Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
SMN1
Gene Name  | SMN1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 1MHN |
| Synonyms | SMN1, SMN, SMNT, SMN2, SMNC | |
| Protein Name | SMN1 | |
| Alternative Name(s) | Survival motor neuron protein;Component of gems 1;Gemin-1; | |
| Protein Family | Belongs to the SMN family | |
| EntrezGene ID | 6606 6607 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q16637 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 31849 Dalton | |
| Protein Length | 294 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000172062 (Ensembl) | ENSG00000205571 (Ensembl) | ENSG00000277773 (Ensembl) | ENSG00000273772 (Ensembl) | ENSG00000275349 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG4327 | eggNOG - ENOG4111ME8 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Nucleus, gem Nucleus,Cajal body Cytoplasm Cytoplasmic granule Perikaryon Cell projection Cytoplasm, myofibril, sarcomere, Zline Note=Colocalizes with actinand at the Z-line of skeletal muscle (By similarity) Under stressconditions colocalizes with RPP20/POP7 in punctuated cytoplasmicgranules (PubMed:14715275) Colocalized and redistributed withZPR1 from the cytoplasm to nuclear gems (Gemini of coiled bodies)and Cajal bodies (PubMed:11283611) Colocalizes with FMR1 incytoplasmic granules in the soma and neurite cell processes(PubMed:18093976) | |||
| Function (UniProt annotation) | |||
| The SMN complex plays a catalyst role in the assembly ofsmall nuclear ribonucleoproteins (snRNPs), the building blocks ofthe spliceosome Thereby, plays an important role in the splicingof cellular pre-mRNAs Most spliceosomal snRNPs contain a commonset of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF andSNRPG that assemble in a heptameric protein ring on the Sm site ofthe small nuclear RNA to form the core snRNP In the cytosol, theSm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped inan inactive 6S pICln-Sm complex by the chaperone CLNS1A thatcontrols the assembly of the core snRNP Dissociation by the SMNcomplex of CLNS1A from the trapped Sm proteins and their transferto an SMN-Sm complex triggers the assembly of core snRNPs andtheir transport to the nucleus Ensures the correct splicing ofU12 intron-containing genes that may be important for normal motorand proprioceptive neurons development Also required forresolving RNA-DNA hybrids created by RNA polymerase II, that formR-loop in transcription terminal regions, an important step inproper transcription termination May also play a role in themetabolism of small nucleolar ribonucleoprotein (snoRNPs) | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKS QKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENE NESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGP PIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000245 | P:spliceosomal complex assembly |
| GO:0000387 | P:spliceosomal snRNP assembly |
| GO:0003723 | F:RNA binding |
| GO:0005634 | C:nucleus |
| GO:0005654 | C:nucleoplasm |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0006353 | P:DNA-templated transcription |
| GO:0007399 | termination |
| GO:0015030 | P:nervous system development |
| GO:0030018 | C:Cajal body |
| GO:0032797 | C:Z disc |
| GO:0034719 | C:SMN complex |
| GO:0036464 | C:SMN-Sm protein complex |
| GO:0042802 | C:cytoplasmic ribonucleoprotein granule |
| GO:0043005 | F:identical protein binding |
| GO:0043204 | C:neuron projection |
| GO:0051170 | C:perikaryon |
| GO:0097504 | P:import into nucleus |
