGRID P2RY12 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PARP16 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PARP2 protein array adp ribosylation reaction 21812934 , (Europe PMC )0.44 IntAct, MINT PHAX Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PHB2 Affinity Capture-MS physical 17353931 , (Europe PMC )NA BioGRID PHB2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PNKP Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct POLD1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct POLR1E Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct POU5F1 Affinity Capture-MS physical 26687479 , (Europe PMC )NA BioGRID PPP4R2 Affinity Capture-MS, Affinity Capture-Western physical 12668731 , (Europe PMC )NA BioGRID PRKAB1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PRRC2A Two-hybrid, two hybrid physical, physical association 14667819 , (Europe PMC )0.37 BioGRID, IntAct PTP4A3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PTPN9 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RBM14 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct RN7SL1 Protein-RNA physical 23221635 , (Europe PMC )NA BioGRID RNPS1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RNU1-1 Protein-RNA physical 23221635 , (Europe PMC )NA BioGRID RNU2-1 Protein-RNA physical 23221635 , (Europe PMC )NA BioGRID SCN2B Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID SIGLECL1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SLX1A anti tag coimmunoprecipitation association 19596235 , (Europe PMC )0.35 IntAct SLX1B Affinity Capture-MS physical 19596235 , (Europe PMC )NA BioGRID SMN1 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Co-purification, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10601333 , 10942426 , 11714716 , 11914277 , 12668731 , 19928837 , 21072240 , 21300694 , 22939629 , 23752268 , 26908624 , (Europe PMC )0.73 BioGRID, IntAct, MINT SMN2 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation physical 22939629 , 23112048 , 28514442 , (Europe PMC )NA BioGRID SNRNP70 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SNRPB Affinity Capture-Western, Reconstituted Complex physical 10601333 , (Europe PMC )NA BioGRID SNRPD1 Affinity Capture-Western, Reconstituted Complex physical 10601333 , (Europe PMC )NA BioGRID SNRPD2 Affinity Capture-Western, Reconstituted Complex physical 10601333 , (Europe PMC )NA BioGRID SNRPD3 Affinity Capture-Western, Reconstituted Complex physical 10601333 , (Europe PMC )NA BioGRID SNRPE Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 10601333 , 28514442 , (Europe PMC )NA BioGRID SNRPF Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 10601333 , 28514442 , (Europe PMC )NA BioGRID SNRPG Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 10601333 , 28514442 , (Europe PMC )NA BioGRID SNUPN Reconstituted Complex physical 12095920 , (Europe PMC )NA BioGRID SRP54 Affinity Capture-Western physical 23221635 , (Europe PMC )NA BioGRID SRP9 Affinity Capture-Western physical 23221635 , (Europe PMC )NA BioGRID STRAP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct TCF3 Affinity Capture-MS physical 22354994 , (Europe PMC )NA BioGRID TP53BP1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TPTE pull down association 28330616 , (Europe PMC )0.35 IntAct TRIM25 Affinity Capture-MS, Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID UBL4A Affinity Capture-MS physical 23246001 , (Europe PMC )NA BioGRID USO1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID USP9X Affinity Capture-MS, Affinity Capture-Western physical 23112048 , (Europe PMC )NA BioGRID WRAP53 anti bait coimmunoprecipitation physical association 21072240 , (Europe PMC )0.40 IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
Unknown S187_KCHIAVGsPGRIKQL , S268_PTFVRLNsSDPSLIG , S272_RLNSSDPsLIGLKQY , S47_LRTAQDLsSPRTRTG , S48_RTAQDLSsPRTRTGD , S500_MASSRNNsVSGLSVK , S502_SSRNNSVsGLSVKSK , S532_GIIEKATsPKELGCD , S549_SEEQMKNsVQTPVEN , S557_VQTPVENsTNSQHQV , S560_PVENSTNsQHQVKEA , S649_VLASSSQsGDSESDS , S652_SSSQSGDsESDSDSY , S654_SQSGDSEsDSDSYSS , S656_SGDSESDsDSYSSRT , S672_SQSKGNKsYLEGSSD , S677_NKSYLEGsSDNQLKD , S678_KSYLEGSsDNQLKDS , S703_LEQPPNGsDTPNPEK , S714_NPEKYQEsPGIQMKT , S743_RNLPRRSsFRLQTEA , S86_AAGFERPsPVQLKAI , T552_QMKNSVQtPVENSTN , T688_QLKDSEStPVDDRIS , T705_QPPNGSDtPNPEKYQ , Y673_QSKGNKSyLEGSSDN , HTP, in vivo 15302935 , 16964243 , 17081983 , 17322306 , 18669648 , 18691976 , 18767875 , 19007248 , 19413330 , 19651622 , 19664994 , 19664995 , 19691289 , 20068231 ,(Europe PMC )HPRD, PhosphoELM ,