Top
SNCA
Localization (UniProt annotation) Cytoplasm, cytosolMembrane Nucleus Celljunction, synapse Secreted Note=Membrane-bound in dopaminergicneurons Function (UniProt annotation) May be involved in the regulation of dopamine releaseand transport Induces fibrillization of microtubule-associatedprotein tau Reduces neuronal responsiveness to various apoptoticstimuli, leading to a decreased caspase-3 activation Catalytic Activity (UniProt annotation) N/A Protein Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK
TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
ELM Motif Motif Instance
Description Motif Regex MOD_Plk_2-3 126-EMPSEEG-132 Polo-like kinase phosphosites [DE]..([ST])[EDILMVFWY](([DE].)|(.[DE]))
SNCA is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa05010 Alzheimer disease Alzheimer disease (AD) is a chronic disorder that slowly destroys neurons and causes serious cognitive disability. AD is associated with senile plaques and neurofibrillary tangles (NFTs). Amyloid-beta (Abeta), a major component of senile plaques, has various pathological effects on cell and organelle function. The extracellular Abeta oligomers may activate caspases through activation of cell surface death receptors. Alternatively, intracellular Abeta may contribute to pathology by facilitating tau hyper-phosphorylation, disrupting mitochondria function, and triggering calcium dysfunction. To date genetic studies have revealed four genes that may be linked to autosomal dominant or familial early onset AD (FAD). These four genes include: amyloid precursor protein (APP), presenilin 1 (PS1), presenilin 2 (PS2) and apolipoprotein E (ApoE). All mutations associated with APP and PS proteins can lead to an increase in the production of Abeta peptides, specfically the more amyloidogenic form, Abeta42. FAD-linked PS1 mutation downregulates the unfolded protein response and leads to vulnerability to ER stress. hsa05012 Parkinson disease Parkinson disease (PD) is a progressive neurodegenerative movement disorder that results primarily from the death of dopaminergic (DA) neurons in the substantia nigra pars compacta (SNc). Mutations in alpha-synuclein, UCHL1 (a ubiquitin carboxy-terminal hydrolase L1), parkin, DJ1 (a parkin-associated protein involved with oxidative stress), and PINK1 (a putative serine threonine kinase) are known to cause early-onset PD. Mutations or altered expression of these proteins contributes to the damage and subsequent loss of DA neurons through common mechanisms that result in proteasome dysfunction, mitochondrial impairment, and oxidative stress. The demise of DA neurons located in the SNc leads to a drop in the dopaminergic input to the striatum. This results in a reduced activation of the direct pathway and in a disinhibition of the indirect pathway, which is associated with the elevation of adenosine A2A receptor transmission. Such unbalanced activity of the striatal output pathway is at the basis of the motor impairment observed in PD.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-977225 Amyloid fiber formation. Amyloid is a term used to describe deposits of fibrillar proteins, typically extracellular. The abnormal accumulation of amyloid, amyloidosis, is a term associated with tissue damage caused by amyloid deposition, seen in numerous diseases including neurodegenerative diseases such as Alzheimer's, Parkinson's and Huntington's. Amyloid deposits consist predominantly of amyloid fibrils, rigid, non-branching structures that form ordered assemblies, characteristically with a cross beta-sheet structure where the sheets run parallel to the direction of the fibril (Sawaya et al. 2007). Often the fibril has a left-handed twist (Nelson & Eisenberg 2006). At least 27 human proteins form amyloid fibrils (Sipe et al. 2010). Many of these proteins have non-pathological functions; the trigger that leads to abnormal aggregations differs between proteins and is not well understood but in many cases the peptides are abnormal fragments or mutant forms arising from polymorphisms, suggesting that the initial event may be aggregation of misfolded or unfolded peptides. Early studies of Amyloid-beta assembly led to a widely accepted model that assembly was a nucleation-dependent polymerization reaction (Teplow 1998) but it is now understood to be more complex, with multiple 'off-pathway' events leading to a variety of oligomeric structures in addition to fibrils (Roychaudhuri et al. 2008), though it is unclear whether these intermediate steps are required in vivo. An increasing body of evidence suggests that these oligomeric forms are primarily responsible for the neurotoxic effects of Amyloid-beta (Roychaudhuri et al. 2008), alpha-synuclein (Winner et al. 2011) and tau (Dance & Strobel 2009, Meraz-Rios et al. 2010). Amyloid oligomers are believed to have a common structural motif that is independent of the protein involved and not present in fibrils (Kayed et al. 2003). Conformation dependent, aggregation specific antibodies suggest that there are 3 general classes of amyloid oligomer structures (Glabe 2009) including annular structures which may be responsible for the widely reported membrane permeabilization effect of amyloid oligomers. Toxicity of amyloid oligomers preceeds the appearance of plaques in mouse models (Ferretti et al. 2011). Fibrils are often associated with other molecules, notably heparan sulfate proteoglycans and Serum Amyloid P-component, which are universally associated and seem to stabilize fibrils, possibly by protecting them from degradation
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTA1 Reconstituted Complex physical 19553474 , (Europe PMC )NA BioGRID ACTB Affinity Capture-Western physical 18331289 , (Europe PMC )NA BioGRID ADAP2 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID AKAP17A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AKT1 Affinity Capture-Western, Far Western physical 21474915 , (Europe PMC )NA BioGRID ANXA6 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID AP1B1 Affinity Capture-Western physical 18614564 , (Europe PMC )NA BioGRID APLP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT APP Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay physical, physical association 18769546 , 21832049 , 25241761 , 7568089 , 9163350 , (Europe PMC )0.40 BioGRID, IntAct ARHGAP15 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID ARPP19 Reconstituted Complex physical 17893145 , (Europe PMC )NA BioGRID ARRB1 Affinity Capture-Western physical 20448034 , (Europe PMC )NA BioGRID BAD Affinity Capture-Western physical 15978696 , (Europe PMC )NA BioGRID BAG5 Affinity Capture-Western, Reconstituted Complex physical 21358815 , (Europe PMC )NA BioGRID BAX Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct BDH2 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID CALM1 Affinity Capture-Western, Reconstituted Complex physical 12358748 , 12610000 , (Europe PMC )NA BioGRID CAV1 Reconstituted Complex physical 21693152 , (Europe PMC )NA BioGRID CBX4 Affinity Capture-Western physical 21256122 , (Europe PMC )NA BioGRID CDC42EP2 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID CDC42EP3 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID CDC42SE1 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID CDK4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CEP295 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID CGRRF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHMP5 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CLTC Affinity Capture-Western physical 18614564 , (Europe PMC )NA BioGRID CMBL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct COL7A1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct COX1 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID CRYAB Co-crystal Structure, Co-fractionation, Reconstituted Complex physical 15236975 , 20197038 , 21905118 , (Europe PMC )NA BioGRID CSNK1A1 Biochemical Activity physical 10617630 , 16959772 , (Europe PMC )NA BioGRID CSNK1D Biochemical Activity, Co-localization, proximity ligation assay physical, physical association 16618118 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct CSNK2A1 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 10617630 , 15033366 , 19576176 , (Europe PMC )0.44 BioGRID, IntAct CTNND1 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID CTSD Biochemical Activity physical 25617759 , (Europe PMC )NA BioGRID DGUOK Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID DHCR24 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DMTN Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID DNAAF2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DNAJB1 Affinity Capture-Western physical 17012257 , (Europe PMC )NA BioGRID DOCK7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DYNC1H1 Affinity Capture-MS, Protein-peptide, anti tag coimmunoprecipitation association, physical 17893145 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct DYNLL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DYRK1A Affinity Capture-Western, Biochemical Activity physical 16959772 , (Europe PMC )NA BioGRID EEF1A1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EFTUD2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct EGFR Affinity Capture-Luminescence, PCA, Two-hybrid, ubiquitin reconstruction physical, physical association 24658140 , 25402006 , (Europe PMC )0.37 BioGRID, IntAct EIF3G Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID ELK1 Affinity Capture-Western physical 11279280 , (Europe PMC )NA BioGRID ENC1 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID ENSA Protein-peptide, Reconstituted Complex physical 17893145 , 18973346 , (Europe PMC )NA BioGRID FBXW7 Affinity Capture-Western physical 26033182 , (Europe PMC )NA BioGRID FKBP4 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID FMR1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID FSD1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID FXR1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID FXR2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FYN Biochemical Activity physical 11078745 , 11162638 , 15033366 , (Europe PMC )NA BioGRID GABARAPL1 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID GAPDH Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 15673432 , 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GBA Affinity Capture-Western, Reconstituted Complex physical 21653695 , 23266198 , (Europe PMC )NA BioGRID GRK1 Biochemical Activity physical 10852916 , (Europe PMC )NA BioGRID GRK2 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID GRK5 Biochemical Activity physical 10852916 , (Europe PMC )NA BioGRID GRK6 Biochemical Activity physical 10852916 , (Europe PMC )NA BioGRID GSK3B Reconstituted Complex, pull down direct interaction, physical, physical association 21985244 , (Europe PMC )0.54 BioGRID, IntAct, MINT HAX1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HCLS1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HERC5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HERPUD1 Affinity Capture-Western physical 20604806 , (Europe PMC )NA BioGRID HIST2H3C Affinity Capture-Western, Co-localization physical 16959795 , (Europe PMC )NA BioGRID HK1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HPRT1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HSD17B4 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID HSP90AA1 Reconstituted Complex physical 19759002 , (Europe PMC )NA BioGRID HSPA1A FRET, Reconstituted Complex physical 19875982 , (Europe PMC )NA BioGRID HSPA1L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HSPA4 Affinity Capture-Western, Reconstituted Complex physical 14711827 , 17010992 , 17012257 , 21358815 , 21832061 , 21985244 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-Western, Protein-peptide, Reconstituted Complex physical 17893145 , 21832061 , 22776201 , 22843682 , (Europe PMC )NA BioGRID HSPB1 Affinity Capture-MS, Reconstituted Complex physical 19651786 , 21905118 , (Europe PMC )NA BioGRID HSPB2 Reconstituted Complex physical 21905118 , (Europe PMC )NA BioGRID HSPB6 Reconstituted Complex physical 21905118 , (Europe PMC )NA BioGRID HSPB8 Reconstituted Complex physical 21905118 , (Europe PMC )NA BioGRID IARS Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID ILF3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KIAA1191 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID KLC1 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID KLK6 Biochemical Activity physical 12928483 , (Europe PMC )NA BioGRID LAMP2 Affinity Capture-Western physical 15333840 , (Europe PMC )NA BioGRID LAMTOR4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LCMT2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LRRK2 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 19878656 , 23183827 , (Europe PMC )0.56 BioGRID, IntAct MAN2C1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAP1B Reconstituted Complex physical 10764738 , (Europe PMC )NA BioGRID MAP1LC3A Co-localization physical 22411133 , (Europe PMC )NA BioGRID MAPK1 Affinity Capture-Western, Reconstituted Complex physical 11279280 , 12121974 , (Europe PMC )NA BioGRID MAPK3 Affinity Capture-Western physical 12121974 , (Europe PMC )NA BioGRID MAPK8 Affinity Capture-Western physical 12121974 , (Europe PMC )NA BioGRID MAPT Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, pull down direct interaction, physical, physical association 10464279 , 15904919 , 17408955 , 21127069 , 21985244 , (Europe PMC )0.54 BioGRID, IntAct, MINT MCM5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MEF2D Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID MTREX Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID NCBP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NCBP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NDFIP1 Affinity Capture-Western physical 27173227 , (Europe PMC )NA BioGRID NDUFB6 Affinity Capture-Western physical 18614564 , (Europe PMC )NA BioGRID NEDD4 Affinity Capture-Western, Biochemical Activity physical 21953697 , 24831002 , (Europe PMC )NA BioGRID NEDD4L Biochemical Activity physical 24831002 , (Europe PMC )NA BioGRID NOS1AP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NUFIP1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID P3H1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PAK3 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID PARK7 Affinity Capture-Western physical 15502874 , 15935068 , (Europe PMC )NA BioGRID PATJ Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PDE4DIP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PDIA2 Reconstituted Complex physical 27142583 , (Europe PMC )NA BioGRID PELP1 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID PFDN2 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID PIN1 Affinity Capture-Western, Co-localization physical 16365047 , (Europe PMC )NA BioGRID PINK1 Affinity Capture-Western, Reconstituted Complex physical 19167501 , 27334109 , (Europe PMC )NA BioGRID PLCB2 Reconstituted Complex physical 15641770 , (Europe PMC )NA BioGRID PLD1 Affinity Capture-Western, Reconstituted Complex physical 11821392 , (Europe PMC )NA BioGRID PLK1 Biochemical Activity physical 19889641 , (Europe PMC )NA BioGRID PLK2 Biochemical Activity physical 19889641 , 22988096 , (Europe PMC )NA BioGRID PLK3 Biochemical Activity physical 19889641 , (Europe PMC )NA BioGRID POLR2H Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID POLR2L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPIL3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PRDX1 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID PRDX3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PREP PCA, Reconstituted Complex physical 25555914 , (Europe PMC )NA BioGRID PRKCD Affinity Capture-Western physical 15978696 , (Europe PMC )NA BioGRID PRKN Affinity Capture-MS, Affinity Capture-Western, Phenotypic Suppression genetic, physical 11588587 , 12670421 , 12963044 , 16714300 , 18195004 , 19651786 , 25861987 , (Europe PMC )NA BioGRID PRPF19 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PRSS1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PSAP Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PSMC3 Affinity Capture-Western physical 12551928 , 15591046 , (Europe PMC )NA BioGRID RAB3A Affinity Capture-Western physical 15207266 , 15854772 , (Europe PMC )NA BioGRID RAB5A Affinity Capture-Western physical 15207266 , (Europe PMC )NA BioGRID RAB8A Affinity Capture-Western, fluorescence microscopy colocalization, physical 15207266 , 24983211 , (Europe PMC )0.27 BioGRID, IntAct RABAC1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, fluorescence microscopy, phage display, pull down colocalization, direct interaction, physical, physical association 21798244 , (Europe PMC )0.63 BioGRID, IntAct RALGDS Affinity Capture-Western physical 20448034 , (Europe PMC )NA BioGRID RNF10 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID RRAS2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RREB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SAP30BP Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID SDF4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SEPT2 Affinity Capture-Western physical 12695511 , (Europe PMC )NA BioGRID SEPT4 Affinity Capture-Western, Protein-peptide physical 12695511 , 17893145 , (Europe PMC )NA BioGRID SERPINB13 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SGSM3 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID SIAH1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 18065497 , 18070888 , 19224863 , 27334109 , (Europe PMC )NA BioGRID SIAH2 Affinity Capture-Western, Biochemical Activity physical 15064394 , 18070888 , 19224863 , 22065755 , (Europe PMC )NA BioGRID SIN3A Phenotypic Suppression genetic 16959795 , (Europe PMC )NA BioGRID SLC6A2 Affinity Capture-Western physical 17156375 , 18331289 , (Europe PMC )NA BioGRID SLC6A3 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay association, physical, physical association 11292651 , 12672538 , 14550771 , 14756560 , 16216085 , 22163275 , (Europe PMC )0.58 BioGRID, IntAct SLC6A4 Affinity Capture-Western, Co-localization physical 16882008 , 19429025 , (Europe PMC )NA BioGRID SMU1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SNCA Affinity Capture-MS, Affinity Capture-Western, Co-purification, FRET, PCA, Reconstituted Complex, atomic force microscopy, bimolecular fluorescence complementation, biophysical, circular dichroism, classical fluorescence spectroscopy, comigration in non denaturing gel electrophoresis, comigration in sds page, confocal microscopy, cosedimentation, cross-linking study, detection by mass spectrometry, dynamic light scattering, electron microscopy, electron tomography, fluorescence polarization spectroscopy, fluorescence technology, molecular sieving, nuclear magnetic resonance, proximity ligation assay, pull down, solid state nmr, transmission electron microscopy, x-ray fiber diffraction association, colocalization, direct interaction, physical, physical association 11502187 , 12928483 , 15502874 , 16330551 , 16764865 , 18055555 , 18179253 , 18221373 , 18505736 , 18550842 , 18614564 , 19651786 , 19745811 , 19875982 , 20849899 , 21358815 , 21443877 , 22119730 , 23927048 , 24374342 , 24895406 , 24983211 , 25484190 , 25555914 , 25617759 , 25643172 , 25732184 , 27018801 , 27341336 , (Europe PMC )0.89, 0.98 BioGRID, IntAct, MINT SNCAIP Affinity Capture-Western, Co-crystal Structure, FRET, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, confocal microscopy, cross-linking study, fluorescence correlation spectroscopy, nuclear magnetic resonance, pull down, two hybrid colocalization, direct interaction, physical, physical association 10319874 , 11331421 , 11742726 , 12044636 , 14645218 , 15894486 , 15944382 , 16365047 , 16595633 , 19762560 , 25861987 , (Europe PMC )0.52, 0.83 BioGRID, IntAct SNCB Affinity Capture-Western physical 11683992 , (Europe PMC )NA BioGRID SNRNP200 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTBN1 Affinity Capture-Western, Co-localization, Reconstituted Complex, pull down association, physical 18614564 , 22771809 , (Europe PMC )0.35 BioGRID, IntAct SQSTM1 Co-localization physical 22411133 , (Europe PMC )NA BioGRID SRC Biochemical Activity physical 11078745 , (Europe PMC )NA BioGRID SRI Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID SRRM1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID SRRT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SRSF4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SSB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STUB1 Affinity Capture-Western, Biochemical Activity physical 18436529 , 21358815 , (Europe PMC )NA BioGRID SYN1 Protein-peptide, anti bait coimmunoprecipitation, proximity ligation assay association, physical, physical association 17893145 , 22163275 , (Europe PMC )0.50 BioGRID, IntAct TAF7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TGM1 Biochemical Activity physical 19651786 , (Europe PMC )NA BioGRID TGS1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TMPRSS12 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TOR1A FRET physical 11438481 , (Europe PMC )NA BioGRID TPPP Affinity Capture-Western, imaging technique colocalization, physical 17027006 , 20849899 , (Europe PMC )0.27 BioGRID, IntAct, MINT TRAF6 Affinity Capture-Western physical 20634198 , (Europe PMC )NA BioGRID TUBA1B Affinity Capture-MS, Affinity Capture-Western, Protein-peptide physical 11698390 , 16216085 , 17893145 , (Europe PMC )NA BioGRID TUBB Affinity Capture-MS physical 11698390 , (Europe PMC )NA BioGRID TUBB1 Affinity Capture-Western physical 16216085 , (Europe PMC )NA BioGRID TUBG1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct UBC Affinity Capture-MS, FRET physical 11603807 , 19651786 , (Europe PMC )NA BioGRID UQCRC2 Affinity Capture-Western physical 18614564 , (Europe PMC )NA BioGRID USP47 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID USP7 Biochemical Activity physical 27444016 , (Europe PMC )NA BioGRID USP8 Affinity Capture-Western, Biochemical Activity, PCA physical 27444016 , (Europe PMC )NA BioGRID USP9X Affinity Capture-Western physical 22065755 , (Europe PMC )NA BioGRID VDAC1 Affinity Capture-Western, pull down association, physical 18614564 , (Europe PMC )0.35 BioGRID, IntAct VDAC2 Affinity Capture-Western, pull down association, physical 18614564 , (Europe PMC )0.35 BioGRID, IntAct VIRMA Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID YWHAQ Affinity Capture-Western physical 15280438 , (Europe PMC )NA BioGRID ZCCHC8 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABL1 anti bait coimmunoprecipitation, confocal microscopy, nuclear magnetic resonance, protein kinase assay colocalization, phosphorylation reaction, physical association 24412932 , (Europe PMC )0.46, 0.56 IntAct AKAP17A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct APLP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT APP Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay physical, physical association 18769546 , 21832049 , 25241761 , 7568089 , 9163350 , (Europe PMC )0.40 BioGRID, IntAct ATG5 anti tag coimmunoprecipitation association 20417604 , (Europe PMC )0.35 IntAct BAX Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct CDK4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CEP295 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct CGRRF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CMBL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct COL7A1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CSNK1D Biochemical Activity, Co-localization, proximity ligation assay physical, physical association 16618118 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct CSNK2A1 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 10617630 , 15033366 , 19576176 , (Europe PMC )0.44 BioGRID, IntAct DHCR24 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DOCK7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DYNC1H1 Affinity Capture-MS, Protein-peptide, anti tag coimmunoprecipitation association, physical 17893145 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct DYNLL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct EEF1A1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EFTUD2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct EGFR Affinity Capture-Luminescence, PCA, Two-hybrid, ubiquitin reconstruction physical, physical association 24658140 , 25402006 , (Europe PMC )0.37 BioGRID, IntAct EIF3G two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT FMR1 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct FXR2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GAPDH Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 15673432 , 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GSK3B Reconstituted Complex, pull down direct interaction, physical, physical association 21985244 , (Europe PMC )0.54 BioGRID, IntAct, MINT HERC5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HSPA1L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HTT bimolecular fluorescence complementation, comigration in non denaturing gel electrophoresis, fluorescence microscopy colocalization, physical association 22119730 , (Europe PMC )0.54 IntAct, MINT ILF3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LAMTOR4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LCMT2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LRRK2 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 19878656 , 23183827 , (Europe PMC )0.56 BioGRID, IntAct MAP1LC3B anti tag coimmunoprecipitation association 20417604 , (Europe PMC )0.35 IntAct MAPT Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, pull down direct interaction, physical, physical association 10464279 , 15904919 , 17408955 , 21127069 , 21985244 , (Europe PMC )0.54 BioGRID, IntAct, MINT MCM5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MT-CO3 anti tag coimmunoprecipitation, two hybrid physical association 12059041 , (Europe PMC )0.51 IntAct MTREX anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct NCBP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NCBP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NOS1AP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct P3H1 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct PARK7 anti tag coimmunoprecipitation physical association 15502874 , (Europe PMC )0.40 IntAct PATJ anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct PDE4DIP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT POLR2L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPIL3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PRDX3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PRPF19 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct RAB8A Affinity Capture-Western, fluorescence microscopy colocalization, physical 15207266 , 24983211 , (Europe PMC )0.27 BioGRID, IntAct RABAC1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, fluorescence microscopy, phage display, pull down colocalization, direct interaction, physical, physical association 21798244 , (Europe PMC )0.63 BioGRID, IntAct RRAS2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RREB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SDF4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SLC6A3 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay association, physical, physical association 11292651 , 12672538 , 14550771 , 14756560 , 16216085 , 22163275 , (Europe PMC )0.58 BioGRID, IntAct SMU1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SNCA Affinity Capture-MS, Affinity Capture-Western, Co-purification, FRET, PCA, Reconstituted Complex, atomic force microscopy, bimolecular fluorescence complementation, biophysical, circular dichroism, classical fluorescence spectroscopy, comigration in non denaturing gel electrophoresis, comigration in sds page, confocal microscopy, cosedimentation, cross-linking study, detection by mass spectrometry, dynamic light scattering, electron microscopy, electron tomography, fluorescence polarization spectroscopy, fluorescence technology, molecular sieving, nuclear magnetic resonance, proximity ligation assay, pull down, solid state nmr, transmission electron microscopy, x-ray fiber diffraction association, colocalization, direct interaction, physical, physical association 11502187 , 12928483 , 15502874 , 16330551 , 16764865 , 18055555 , 18179253 , 18221373 , 18505736 , 18550842 , 18614564 , 19651786 , 19745811 , 19875982 , 20849899 , 21358815 , 21443877 , 22119730 , 23927048 , 24374342 , 24895406 , 24983211 , 25484190 , 25555914 , 25617759 , 25643172 , 25732184 , 27018801 , 27341336 , (Europe PMC )0.89, 0.98 BioGRID, IntAct, MINT SNCAIP Affinity Capture-Western, Co-crystal Structure, FRET, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, confocal microscopy, cross-linking study, fluorescence correlation spectroscopy, nuclear magnetic resonance, pull down, two hybrid colocalization, direct interaction, physical, physical association 10319874 , 11331421 , 11742726 , 12044636 , 14645218 , 15894486 , 15944382 , 16365047 , 16595633 , 19762560 , 25861987 , (Europe PMC )0.52, 0.83 BioGRID, IntAct SNRNP200 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTBN1 Affinity Capture-Western, Co-localization, Reconstituted Complex, pull down association, physical 18614564 , 22771809 , (Europe PMC )0.35 BioGRID, IntAct SRRT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SRSF4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SSB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYN1 Protein-peptide, anti bait coimmunoprecipitation, proximity ligation assay association, physical, physical association 17893145 , 22163275 , (Europe PMC )0.50 BioGRID, IntAct TAF7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TGS1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TPPP Affinity Capture-Western, imaging technique colocalization, physical 17027006 , 20849899 , (Europe PMC )0.27 BioGRID, IntAct, MINT TUBG1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct VDAC1 Affinity Capture-Western, pull down association, physical 18614564 , (Europe PMC )0.35 BioGRID, IntAct VDAC2 Affinity Capture-Western, pull down association, physical 18614564 , (Europe PMC )0.35 BioGRID, IntAct VIM fluorescence microscopy colocalization 16678164 , (Europe PMC )0.27 IntAct, MINT VIRMA anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct WDFY3 anti tag coimmunoprecipitation association 20417604 , (Europe PMC )0.35 IntAct YWHAH atomic force microscopy, circular dichroism, confocal microscopy, electrophoretic mobility-based method, fluorescence polarization spectroscopy, transmission electron microscopy colocalization, direct interaction, physical association 24895406 , (Europe PMC )0.27, 0.64 IntAct ZCCHC8 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source APLP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CDK4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DOCK7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EEF1A1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EIF3G two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT GAPDH Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 15673432 , 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GSK3B Reconstituted Complex, pull down direct interaction, physical, physical association 21985244 , (Europe PMC )0.54 BioGRID, IntAct, MINT HTT bimolecular fluorescence complementation, comigration in non denaturing gel electrophoresis, fluorescence microscopy colocalization, physical association 22119730 , (Europe PMC )0.54 IntAct, MINT MAPT Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, pull down direct interaction, physical, physical association 10464279 , 15904919 , 17408955 , 21127069 , 21985244 , (Europe PMC )0.54 BioGRID, IntAct, MINT PDE4DIP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SDF4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SNCA Affinity Capture-MS, Affinity Capture-Western, Co-purification, FRET, PCA, Reconstituted Complex, atomic force microscopy, bimolecular fluorescence complementation, biophysical, circular dichroism, classical fluorescence spectroscopy, comigration in non denaturing gel electrophoresis, comigration in sds page, confocal microscopy, cosedimentation, cross-linking study, detection by mass spectrometry, dynamic light scattering, electron microscopy, electron tomography, fluorescence polarization spectroscopy, fluorescence technology, molecular sieving, nuclear magnetic resonance, proximity ligation assay, pull down, solid state nmr, transmission electron microscopy, x-ray fiber diffraction association, colocalization, direct interaction, physical, physical association 11502187 , 12928483 , 15502874 , 16330551 , 16764865 , 18055555 , 18179253 , 18221373 , 18505736 , 18550842 , 18614564 , 19651786 , 19745811 , 19875982 , 20849899 , 21358815 , 21443877 , 22119730 , 23927048 , 24374342 , 24895406 , 24983211 , 25484190 , 25555914 , 25617759 , 25643172 , 25732184 , 27018801 , 27341336 , (Europe PMC )0.89, 0.98 BioGRID, IntAct, MINT TPPP Affinity Capture-Western, imaging technique colocalization, physical 17027006 , 20849899 , (Europe PMC )0.27 BioGRID, IntAct, MINT VIM fluorescence microscopy colocalization 16678164 , (Europe PMC )0.27 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABL1 anti bait coimmunoprecipitation, confocal microscopy, nuclear magnetic resonance, protein kinase assay colocalization, phosphorylation reaction, physical association 24412932 , (Europe PMC )0.46, 0.56 IntAct ACTA1 Reconstituted Complex physical 19553474 , (Europe PMC )NA BioGRID ACTB Affinity Capture-Western physical 18331289 , (Europe PMC )NA BioGRID ADAP2 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID AKAP17A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AKT1 Affinity Capture-Western, Far Western physical 21474915 , (Europe PMC )NA BioGRID ANXA6 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID AP1B1 Affinity Capture-Western physical 18614564 , (Europe PMC )NA BioGRID APLP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT APP Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay physical, physical association 18769546 , 21832049 , 25241761 , 7568089 , 9163350 , (Europe PMC )0.40 BioGRID, IntAct ARHGAP15 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID ARPP19 Reconstituted Complex physical 17893145 , (Europe PMC )NA BioGRID ARRB1 Affinity Capture-Western physical 20448034 , (Europe PMC )NA BioGRID ATG5 anti tag coimmunoprecipitation association 20417604 , (Europe PMC )0.35 IntAct BAD Affinity Capture-Western physical 15978696 , (Europe PMC )NA BioGRID BAG5 Affinity Capture-Western, Reconstituted Complex physical 21358815 , (Europe PMC )NA BioGRID BAX Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct BDH2 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID CALM1 Affinity Capture-Western, Reconstituted Complex physical 12358748 , 12610000 , (Europe PMC )NA BioGRID CAV1 Reconstituted Complex physical 21693152 , (Europe PMC )NA BioGRID CBX4 Affinity Capture-Western physical 21256122 , (Europe PMC )NA BioGRID CDC42EP2 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID CDC42EP3 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID CDC42SE1 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID CDK4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CEP295 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID CEP295 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct CGRRF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHMP5 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CLTC Affinity Capture-Western physical 18614564 , (Europe PMC )NA BioGRID CMBL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct COL7A1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct COX1 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID CRYAB Co-crystal Structure, Co-fractionation, Reconstituted Complex physical 15236975 , 20197038 , 21905118 , (Europe PMC )NA BioGRID CSNK1A1 Biochemical Activity physical 10617630 , 16959772 , (Europe PMC )NA BioGRID CSNK1D Biochemical Activity, Co-localization, proximity ligation assay physical, physical association 16618118 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct CSNK2A1 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 10617630 , 15033366 , 19576176 , (Europe PMC )0.44 BioGRID, IntAct CTNND1 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID CTSD Biochemical Activity physical 25617759 , (Europe PMC )NA BioGRID DGUOK Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID DHCR24 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DMTN Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID DNAAF2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DNAJB1 Affinity Capture-Western physical 17012257 , (Europe PMC )NA BioGRID DOCK7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DYNC1H1 Affinity Capture-MS, Protein-peptide, anti tag coimmunoprecipitation association, physical 17893145 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct DYNLL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DYRK1A Affinity Capture-Western, Biochemical Activity physical 16959772 , (Europe PMC )NA BioGRID EEF1A1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EFTUD2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct EGFR Affinity Capture-Luminescence, PCA, Two-hybrid, ubiquitin reconstruction physical, physical association 24658140 , 25402006 , (Europe PMC )0.37 BioGRID, IntAct EIF3G Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID EIF3G two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT ELK1 Affinity Capture-Western physical 11279280 , (Europe PMC )NA BioGRID ENC1 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID ENSA Protein-peptide, Reconstituted Complex physical 17893145 , 18973346 , (Europe PMC )NA BioGRID FBXW7 Affinity Capture-Western physical 26033182 , (Europe PMC )NA BioGRID FKBP4 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID FMR1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID FMR1 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct FSD1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID FXR1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID FXR2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FYN Biochemical Activity physical 11078745 , 11162638 , 15033366 , (Europe PMC )NA BioGRID GABARAPL1 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID GAPDH Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 15673432 , 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GBA Affinity Capture-Western, Reconstituted Complex physical 21653695 , 23266198 , (Europe PMC )NA BioGRID GRK1 Biochemical Activity physical 10852916 , (Europe PMC )NA BioGRID GRK2 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID GRK5 Biochemical Activity physical 10852916 , (Europe PMC )NA BioGRID GRK6 Biochemical Activity physical 10852916 , (Europe PMC )NA BioGRID GSK3B Reconstituted Complex, pull down direct interaction, physical, physical association 21985244 , (Europe PMC )0.54 BioGRID, IntAct, MINT HAX1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HCLS1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HERC5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HERPUD1 Affinity Capture-Western physical 20604806 , (Europe PMC )NA BioGRID HIST2H3C Affinity Capture-Western, Co-localization physical 16959795 , (Europe PMC )NA BioGRID HK1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HPRT1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HSD17B4 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID HSP90AA1 Reconstituted Complex physical 19759002 , (Europe PMC )NA BioGRID HSPA1A FRET, Reconstituted Complex physical 19875982 , (Europe PMC )NA BioGRID HSPA1L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HSPA4 Affinity Capture-Western, Reconstituted Complex physical 14711827 , 17010992 , 17012257 , 21358815 , 21832061 , 21985244 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-Western, Protein-peptide, Reconstituted Complex physical 17893145 , 21832061 , 22776201 , 22843682 , (Europe PMC )NA BioGRID HSPB1 Affinity Capture-MS, Reconstituted Complex physical 19651786 , 21905118 , (Europe PMC )NA BioGRID HSPB2 Reconstituted Complex physical 21905118 , (Europe PMC )NA BioGRID HSPB6 Reconstituted Complex physical 21905118 , (Europe PMC )NA BioGRID HSPB8 Reconstituted Complex physical 21905118 , (Europe PMC )NA BioGRID HTT bimolecular fluorescence complementation, comigration in non denaturing gel electrophoresis, fluorescence microscopy colocalization, physical association 22119730 , (Europe PMC )0.54 IntAct, MINT IARS Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID ILF3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KIAA1191 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID KLC1 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID KLK6 Biochemical Activity physical 12928483 , (Europe PMC )NA BioGRID LAMP2 Affinity Capture-Western physical 15333840 , (Europe PMC )NA BioGRID LAMTOR4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LCMT2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LRRK2 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 19878656 , 23183827 , (Europe PMC )0.56 BioGRID, IntAct MAN2C1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAP1B Reconstituted Complex physical 10764738 , (Europe PMC )NA BioGRID MAP1LC3A Co-localization physical 22411133 , (Europe PMC )NA BioGRID MAP1LC3B anti tag coimmunoprecipitation association 20417604 , (Europe PMC )0.35 IntAct MAPK1 Affinity Capture-Western, Reconstituted Complex physical 11279280 , 12121974 , (Europe PMC )NA BioGRID MAPK3 Affinity Capture-Western physical 12121974 , (Europe PMC )NA BioGRID MAPK8 Affinity Capture-Western physical 12121974 , (Europe PMC )NA BioGRID MAPT Affinity Capture-Western, Co-localization, Co-purification, Reconstituted Complex, pull down direct interaction, physical, physical association 10464279 , 15904919 , 17408955 , 21127069 , 21985244 , (Europe PMC )0.54 BioGRID, IntAct, MINT MCM5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MEF2D Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID MT-CO3 anti tag coimmunoprecipitation, two hybrid physical association 12059041 , (Europe PMC )0.51 IntAct MTREX Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MTREX anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct NCBP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NCBP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NDFIP1 Affinity Capture-Western physical 27173227 , (Europe PMC )NA BioGRID NDUFB6 Affinity Capture-Western physical 18614564 , (Europe PMC )NA BioGRID NEDD4 Affinity Capture-Western, Biochemical Activity physical 21953697 , 24831002 , (Europe PMC )NA BioGRID NEDD4L Biochemical Activity physical 24831002 , (Europe PMC )NA BioGRID NOS1AP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NUFIP1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID P3H1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID P3H1 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct PAK3 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID PARK7 Affinity Capture-Western physical 15502874 , 15935068 , (Europe PMC )NA BioGRID PARK7 anti tag coimmunoprecipitation physical association 15502874 , (Europe PMC )0.40 IntAct PATJ Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PATJ anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct PDE4DIP Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PDIA2 Reconstituted Complex physical 27142583 , (Europe PMC )NA BioGRID PELP1 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID PFDN2 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID PIN1 Affinity Capture-Western, Co-localization physical 16365047 , (Europe PMC )NA BioGRID PINK1 Affinity Capture-Western, Reconstituted Complex physical 19167501 , 27334109 , (Europe PMC )NA BioGRID PLCB2 Reconstituted Complex physical 15641770 , (Europe PMC )NA BioGRID PLD1 Affinity Capture-Western, Reconstituted Complex physical 11821392 , (Europe PMC )NA BioGRID PLK1 Biochemical Activity physical 19889641 , (Europe PMC )NA BioGRID PLK2 Biochemical Activity physical 19889641 , 22988096 , (Europe PMC )NA BioGRID PLK3 Biochemical Activity physical 19889641 , (Europe PMC )NA BioGRID POLR2H Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID POLR2L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPIL3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PRDX1 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID PRDX3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PREP PCA, Reconstituted Complex physical 25555914 , (Europe PMC )NA BioGRID PRKCD Affinity Capture-Western physical 15978696 , (Europe PMC )NA BioGRID PRKN Affinity Capture-MS, Affinity Capture-Western, Phenotypic Suppression genetic, physical 11588587 , 12670421 , 12963044 , 16714300 , 18195004 , 19651786 , 25861987 , (Europe PMC )NA BioGRID PRPF19 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PRPF19 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct PRSS1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PSAP Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PSMC3 Affinity Capture-Western physical 12551928 , 15591046 , (Europe PMC )NA BioGRID RAB3A Affinity Capture-Western physical 15207266 , 15854772 , (Europe PMC )NA BioGRID RAB5A Affinity Capture-Western physical 15207266 , (Europe PMC )NA BioGRID RAB8A Affinity Capture-Western, fluorescence microscopy colocalization, physical 15207266 , 24983211 , (Europe PMC )0.27 BioGRID, IntAct RABAC1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, fluorescence microscopy, phage display, pull down colocalization, direct interaction, physical, physical association 21798244 , (Europe PMC )0.63 BioGRID, IntAct RALGDS Affinity Capture-Western physical 20448034 , (Europe PMC )NA BioGRID RNF10 Reconstituted Complex physical 18541383 , (Europe PMC )NA BioGRID RRAS2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RREB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SAP30BP Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID SDF4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SEPT2 Affinity Capture-Western physical 12695511 , (Europe PMC )NA BioGRID SEPT4 Affinity Capture-Western, Protein-peptide physical 12695511 , 17893145 , (Europe PMC )NA BioGRID SERPINB13 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SGSM3 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID SIAH1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 18065497 , 18070888 , 19224863 , 27334109 , (Europe PMC )NA BioGRID SIAH2 Affinity Capture-Western, Biochemical Activity physical 15064394 , 18070888 , 19224863 , 22065755 , (Europe PMC )NA BioGRID SIN3A Phenotypic Suppression genetic 16959795 , (Europe PMC )NA BioGRID SLC6A2 Affinity Capture-Western physical 17156375 , 18331289 , (Europe PMC )NA BioGRID SLC6A3 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay association, physical, physical association 11292651 , 12672538 , 14550771 , 14756560 , 16216085 , 22163275 , (Europe PMC )0.58 BioGRID, IntAct SLC6A4 Affinity Capture-Western, Co-localization physical 16882008 , 19429025 , (Europe PMC )NA BioGRID SMU1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SNCA Affinity Capture-MS, Affinity Capture-Western, Co-purification, FRET, PCA, Reconstituted Complex, atomic force microscopy, bimolecular fluorescence complementation, biophysical, circular dichroism, classical fluorescence spectroscopy, comigration in non denaturing gel electrophoresis, comigration in sds page, confocal microscopy, cosedimentation, cross-linking study, detection by mass spectrometry, dynamic light scattering, electron microscopy, electron tomography, fluorescence polarization spectroscopy, fluorescence technology, molecular sieving, nuclear magnetic resonance, proximity ligation assay, pull down, solid state nmr, transmission electron microscopy, x-ray fiber diffraction association, colocalization, direct interaction, physical, physical association 11502187 , 12928483 , 15502874 , 16330551 , 16764865 , 18055555 , 18179253 , 18221373 , 18505736 , 18550842 , 18614564 , 19651786 , 19745811 , 19875982 , 20849899 , 21358815 , 21443877 , 22119730 , 23927048 , 24374342 , 24895406 , 24983211 , 25484190 , 25555914 , 25617759 , 25643172 , 25732184 , 27018801 , 27341336 , (Europe PMC )0.89, 0.98 BioGRID, IntAct, MINT SNCAIP Affinity Capture-Western, Co-crystal Structure, FRET, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, confocal microscopy, cross-linking study, fluorescence correlation spectroscopy, nuclear magnetic resonance, pull down, two hybrid colocalization, direct interaction, physical, physical association 10319874 , 11331421 , 11742726 , 12044636 , 14645218 , 15894486 , 15944382 , 16365047 , 16595633 , 19762560 , 25861987 , (Europe PMC )0.52, 0.83 BioGRID, IntAct SNCB Affinity Capture-Western physical 11683992 , (Europe PMC )NA BioGRID SNRNP200 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTBN1 Affinity Capture-Western, Co-localization, Reconstituted Complex, pull down association, physical 18614564 , 22771809 , (Europe PMC )0.35 BioGRID, IntAct SQSTM1 Co-localization physical 22411133 , (Europe PMC )NA BioGRID SRC Biochemical Activity physical 11078745 , (Europe PMC )NA BioGRID SRI Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID SRRM1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID SRRT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SRSF4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SSB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STUB1 Affinity Capture-Western, Biochemical Activity physical 18436529 , 21358815 , (Europe PMC )NA BioGRID SYN1 Protein-peptide, anti bait coimmunoprecipitation, proximity ligation assay association, physical, physical association 17893145 , 22163275 , (Europe PMC )0.50 BioGRID, IntAct TAF7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TGM1 Biochemical Activity physical 19651786 , (Europe PMC )NA BioGRID TGS1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TMPRSS12 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TOR1A FRET physical 11438481 , (Europe PMC )NA BioGRID TPPP Affinity Capture-Western, imaging technique colocalization, physical 17027006 , 20849899 , (Europe PMC )0.27 BioGRID, IntAct, MINT TRAF6 Affinity Capture-Western physical 20634198 , (Europe PMC )NA BioGRID TUBA1B Affinity Capture-MS, Affinity Capture-Western, Protein-peptide physical 11698390 , 16216085 , 17893145 , (Europe PMC )NA BioGRID TUBB Affinity Capture-MS physical 11698390 , (Europe PMC )NA BioGRID TUBB1 Affinity Capture-Western physical 16216085 , (Europe PMC )NA BioGRID TUBG1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct UBC Affinity Capture-MS, FRET physical 11603807 , 19651786 , (Europe PMC )NA BioGRID UQCRC2 Affinity Capture-Western physical 18614564 , (Europe PMC )NA BioGRID USP47 Protein-peptide physical 17893145 , (Europe PMC )NA BioGRID USP7 Biochemical Activity physical 27444016 , (Europe PMC )NA BioGRID USP8 Affinity Capture-Western, Biochemical Activity, PCA physical 27444016 , (Europe PMC )NA BioGRID USP9X Affinity Capture-Western physical 22065755 , (Europe PMC )NA BioGRID VDAC1 Affinity Capture-Western, pull down association, physical 18614564 , (Europe PMC )0.35 BioGRID, IntAct VDAC2 Affinity Capture-Western, pull down association, physical 18614564 , (Europe PMC )0.35 BioGRID, IntAct VIM fluorescence microscopy colocalization 16678164 , (Europe PMC )0.27 IntAct, MINT VIRMA Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID VIRMA anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct WDFY3 anti tag coimmunoprecipitation association 20417604 , (Europe PMC )0.35 IntAct YWHAH atomic force microscopy, circular dichroism, confocal microscopy, electrophoretic mobility-based method, fluorescence polarization spectroscopy, transmission electron microscopy colocalization, direct interaction, physical association 24895406 , (Europe PMC )0.27, 0.64 IntAct YWHAQ Affinity Capture-Western physical 15280438 , (Europe PMC )NA BioGRID ZCCHC8 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
ABL1 Y39_KTKEGVLyVGSKTKE , NA NA PhosphoSitePlus , ADRBK1 S129_NEAYEMPsEEGYQDY , in vitro, in vivo 10617630 , 10852916 ,(Europe PMC )HPRD, CAMK2A S129_NEAYEMPsEEGYQDY , NA NA PhosphoSitePlus , CK1_alpha S129_NEAYEMPsEEGYQDY , LTP 10617630 ,(Europe PMC )PhosphoELM , CK2_alpha S129_NEAYEMPsEEGYQDY , LTP 10617630 ,(Europe PMC )PhosphoELM , CSNK1A1 S129_NEAYEMPsEEGYQDY , S87_KTVEGAGsIAAATGF , NA NA PhosphoSitePlus , CSNK1D S129_NEAYEMPsEEGYQDY , in vitro, in vivo 10617630 , 10852916 ,(Europe PMC )HPRD, CSNK2A1 S129_NEAYEMPsEEGYQDY , in vitro, in vivo 10617630 , 10852916 ,(Europe PMC )HPRD, PhosphoSitePlus , CSNK2A2 S129_NEAYEMPsEEGYQDY , in vitro, in vivo 10617630 , 10852916 ,(Europe PMC )HPRD, DYRK1A S87_KTVEGAGsIAAATGF , LTP 16959772 ,(Europe PMC )PhosphoELM , PhosphoSitePlus , FGR Y125_VDPDNEAyEMPSEEG , in vitro, in vivo 11162638 , 11744621 , 12096713 ,(Europe PMC )HPRD, FYN Y125_VDPDNEAyEMPSEEG , in vitro, in vivo 11162638 , 11744621 , 12096713 ,(Europe PMC )HPRD, PhosphoSitePlus , Fyn Y125_VDPDNEAyEMPSEEG , LTP 11162638 ,(Europe PMC )PhosphoELM , GRK-2 S129_NEAYEMPsEEGYQDY , LTP 10852916 ,(Europe PMC )PhosphoELM , GRK-5 S129_NEAYEMPsEEGYQDY , LTP 10852916 ,(Europe PMC )PhosphoELM , GRK2 S129_NEAYEMPsEEGYQDY , NA NA PhosphoSitePlus , GRK5 S129_NEAYEMPsEEGYQDY , in vitro, in vivo 10617630 , 10852916 ,(Europe PMC )HPRD, PhosphoSitePlus , GRK6 S9_DVFMKGLsKAKEGVV , in vitro 10852916 ,(Europe PMC )HPRD, GSK3B S129_NEAYEMPsEEGYQDY , NA NA PhosphoSitePlus , LYN Y125_VDPDNEAyEMPSEEG , in vitro, in vivo 11162638 , 11744621 , 12096713 ,(Europe PMC )HPRD, PLK1 S129_NEAYEMPsEEGYQDY , NA NA PhosphoSitePlus , PLK2 S129_NEAYEMPsEEGYQDY , NA NA PhosphoSitePlus , PLK3 S129_NEAYEMPsEEGYQDY , NA NA PhosphoSitePlus , PTK2B Y125_VDPDNEAyEMPSEEG , in vitro, in vivo 11162638 , 11744621 , 12096713 ,(Europe PMC )HPRD, PhosphoSitePlus , SRC Y125_VDPDNEAyEMPSEEG , NA NA PhosphoSitePlus , SRC_group Y125_VDPDNEAyEMPSEEG , LTP 12096713 ,(Europe PMC )PhosphoELM , SYK Y108_GKNEEGAyQEGILED , Y125_VDPDNEAyEMPSEEG , Y133_EMPSEEGyQDYEPEA , Y136_SEEGYQDyEPEA , LTP, in vitro, in vivo 11162638 , 11744621 , 12096713 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , Unknown S129_NEAYEMPsEEGYQDY , S87_KTVEGAGsIAAATGF , Y125_VDPDNEAyEMPSEEG , LTP, in vitro 10617630 , 11813001 , 12893833 ,(Europe PMC )HPRD, PhosphoELM ,