Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
CTDSP2
Gene Name  | CTDSP2 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | CTDSP2, NIF2, OS4, SCP2 | |
| Protein Name | CTDSP2 |
|
| Alternative Name(s) |
Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2;3.1.3.16;Nuclear LIM interactor-interacting factor 2;NLI-interacting factor 2;Protein OS-4;Small C-terminal domain phosphatase 2;Small CTD phosphatase 2;SCP2; | |
| EntrezGene ID | 10106 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | O14595 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 (BRENDA ) | |
| Molecular Weight | 30664 Dalton | |
| Protein Length | 271 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000175215 (Ensembl) | | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: HAD --> Family: FCP --> Subfamily: SCP | Historic class: PSTPs --> FCP/SCP | CATH ID: 3.40.50.1000 | SCOP Fold: HAD | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Nucleus | |||
| Function (UniProt annotation) | |||
| Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residue repeats in the C-terminal domain(CTD) of the largest RNA polymerase II subunit POLR2A Negativelyregulates RNA polymerase II transcription, possibly by controllingthe transition from initiation/capping to processive transcriptelongation Recruited by REST to neuronal genes that contain RE-1elements, leading to neuronal gene silencing in non-neuronalcells May contribute to the development of sarcomas | |||
| Catalytic Activity (UniProt annotation) | |||
| [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQY QFYQIPGTCLLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRMGELFECV LFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDM ADTELLNLIPIFEELSGAEDVYTSLGQLRAP |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0001933 | P:negative regulation of protein phosphorylation |
| GO:0005654 | C:nucleoplasm |
| GO:0006470 | P:protein dephosphorylation |
| GO:0008420 | F:RNA polymerase II CTD heptapeptide repeat phosphatase activity |
| GO:0036498 | P:IRE1-mediated unfolded protein response |
| GO:0046872 | F:metal ion binding |
| GO:2000134 | P:negative regulation of G1/S transition of mitotic cell cycle |
