- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PTPN1
Gene Name  | PTPN1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 1C84 |
| Synonyms | PTPN1, PTP1B | |
| Protein Name | PTPN1 | |
| Alternative Name(s) | Tyrosine-protein phosphatase non-receptor type 1;3.1.3.48;Protein-tyrosine phosphatase 1B;PTP-1B; | |
| Protein Family | Belongs to the protein-tyrosine phosphatase familyNon-receptor class 1 subfamily | |
| EntrezGene ID | 5770 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P18031 (protein sequence) | |
| Enzyme Class | 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 49967 Dalton | |
| Protein Length | 435 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000196396 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG0789 | eggNOG - COG5599 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Endoplasmic reticulum membraneNote=Interacts with EPHA3 at the cell membrane | |||
| Function (UniProt annotation) | |||
| Tyrosine-protein phosphatase which acts as a regulatorof endoplasmic reticulum unfolded protein response Mediatesdephosphorylation of EIF2AK3/PERK; inactivating the protein kinaseactivity of EIF2AK3/PERK May play an important role in CKII- andp60c-src-induced signal transduction cascades May regulate theEFNA5-EPHA3 signaling pathway which modulates cell reorganizationand cell-cell repulsion May also regulate the hepatocyte growthfactor receptor signaling pathway through dephosphorylation ofMET | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate | |||
| Protein Sequence | |||
| MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRS YILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLEL ENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPH NGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDED HALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0003723 | F:RNA binding |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0005158 | F:insulin receptor binding |
| GO:0005769 | C:early endosome |
| GO:0005783 | C:endoplasmic reticulum |
| GO:0005829 | C:cytosol |
| GO:0006470 | P:protein dephosphorylation |
| GO:0007257 | P:activation of JUN kinase activity |
| GO:0008270 | F:zinc ion binding |
| GO:0008286 | P:insulin receptor signaling pathway |
| GO:0009966 | P:regulation of signal transduction |
| GO:0009968 | P:negative regulation of signal transduction |
| GO:0019899 | F:enzyme binding |
| GO:0019901 | F:protein kinase binding |
| GO:0030100 | P:regulation of endocytosis |
| GO:0030948 | P:negative regulation of vascular endothelial growth factor receptor signaling pathway |
| GO:0030968 | P:endoplasmic reticulum unfolded protein response |
| GO:0030971 | F:receptor tyrosine kinase binding |
| GO:0031532 | P:actin cytoskeleton reorganization |
| GO:0033157 | P:regulation of intracellular protein transport |
| GO:0034620 | P:cellular response to unfolded protein |
| GO:0035335 | P:peptidyl-tyrosine dephosphorylation |
| GO:0035791 | P:platelet-derived growth factor receptor-beta signaling pathway |
| GO:0036498 | P:IRE1-mediated unfolded protein response |
| GO:0043407 | P:negative regulation of MAP kinase activity |
| GO:0045296 | F:cadherin binding |
| GO:0046627 | P:negative regulation of insulin receptor signaling pathway |
| GO:0046875 | F:ephrin receptor binding |
| GO:0051721 | F:protein phosphatase 2A binding |
| GO:0060338 | P:regulation of type I interferon-mediated signaling pathway |
| GO:0060397 | P:JAK-STAT cascade involved in growth hormone signaling pathway |
| GO:0061098 | P:positive regulation of protein tyrosine kinase activity |
| GO:0070373 | P:negative regulation of ERK1 and ERK2 cascade |
| GO:0097443 | C:sorting endosome |
| GO:0098554 | C:cytoplasmic side of endoplasmic reticulum membrane |
| GO:1902202 | P:regulation of hepatocyte growth factor receptor signaling pathway |
| GO:1902236 | P:negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway |
| GO:1903896 | P:positive regulation of IRE1-mediated unfolded protein response |
| GO:1903898 | P:negative regulation of PERK-mediated unfolded protein response |
| GO:1990264 | P:peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity |
| GO:2000646 | P:positive regulation of receptor catabolic process |
PTPN1 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in PTPN1 (P18031) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PTPN1 | P18031 | Tyr-66_QEDNDyINASL,, Tyr-152_EDIKSyYTVRQ,, Tyr-153 _DIKSYyTVRQL, | In vitro and in vivo | 11506178, | Europe PMC |  |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04520 | Adherens junction | Cell-cell adherens junctions (AJs), the most common type of intercellular adhesions, are important for maintaining tissue architecture and cell polarity and can limit cell movement and proliferation. At AJs, E-cadherin serves as an essential cell adhesion molecules (CAMs). The cytoplasmic tail binds beta-catenin, which in turn binds alpha-catenin. Alpha-catenin is associated with F-actin bundles directly and indirectly. The integrity of the cadherin-catenin complex is negatively regulated by phosphorylation of beta-catenin by receptor tyrosine kinases (RTKs) and cytoplasmic tyrosine kinases (Fer, Fyn, Yes, and Src), which leads to dissociation of the cadherin-catenin complex. Integrity of this complex is positively regulated by beta -catenin phosphorylation by casein kinase II, and dephosphorylation by protein tyrosine phosphatases. Changes in the phosphorylation state of beta-catenin affect cell-cell adhesion, cell migration and the level of signaling beta-catenin. Wnt signaling acts as a positive regulator of beta-catenin by inhibiting beta-catenin degradation, which stabilizes beta-catenin, and causes its accumulation. Cadherin may acts as a negative regulator of signaling beta-catenin as it binds beta-catenin at the cell surface and thereby sequesters it from the nucleus. Nectins also function as CAMs at AJs, but are more highly concentrated at AJs than E-cadherin. Nectins transduce signals through Cdc42 and Rac, which reorganize the actin cytoskeleton, regulate the formation of AJs, and strengthen cell-cell adhesion. |
| hsa04910 | Insulin signaling pathway | Insulin binding to its receptor results in the tyrosine phosphorylation of insulin receptor substrates (IRS) by the insulin receptor tyrosine kinase (INSR). This allows association of IRSs with the regulatory subunit of phosphoinositide 3-kinase (PI3K). PI3K activates 3-phosphoinositide-dependent protein kinase 1 (PDK1), which activates Akt, a serine kinase. Akt in turn deactivates glycogen synthase kinase 3 (GSK-3), leading to activation of glycogen synthase (GYS) and thus glycogen synthesis. Activation of Akt also results in the translocation of GLUT4 vesicles from their intracellular pool to the plasma membrane, where they allow uptake of glucose into the cell. Akt also leads to mTOR-mediated activation of protein synthesis by eIF4 and p70S6K. The translocation of GLUT4 protein is also elicited through the CAP/Cbl/TC10 pathway, once Cbl is phosphorylated by INSR.Other signal transduction proteins interact with IRS including GRB2. GRB2 is part of the cascade including SOS, RAS, RAF and MEK that leads to activation of mitogen-activated protein kinase (MAPK) and mitogenic responses in the form of gene transcription. SHC is another substrate of INSR. When tyrosine phosphorylated, SHC associates with GRB2 and can thus activate the RAS/MAPK pathway independently of IRS-1. |
| hsa04931 | Insulin resistance | Insulin resistance is a condition where cells become resistant to the effects of insulin. It is often found in people with health disorders, including obesity, type 2 diabetes mellitus, non-alcoholic fatty liver disease, and cardiovascular diseases. In this diagram multiple mechanisms underlying insulin resistance are shown: (a) increased phosphorylation of IRS (insulin receptor substrate) protein through serine/threonine kinases, such as JNK1 and IKKB, and protein kinase C, (b) increased IRS-1 proteasome degradation via mTOR signaling pathway, (c) decreased activation of signaling molecules including PI3K and AKT, (d) increase in activity of phosphatases including PTPs, PTEN, and PP2A. Regulatory actions such as oxidative stress, mitochondrial dysfunction, accumulation of intracellular lipid derivatives (diacylglycrol and ceramides), and inflammation (via IL-6 and TNFA) contribute to these mechanisms. Consequently, insulin resistance causes reduced GLUT4 translocation, resulting in glucose takeup and glycogen synthesis in skeletal muscle as well as increased hepatic gluconeogenesis and decreased glycogen synthesis in liver. At the bottom of the diagram, interplay between O-GlcNAcylation and serine/threonine phosphorylation is shown. Studies suggested that elevated O-GlcNAc level was correlated to high glucose-induced insulin resistance. Donor UDP-GlcNAc is induced through hexosamine biosynthesis pathway and added to proteins by O-GlcNAc transferase. Elevation of O-GlcNAc modification alters phosphorylation and function of key insulin signaling proteins including IRS-1, PI3K, PDK1, Akt and other transcription factor and cofactors, resulting in the attenuation of insulin signaling cascade. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-354192 | Integrin alphaIIb beta3 signaling. | At the sites of vascular injury bioactive molecules such as thrombin, ADP, collagen, fibrinogen and thrombospondin are generated, secreted or exposed. These stimuli activate platelets, converting the major platelet integrin alphaIIbbeta3 from a resting state to an active conformation, in a process termed integrin priming or 'inside-out signalling'. Integrin activation refers to the change required to enhance ligand-binding activity. The activated alphaIIbbeta3 interacts with the fibrinogen and links platelets together in an aggregate to form a platelet plug. AlphaIIbbeta3 bound to fibrin generates more intracellular signals (outside-in signalling), causing further platelet activation and platelet-plug retraction. In the resting state the alpha and beta tails are close together. This interaction keeps the membrane proximal regions in a bent conformation that maintains alphaIIbbeta3 in a low affinity state. Integrin alphaIIbbeta3 is released from its inactive state by interaction with the protein talin. Talin interacts with the beta3 cytoplasmic domain and disrupts the salt bridge between the alpha and beta chains. This separation in the cytoplasmic regions triggers the conformational change in the extracellular domain that increases its affinity to fibrinogen. Much of talin exists in an inactive cytosolic pool, and the Rap1 interacting adaptor molecule (RIAM) is implicated in talin activation and translocation to beta3 integrin cytoplasmic domain |
| R-HSA-6807004 | Negative regulation of MET activity. | Signaling by MET receptor is negatively regulated mainly by MET receptor dephosphorylation or MET receptor degradation. Protein tyrosine phosphatase PTPRJ dephosphorylates MET tyrosine residue Y1349, thus removing the docking site for the GAB1 adapter (Palka et al. 2003). Protein tyrosine phosphatases PTPN1 and PTPN2 dephosphorylate MET tyrosines Y1234 and Y1235 in the kinase activation loop, thus attenuating catalytic activity of MET (Sangwan et al. 2008). The E3 ubiquitin ligase CBL promotes ubiquitination of the activated MET receptor and subsequent MET degradation. CBL contains a RING finger domain that engages E2 protein ubiquitin ligases to mediate ubiquitination of MET, which may occur at the cell membrane or in the early endocytic compartment. Ubiquitinated MET is degraded in a late endosomal or lysosomal compartment in a proteasome-dependent manner. The involvement of proteasome in MET degradation seems to be indirect, through an effect on MET endocytic trafficking (Jeffers et al. 1997, Peschard et al. 2001, Hammond et al. 2001, Petrelli et al. 2002). LRIG1 promotes lysosome-dependent degradation of MET in the absence of HGF-mediated activation (Lee et al. 2014, Oh et al. 2014).MET-mediated activation of RAS signaling is inhibited by MET receptor binding to MUC20 (Higuchi et al. 2004) or RANBP10 (Wang et al. 2004) |
| R-HSA-877312 | Regulation of IFNG signaling. | At least three different classes of negative regulators exist to control the extent of INFG stimulation and signaling. These include the feedback inhibitors belonging to protein family suppressors of cytokine signaling (SOCS), the Scr-homology 2 (SH2)-containing protein tyrosine phosphatases (SHPs), and the protein inhibitors of activated STATs (PIAS). The induction of these regulators seems to be able to stop further signal transduction by inhibiting various steps in IFNG cascade |
| R-HSA-8849472 | PTK6 Down-Regulation. | The kinase activity of PTK6 is negatively regulated by both PTPN1 phosphatase (Fan et al. 2013), which dephosphorylates tyrosine Y342 of PTK6, and SRMS kinase (Fan et al. 2015), which phosphorylates PTK6 on tyrosine residue Y447 |
| R-HSA-912694 | Regulation of IFNA signaling. | There are several proteins and mechanisms involved in controlling the extent of ligand stimulation of IFNA/B signaling. These mechanisms can effect every step of the IFNA/B cascade. Dephosphorylation of JAK and STAT by SHP protein phosphatases, inhibition of STAT function in the nucleus by protein inhibitors of activated STATs (PIAS) proteins, inhibition of tyrosine kinase activity of JAKs by SOCS as well as inhibition of JAK and IFNAR2 interaction by UBP43 are few of the negative regulation mechanisms in controling type I IFN signaling |
| R-HSA-982772 | Growth hormone receptor signaling. | Growth hormone (Somatotropin or GH) is a key factor in determining lean body mass, stimulating the growth and metabolism of muscle, bone and cartilage cells, while reducing body fat. It has many other roles; it acts to regulate cell growth, differentiation, apoptosis, and reorganisation of the cytoskeleton, affecting diverse processes such as cardiac function, immune function, brain function, and aging. GH also has insulin-like effects such as stimulating amino acid transport, protein synthesis, glucose transport, and lipogenesis. The growth hormone receptor (GHR) is a a member of the cytokine receptor family. When the dimeric receptor binds GH it undergoes a conformational change which leads to phosphorylation of key tyrosine residues in its cytoplasmic domains and activation of associated tyrosine kinase JAK2. This leads to recruitment of signaling molecules such as STAT5 and Src family kinases such as Lyn leading to ERK activation. The signal is attenuated by association of Suppressor of Cytokine Signaling (SOCS) proteins and SHP phosphatases which bind to or dephosphorylate specific phosphorylated tyrosines on GHR/JAK. The availability of GHR on the cell surface is regulated by at least two processes; internalization and cleavage from the suface by metalloproteases |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACTB | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| ADGRG5 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| AGR3 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| AIP | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| AMTN | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| APLNR | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| APLP2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| ARF1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| ARF4 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| ARHGAP39 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARL1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| ASGR2 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| ASS1 | Two-hybrid | physical | 21988832, (Europe PMC) | NA | BioGRID |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATP4A | Affinity Capture-MS | physical | 17255364, (Europe PMC) | NA | BioGRID |
| ATP6V0A1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATP6V0D1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATP6V1B2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BCAR1 | Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, phosphatase assay | association, dephosphorylation reaction, direct interaction, physical, physical association | 10889023, 15866871, 8940134, 9407132, 9418872, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| BCAS3 | Two-hybrid | physical | 25640309, (Europe PMC) | NA | BioGRID |
| BCOR | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| C3AR1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| C5AR2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CASC3 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CASC4 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CASZ1 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CAV1 | Affinity Capture-Western, anti tag coimmunoprecipitation, coimmunoprecipitation, cosedimentation through density gradient, phosphatase assay | colocalization, phosphorylation reaction, physical, physical association | 12176037, 16388599, (Europe PMC) | 0.70 | BioGRID, IntAct, MINT |
| CAVIN1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| CCDC47 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CCL5 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CDH1 | Proximity Label-MS | physical | 25468996, (Europe PMC) | NA | BioGRID |
| CDH13 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CDIPT | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDK4 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CLK2 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 10480872, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| COL5A1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| COP1 | Affinity Capture-Western, Reconstituted Complex | physical | 23439647, (Europe PMC) | NA | BioGRID |
| COX11 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CRK | Reconstituted Complex | physical | 8940134, (Europe PMC) | NA | BioGRID |
| CSNK2A1 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 9600099, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| CTDNEP1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CTNNB1 | Reconstituted Complex | physical | 12377785, (Europe PMC) | NA | BioGRID |
| DCUN1D5 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DHCR24 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DHCR7 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DIRAS3 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DUSP1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-Luminescence, Biochemical Activity, Co-crystal Structure, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, protein kinase assay, ubiquitin reconstruction | colocalization, phosphorylation reaction, physical, physical association | 10889023, 24658140, 25402006, 25796184, 7693694, 8621392, 9050838, 9355745, (Europe PMC) | 0.82 | BioGRID, IntAct, MINT |
| ENPP6 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| EVC2 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM234B | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| FAM84B | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FLAD1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| FLOT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FLOT2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GALNT2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GHITM | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| GHR | Far Western, Reconstituted Complex, array technology, far western blotting, phosphatase assay | dephosphorylation reaction, direct interaction, physical, physical association | 12907755, (Europe PMC) | 0.65 | BioGRID, IntAct |
| GOLIM4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GOSR1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| GPR21 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| GRB2 | Affinity Capture-MS, Reconstituted Complex, coimmunoprecipitation | association, direct interaction, physical | 10660596, 27432908, 8940134, (Europe PMC) | 0.52 | BioGRID, IntAct, MINT |
| GSK3B | Biochemical Activity, phosphatase assay | dephosphorylation reaction, physical | 7514173, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| HEATR3 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| HERC2 | Affinity Capture-MS | physical | 25476789, (Europe PMC) | NA | BioGRID |
| HMOX2 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| HNRNPU | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| IGF1R | Affinity Capture-Western, bioluminescence resonance energy transfer, coimmunoprecipitation | physical, physical association | 15976035, 16926280, 8999839, (Europe PMC) | 0.70 | BioGRID, IntAct, MINT |
| IL1B | Affinity Capture-Western | physical | 23439647, (Europe PMC) | NA | BioGRID |
| ILF3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| ILVBL | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| INSR | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, bioluminescence resonance energy transfer, coimmunoprecipitation, filter binding, fluorescent resonance energy transfer, genetic interference, phosphatase assay, protein kinase assay, pull down, x-ray crystallography | association, colocalization, dephosphorylation reaction, direct interaction, phosphorylation reaction, physical, physical association | 11163213, 11506178, 11579209, 11726652, 12237455, 12634852, 14722096, 15588987, 16271887, 16582879, 16926280, 17092689, 17159996, 17481567, 19029027, 21806020, 8702689, 8999839, (Europe PMC) | 0.44, 0.98 | BioGRID, IntAct, MINT |
| IRS1 | Affinity Capture-Western, Reconstituted Complex, phosphatase assay | dephosphorylation reaction, physical | 10660596, 11579209, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| JAK2 | Affinity Capture-Western, Biochemical Activity, coimmunoprecipitation, phosphatase assay, pull down | dephosphorylation reaction, physical, physical association | 11694501, 11970898, 15821101, 21806020, (Europe PMC) | 0.82 | BioGRID, IntAct, MINT |
| KIDINS220 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KLK7 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| KRAS | Synthetic Lethality | genetic | 19490893, (Europe PMC) | NA | BioGRID |
| LAMTOR3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| LAT | Biochemical Activity, Co-purification, cosedimentation, phosphatase assay, pull down | colocalization, dephosphorylation reaction, physical, physical association | 12857726, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| LTK | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| LTN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LYPD3 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| LYPD6 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| MARCKSL1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| MCAT | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| MRAP2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MRC2 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MREG | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MSN | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| MVP | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NARS | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| NDUFAF4 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| NPPC | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| NTRK1 | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| NTRK2 | Protein-peptide | physical | 12237455, (Europe PMC) | NA | BioGRID |
| NTRK3 | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| PCMT1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| PCNP | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PFN2 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| PGRMC1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| PHB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PHB2 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| PISD | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| PLTP | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| PTRH2 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| RAB5C | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| RHOBTB2 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RMDN3 | Co-localization, fluorescence microscopy, proximity ligation assay | colocalization, physical, physical association | 20627780, 21972092, 25862004, (Europe PMC) | 0.65 | BioGRID, IntAct |
| RNF213 | Affinity Capture-MS | physical | 26496610, 27880917, (Europe PMC) | NA | BioGRID |
| SEC61A1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SLC25A3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SLC27A4 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SLC39A12 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| SLC39A4 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| SLCO6A1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| SMARCD2 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| SNAI1 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SNRPD2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| SRC | Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, coimmunoprecipitation, phosphatase assay, protein kinase assay | association, dephosphorylation reaction, phosphorylation reaction, physical, physical association | 11007774, 12857726, 15866871, 16115959, 16537444, 17092689, 17974954, 9600099, (Europe PMC) | 0.94 | BioGRID, IntAct, MINT |
| STAM2 | Affinity Capture-Western, Reconstituted Complex | physical | 20504764, (Europe PMC) | NA | BioGRID |
| STAT3 | Biochemical Activity | physical | 15821101, (Europe PMC) | NA | BioGRID |
| STAT5A | Protein-peptide, filter binding, phosphatase assay | dephosphorylation reaction, direct interaction, physical | 12237455, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| STAT5B | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| STOM | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| TBC1D15 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| TCTN2 | Affinity Capture-MS, Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TCTN3 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| THRSP | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TMEM17 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TMEM216 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TMEM63A | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| TMPRSS3 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| TOMM70 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| TRIP13 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| TYK2 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 11694501, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| VPS45 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| WRAP53 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZACN | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| ZMPSTE24 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABL1 | phosphatase assay | dephosphorylation reaction | 16537444, (Europe PMC) | 0.44 | IntAct, MINT |
| ACTN1 | phosphatase assay | dephosphorylation reaction | 16291744, (Europe PMC) | 0.44 | IntAct |
| AGR3 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ARHGAP39 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ASS1 | two hybrid array | physical association | 21988832, (Europe PMC) | 0.37 | IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATP6V0A1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATP6V0D1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATP6V1B2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BCAR1 | Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, phosphatase assay | association, dephosphorylation reaction, direct interaction, physical, physical association | 10889023, 15866871, 8940134, 9407132, 9418872, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| BCAS3 | two hybrid array | physical association | 25640309, (Europe PMC) | 0.37 | IntAct, MINT |
| BCOR | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BCR | anti tag coimmunoprecipitation, phosphatase assay, pull down | dephosphorylation reaction, physical association | 9566916, (Europe PMC) | 0.60 | IntAct, MINT |
| CANX | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CAPN1 | enzyme linked immunosorbent assay, protease assay | cleavage reaction, enzymatic reaction, physical association | 19712109, 9407132, (Europe PMC) | 0.68 | IntAct, MINT |
| CAPN2 | protease assay | enzymatic reaction | 9407132, (Europe PMC) | 0.44 | IntAct, MINT |
| CASC3 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CASZ1 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CAV1 | Affinity Capture-Western, anti tag coimmunoprecipitation, coimmunoprecipitation, cosedimentation through density gradient, phosphatase assay | colocalization, phosphorylation reaction, physical, physical association | 12176037, 16388599, (Europe PMC) | 0.70 | BioGRID, IntAct, MINT |
| CAVIN1 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| CCL5 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CDH13 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CLK1 | protein kinase assay | phosphorylation reaction | 10480872, (Europe PMC) | 0.44 | IntAct, MINT |
| CLK2 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 10480872, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| COL5A1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| COX14 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CSNK2A1 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 9600099, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| CTTN | pull down | physical association | 18387954, (Europe PMC) | 0.40 | IntAct, MINT |
| DIRAS3 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| EGFR | Affinity Capture-Luminescence, Biochemical Activity, Co-crystal Structure, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, protein kinase assay, ubiquitin reconstruction | colocalization, phosphorylation reaction, physical, physical association | 10889023, 24658140, 25402006, 25796184, 7693694, 8621392, 9050838, 9355745, (Europe PMC) | 0.82 | BioGRID, IntAct, MINT |
| EPOR | coimmunoprecipitation, phosphatase assay, pull down | dephosphorylation reaction, physical association | 14527337, (Europe PMC) | 0.60 | IntAct, MINT |
| EPS15 | phosphatase assay | dephosphorylation reaction | 25728925, (Europe PMC) | 0.44 | IntAct |
| ESR1 | phosphatase assay | dephosphorylation reaction | 7539106, (Europe PMC) | 0.44 | IntAct, MINT |
| EVC2 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM84B | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FLOT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FLOT2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GALNT2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GHR | Far Western, Reconstituted Complex, array technology, far western blotting, phosphatase assay | dephosphorylation reaction, direct interaction, physical, physical association | 12907755, (Europe PMC) | 0.65 | BioGRID, IntAct |
| GOLIM4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GRB2 | Affinity Capture-MS, Reconstituted Complex, coimmunoprecipitation | association, direct interaction, physical | 10660596, 27432908, 8940134, (Europe PMC) | 0.52 | BioGRID, IntAct, MINT |
| GSK3B | Biochemical Activity, phosphatase assay | dephosphorylation reaction, physical | 7514173, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| HSCB | anti bait coimmunoprecipitation | association | 28380382, (Europe PMC) | 0.35 | IntAct |
| IGF1R | Affinity Capture-Western, bioluminescence resonance energy transfer, coimmunoprecipitation | physical, physical association | 15976035, 16926280, 8999839, (Europe PMC) | 0.70 | BioGRID, IntAct, MINT |
| INSR | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, bioluminescence resonance energy transfer, coimmunoprecipitation, filter binding, fluorescent resonance energy transfer, genetic interference, phosphatase assay, protein kinase assay, pull down, x-ray crystallography | association, colocalization, dephosphorylation reaction, direct interaction, phosphorylation reaction, physical, physical association | 11163213, 11506178, 11579209, 11726652, 12237455, 12634852, 14722096, 15588987, 16271887, 16582879, 16926280, 17092689, 17159996, 17481567, 19029027, 21806020, 8702689, 8999839, (Europe PMC) | 0.44, 0.98 | BioGRID, IntAct, MINT |
| IRS1 | Affinity Capture-Western, Reconstituted Complex, phosphatase assay | dephosphorylation reaction, physical | 10660596, 11579209, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| ITGB1 | phosphatase assay | dephosphorylation reaction | 21806020, (Europe PMC) | 0.44 | IntAct, MINT |
| ITGB3 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical association | 16115959, (Europe PMC) | 0.50 | IntAct, MINT |
| JAK2 | Affinity Capture-Western, Biochemical Activity, coimmunoprecipitation, phosphatase assay, pull down | dephosphorylation reaction, physical, physical association | 11694501, 11970898, 15821101, 21806020, (Europe PMC) | 0.82 | BioGRID, IntAct, MINT |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KIDINS220 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KLK7 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| LAMP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| LAT | Biochemical Activity, Co-purification, cosedimentation, phosphatase assay, pull down | colocalization, dephosphorylation reaction, physical, physical association | 12857726, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| LMNA | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| LTK | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| LTN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MET | anti bait coimmunoprecipitation, cross-linking study, phosphatase assay | dephosphorylation reaction, physical association | 16537444, 18579758, 22789536, (Europe PMC) | 0.71 | IntAct, MINT |
| MGST3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MRC2 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MREG | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MSN | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| MVP | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NFKBIA | phosphatase assay | dephosphorylation reaction | 8940099, (Europe PMC) | 0.44 | IntAct, MINT |
| NTRK1 | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| NTRK3 | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| PCNP | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDGFRB | affinity technology, anti tag coimmunoprecipitation, phosphatase assay | dephosphorylation reaction, physical association | 12614164, 19167335, 9355745, (Europe PMC) | 0.71 | IntAct, MINT |
| PHB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PHB2 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| PIAS1 | anti bait coimmunoprecipitation | physical association | 17159996, (Europe PMC) | 0.40 | IntAct |
| PLGRKT | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PRKCG | bimolecular fluorescence complementation | physical association | 17092689, (Europe PMC) | 0.37 | IntAct, MINT |
| PSTPIP1 | coimmunoprecipitation | physical association | 9857189, (Europe PMC) | 0.40 | IntAct, MINT |
| PTPN1 | phosphatase assay | dephosphorylation reaction | 11506178, (Europe PMC) | 0.44 | IntAct, MINT |
| PTPN2 | pull down | physical association | 28330616, (Europe PMC) | 0.40 | IntAct |
| RAB9A | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| RHOB | fluorescence microscopy | colocalization | 14722096, (Europe PMC) | 0.27 | IntAct, MINT |
| RHOBTB2 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RMDN3 | Co-localization, fluorescence microscopy, proximity ligation assay | colocalization, physical, physical association | 20627780, 21972092, 25862004, (Europe PMC) | 0.65 | BioGRID, IntAct |
| RNF213 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| ROS1 | phosphatase assay | dephosphorylation reaction | 17416557, (Europe PMC) | 0.44 | IntAct, MINT |
| SLC4A1 | coimmunoprecipitation, cosedimentation | colocalization, physical association | 8615784, (Europe PMC) | 0.50 | IntAct, MINT |
| SNAI1 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SRC | Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, coimmunoprecipitation, phosphatase assay, protein kinase assay | association, dephosphorylation reaction, phosphorylation reaction, physical, physical association | 11007774, 12857726, 15866871, 16115959, 16537444, 17092689, 17974954, 9600099, (Europe PMC) | 0.94 | BioGRID, IntAct, MINT |
| STAT3 | phosphatase assay | dephosphorylation reaction | 11970898, 15821101, (Europe PMC) | 0.62 | IntAct, MINT |
| STAT5A | Protein-peptide, filter binding, phosphatase assay | dephosphorylation reaction, direct interaction, physical | 12237455, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| STAT5B | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| TCTN2 | Affinity Capture-MS, Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TCTN3 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TGOLN2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| THRSP | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TMEM17 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TMEM216 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TOMM20 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TOMM22 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TRPV6 | anti tag coimmunoprecipitation, bimolecular fluorescence complementation, phosphatase assay | dephosphorylation reaction, physical association | 15894168, 17197020, (Europe PMC) | 0.74 | IntAct, MINT |
| TXN | anti tag coimmunoprecipitation | physical association | 24976139, (Europe PMC) | 0.40 | IntAct, MINT |
| TYK2 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 11694501, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| VPS45 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| WRAP53 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AGR3 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| BCAR1 | Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, phosphatase assay | association, dephosphorylation reaction, direct interaction, physical, physical association | 10889023, 15866871, 8940134, 9407132, 9418872, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| BCAS3 | two hybrid array | physical association | 25640309, (Europe PMC) | 0.37 | IntAct, MINT |
| BCR | anti tag coimmunoprecipitation, phosphatase assay, pull down | dephosphorylation reaction, physical association | 9566916, (Europe PMC) | 0.60 | IntAct, MINT |
| CAPN1 | enzyme linked immunosorbent assay, protease assay | cleavage reaction, enzymatic reaction, physical association | 19712109, 9407132, (Europe PMC) | 0.68 | IntAct, MINT |
| CAPN2 | protease assay | enzymatic reaction | 9407132, (Europe PMC) | 0.44 | IntAct, MINT |
| CASC3 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CASZ1 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CAV1 | Affinity Capture-Western, anti tag coimmunoprecipitation, coimmunoprecipitation, cosedimentation through density gradient, phosphatase assay | colocalization, phosphorylation reaction, physical, physical association | 12176037, 16388599, (Europe PMC) | 0.70 | BioGRID, IntAct, MINT |
| CCL5 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CDH13 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CLK1 | protein kinase assay | phosphorylation reaction | 10480872, (Europe PMC) | 0.44 | IntAct, MINT |
| CLK2 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 10480872, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| CSNK2A1 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 9600099, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| CTTN | pull down | physical association | 18387954, (Europe PMC) | 0.40 | IntAct, MINT |
| DIRAS3 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| EGFR | Affinity Capture-Luminescence, Biochemical Activity, Co-crystal Structure, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, protein kinase assay, ubiquitin reconstruction | colocalization, phosphorylation reaction, physical, physical association | 10889023, 24658140, 25402006, 25796184, 7693694, 8621392, 9050838, 9355745, (Europe PMC) | 0.82 | BioGRID, IntAct, MINT |
| EPOR | coimmunoprecipitation, phosphatase assay, pull down | dephosphorylation reaction, physical association | 14527337, (Europe PMC) | 0.60 | IntAct, MINT |
| ESR1 | phosphatase assay | dephosphorylation reaction | 7539106, (Europe PMC) | 0.44 | IntAct, MINT |
| FAM84B | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GRB2 | Affinity Capture-MS, Reconstituted Complex, coimmunoprecipitation | association, direct interaction, physical | 10660596, 27432908, 8940134, (Europe PMC) | 0.52 | BioGRID, IntAct, MINT |
| GSK3B | Biochemical Activity, phosphatase assay | dephosphorylation reaction, physical | 7514173, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| IGF1R | Affinity Capture-Western, bioluminescence resonance energy transfer, coimmunoprecipitation | physical, physical association | 15976035, 16926280, 8999839, (Europe PMC) | 0.70 | BioGRID, IntAct, MINT |
| INSR | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, bioluminescence resonance energy transfer, coimmunoprecipitation, filter binding, fluorescent resonance energy transfer, genetic interference, phosphatase assay, protein kinase assay, pull down, x-ray crystallography | association, colocalization, dephosphorylation reaction, direct interaction, phosphorylation reaction, physical, physical association | 11163213, 11506178, 11579209, 11726652, 12237455, 12634852, 14722096, 15588987, 16271887, 16582879, 16926280, 17092689, 17159996, 17481567, 19029027, 21806020, 8702689, 8999839, (Europe PMC) | 0.44, 0.98 | BioGRID, IntAct, MINT |
| IRS1 | Affinity Capture-Western, Reconstituted Complex, phosphatase assay | dephosphorylation reaction, physical | 10660596, 11579209, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| ITGB1 | phosphatase assay | dephosphorylation reaction | 21806020, (Europe PMC) | 0.44 | IntAct, MINT |
| ITGB3 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical association | 16115959, (Europe PMC) | 0.50 | IntAct, MINT |
| JAK2 | Affinity Capture-Western, Biochemical Activity, coimmunoprecipitation, phosphatase assay, pull down | dephosphorylation reaction, physical, physical association | 11694501, 11970898, 15821101, 21806020, (Europe PMC) | 0.82 | BioGRID, IntAct, MINT |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KLK7 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| LAT | Biochemical Activity, Co-purification, cosedimentation, phosphatase assay, pull down | colocalization, dephosphorylation reaction, physical, physical association | 12857726, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| LTK | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| MET | anti bait coimmunoprecipitation, cross-linking study, phosphatase assay | dephosphorylation reaction, physical association | 16537444, 18579758, 22789536, (Europe PMC) | 0.71 | IntAct, MINT |
| MRC2 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NFKBIA | phosphatase assay | dephosphorylation reaction | 8940099, (Europe PMC) | 0.44 | IntAct, MINT |
| NTRK1 | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| NTRK3 | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| PDGFRB | affinity technology, anti tag coimmunoprecipitation, phosphatase assay | dephosphorylation reaction, physical association | 12614164, 19167335, 9355745, (Europe PMC) | 0.71 | IntAct, MINT |
| PRKCG | bimolecular fluorescence complementation | physical association | 17092689, (Europe PMC) | 0.37 | IntAct, MINT |
| PSTPIP1 | coimmunoprecipitation | physical association | 9857189, (Europe PMC) | 0.40 | IntAct, MINT |
| PTPN1 | phosphatase assay | dephosphorylation reaction | 11506178, (Europe PMC) | 0.44 | IntAct, MINT |
| RHOB | fluorescence microscopy | colocalization | 14722096, (Europe PMC) | 0.27 | IntAct, MINT |
| RHOBTB2 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ROS1 | phosphatase assay | dephosphorylation reaction | 17416557, (Europe PMC) | 0.44 | IntAct, MINT |
| SLC4A1 | coimmunoprecipitation, cosedimentation | colocalization, physical association | 8615784, (Europe PMC) | 0.50 | IntAct, MINT |
| SNAI1 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SRC | Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, coimmunoprecipitation, phosphatase assay, protein kinase assay | association, dephosphorylation reaction, phosphorylation reaction, physical, physical association | 11007774, 12857726, 15866871, 16115959, 16537444, 17092689, 17974954, 9600099, (Europe PMC) | 0.94 | BioGRID, IntAct, MINT |
| STAT3 | phosphatase assay | dephosphorylation reaction | 11970898, 15821101, (Europe PMC) | 0.62 | IntAct, MINT |
| STAT5A | Protein-peptide, filter binding, phosphatase assay | dephosphorylation reaction, direct interaction, physical | 12237455, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| STAT5B | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| THRSP | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TRPV6 | anti tag coimmunoprecipitation, bimolecular fluorescence complementation, phosphatase assay | dephosphorylation reaction, physical association | 15894168, 17197020, (Europe PMC) | 0.74 | IntAct, MINT |
| TXN | anti tag coimmunoprecipitation | physical association | 24976139, (Europe PMC) | 0.40 | IntAct, MINT |
| TYK2 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 11694501, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| VPS45 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABL1 | phosphatase assay | dephosphorylation reaction | 16537444, (Europe PMC) | 0.44 | IntAct, MINT |
| ACTB | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| ACTN1 | phosphatase assay | dephosphorylation reaction | 16291744, (Europe PMC) | 0.44 | IntAct |
| ADGRG5 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| AGR3 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| AIP | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| AMTN | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| APLNR | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| APLP2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| ARF1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| ARF4 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| ARHGAP39 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARL1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| ASGR2 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| ASS1 | Two-hybrid | physical | 21988832, (Europe PMC) | NA | BioGRID |
| ASS1 | two hybrid array | physical association | 21988832, (Europe PMC) | 0.37 | IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATP4A | Affinity Capture-MS | physical | 17255364, (Europe PMC) | NA | BioGRID |
| ATP6V0A1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATP6V0D1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATP6V1B2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BCAR1 | Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, phosphatase assay | association, dephosphorylation reaction, direct interaction, physical, physical association | 10889023, 15866871, 8940134, 9407132, 9418872, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| BCAS3 | Two-hybrid | physical | 25640309, (Europe PMC) | NA | BioGRID |
| BCAS3 | two hybrid array | physical association | 25640309, (Europe PMC) | 0.37 | IntAct, MINT |
| BCOR | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BCR | anti tag coimmunoprecipitation, phosphatase assay, pull down | dephosphorylation reaction, physical association | 9566916, (Europe PMC) | 0.60 | IntAct, MINT |
| C3AR1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| C5AR2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CANX | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CAPN1 | enzyme linked immunosorbent assay, protease assay | cleavage reaction, enzymatic reaction, physical association | 19712109, 9407132, (Europe PMC) | 0.68 | IntAct, MINT |
| CAPN2 | protease assay | enzymatic reaction | 9407132, (Europe PMC) | 0.44 | IntAct, MINT |
| CASC3 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CASC4 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CASZ1 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CAV1 | Affinity Capture-Western, anti tag coimmunoprecipitation, coimmunoprecipitation, cosedimentation through density gradient, phosphatase assay | colocalization, phosphorylation reaction, physical, physical association | 12176037, 16388599, (Europe PMC) | 0.70 | BioGRID, IntAct, MINT |
| CAVIN1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| CAVIN1 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| CCDC47 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CCL5 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CDH1 | Proximity Label-MS | physical | 25468996, (Europe PMC) | NA | BioGRID |
| CDH13 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CDIPT | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDK4 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CLK1 | protein kinase assay | phosphorylation reaction | 10480872, (Europe PMC) | 0.44 | IntAct, MINT |
| CLK2 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 10480872, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| COL5A1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| COP1 | Affinity Capture-Western, Reconstituted Complex | physical | 23439647, (Europe PMC) | NA | BioGRID |
| COX11 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| COX14 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CRK | Reconstituted Complex | physical | 8940134, (Europe PMC) | NA | BioGRID |
| CSNK2A1 | Biochemical Activity, protein kinase assay | phosphorylation reaction, physical | 9600099, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| CTDNEP1 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CTNNB1 | Reconstituted Complex | physical | 12377785, (Europe PMC) | NA | BioGRID |
| CTTN | pull down | physical association | 18387954, (Europe PMC) | 0.40 | IntAct, MINT |
| DCUN1D5 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DHCR24 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DHCR7 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DIRAS3 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DUSP1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-Luminescence, Biochemical Activity, Co-crystal Structure, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, protein kinase assay, ubiquitin reconstruction | colocalization, phosphorylation reaction, physical, physical association | 10889023, 24658140, 25402006, 25796184, 7693694, 8621392, 9050838, 9355745, (Europe PMC) | 0.82 | BioGRID, IntAct, MINT |
| ENPP6 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| EPOR | coimmunoprecipitation, phosphatase assay, pull down | dephosphorylation reaction, physical association | 14527337, (Europe PMC) | 0.60 | IntAct, MINT |
| EPS15 | phosphatase assay | dephosphorylation reaction | 25728925, (Europe PMC) | 0.44 | IntAct |
| ESR1 | phosphatase assay | dephosphorylation reaction | 7539106, (Europe PMC) | 0.44 | IntAct, MINT |
| EVC2 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM234B | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| FAM84B | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FLAD1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| FLOT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FLOT2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GALNT2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GHITM | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| GHR | Far Western, Reconstituted Complex, array technology, far western blotting, phosphatase assay | dephosphorylation reaction, direct interaction, physical, physical association | 12907755, (Europe PMC) | 0.65 | BioGRID, IntAct |
| GOLIM4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GOSR1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| GPR21 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| GRB2 | Affinity Capture-MS, Reconstituted Complex, coimmunoprecipitation | association, direct interaction, physical | 10660596, 27432908, 8940134, (Europe PMC) | 0.52 | BioGRID, IntAct, MINT |
| GSK3B | Biochemical Activity, phosphatase assay | dephosphorylation reaction, physical | 7514173, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| HEATR3 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| HERC2 | Affinity Capture-MS | physical | 25476789, (Europe PMC) | NA | BioGRID |
| HMOX2 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| HNRNPU | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HSCB | anti bait coimmunoprecipitation | association | 28380382, (Europe PMC) | 0.35 | IntAct |
| IGF1R | Affinity Capture-Western, bioluminescence resonance energy transfer, coimmunoprecipitation | physical, physical association | 15976035, 16926280, 8999839, (Europe PMC) | 0.70 | BioGRID, IntAct, MINT |
| IL1B | Affinity Capture-Western | physical | 23439647, (Europe PMC) | NA | BioGRID |
| ILF3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| ILVBL | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| INSR | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, bioluminescence resonance energy transfer, coimmunoprecipitation, filter binding, fluorescent resonance energy transfer, genetic interference, phosphatase assay, protein kinase assay, pull down, x-ray crystallography | association, colocalization, dephosphorylation reaction, direct interaction, phosphorylation reaction, physical, physical association | 11163213, 11506178, 11579209, 11726652, 12237455, 12634852, 14722096, 15588987, 16271887, 16582879, 16926280, 17092689, 17159996, 17481567, 19029027, 21806020, 8702689, 8999839, (Europe PMC) | 0.44, 0.98 | BioGRID, IntAct, MINT |
| IRS1 | Affinity Capture-Western, Reconstituted Complex, phosphatase assay | dephosphorylation reaction, physical | 10660596, 11579209, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| ITGB1 | phosphatase assay | dephosphorylation reaction | 21806020, (Europe PMC) | 0.44 | IntAct, MINT |
| ITGB3 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical association | 16115959, (Europe PMC) | 0.50 | IntAct, MINT |
| JAK2 | Affinity Capture-Western, Biochemical Activity, coimmunoprecipitation, phosphatase assay, pull down | dephosphorylation reaction, physical, physical association | 11694501, 11970898, 15821101, 21806020, (Europe PMC) | 0.82 | BioGRID, IntAct, MINT |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KIDINS220 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KLK7 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| KRAS | Synthetic Lethality | genetic | 19490893, (Europe PMC) | NA | BioGRID |
| LAMP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| LAMTOR3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| LAT | Biochemical Activity, Co-purification, cosedimentation, phosphatase assay, pull down | colocalization, dephosphorylation reaction, physical, physical association | 12857726, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| LMNA | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| LTK | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| LTN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LYPD3 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| LYPD6 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| MARCKSL1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| MCAT | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| MET | anti bait coimmunoprecipitation, cross-linking study, phosphatase assay | dephosphorylation reaction, physical association | 16537444, 18579758, 22789536, (Europe PMC) | 0.71 | IntAct, MINT |
| MGST3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MRAP2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MRC2 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MREG | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MSN | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| MSN | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| MVP | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NARS | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| NDUFAF4 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| NFKBIA | phosphatase assay | dephosphorylation reaction | 8940099, (Europe PMC) | 0.44 | IntAct, MINT |
| NPPC | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| NTRK1 | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| NTRK2 | Protein-peptide | physical | 12237455, (Europe PMC) | NA | BioGRID |
| NTRK3 | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| PCMT1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| PCNP | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDGFRB | affinity technology, anti tag coimmunoprecipitation, phosphatase assay | dephosphorylation reaction, physical association | 12614164, 19167335, 9355745, (Europe PMC) | 0.71 | IntAct, MINT |
| PFN2 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| PGRMC1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| PHB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PHB2 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| PHB2 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| PIAS1 | anti bait coimmunoprecipitation | physical association | 17159996, (Europe PMC) | 0.40 | IntAct |
| PISD | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| PLGRKT | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PLTP | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| PRKCG | bimolecular fluorescence complementation | physical association | 17092689, (Europe PMC) | 0.37 | IntAct, MINT |
| PSTPIP1 | coimmunoprecipitation | physical association | 9857189, (Europe PMC) | 0.40 | IntAct, MINT |
| PTPN1 | phosphatase assay | dephosphorylation reaction | 11506178, (Europe PMC) | 0.44 | IntAct, MINT |
| PTPN2 | pull down | physical association | 28330616, (Europe PMC) | 0.40 | IntAct |
| PTRH2 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| RAB5C | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| RAB9A | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| RHOB | fluorescence microscopy | colocalization | 14722096, (Europe PMC) | 0.27 | IntAct, MINT |
| RHOBTB2 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RMDN3 | Co-localization, fluorescence microscopy, proximity ligation assay | colocalization, physical, physical association | 20627780, 21972092, 25862004, (Europe PMC) | 0.65 | BioGRID, IntAct |
| RNF213 | Affinity Capture-MS | physical | 26496610, 27880917, (Europe PMC) | NA | BioGRID |
| RNF213 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| ROS1 | phosphatase assay | dephosphorylation reaction | 17416557, (Europe PMC) | 0.44 | IntAct, MINT |
| SEC61A1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SLC25A3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SLC27A4 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SLC39A12 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| SLC39A4 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| SLC4A1 | coimmunoprecipitation, cosedimentation | colocalization, physical association | 8615784, (Europe PMC) | 0.50 | IntAct, MINT |
| SLCO6A1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| SMARCD2 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| SNAI1 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SNRPD2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| SRC | Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, coimmunoprecipitation, phosphatase assay, protein kinase assay | association, dephosphorylation reaction, phosphorylation reaction, physical, physical association | 11007774, 12857726, 15866871, 16115959, 16537444, 17092689, 17974954, 9600099, (Europe PMC) | 0.94 | BioGRID, IntAct, MINT |
| STAM2 | Affinity Capture-Western, Reconstituted Complex | physical | 20504764, (Europe PMC) | NA | BioGRID |
| STAT3 | Biochemical Activity | physical | 15821101, (Europe PMC) | NA | BioGRID |
| STAT3 | phosphatase assay | dephosphorylation reaction | 11970898, 15821101, (Europe PMC) | 0.62 | IntAct, MINT |
| STAT5A | Protein-peptide, filter binding, phosphatase assay | dephosphorylation reaction, direct interaction, physical | 12237455, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| STAT5B | Protein-peptide, filter binding | direct interaction, physical | 12237455, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| STOM | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| TBC1D15 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| TCTN2 | Affinity Capture-MS, Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TCTN3 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TGOLN2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| THRSP | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TMEM17 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TMEM216 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TMEM63A | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| TMPRSS3 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| TOMM20 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TOMM22 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TOMM70 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| TRIP13 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| TRPV6 | anti tag coimmunoprecipitation, bimolecular fluorescence complementation, phosphatase assay | dephosphorylation reaction, physical association | 15894168, 17197020, (Europe PMC) | 0.74 | IntAct, MINT |
| TXN | anti tag coimmunoprecipitation | physical association | 24976139, (Europe PMC) | 0.40 | IntAct, MINT |
| TYK2 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 11694501, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| VPS45 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| WRAP53 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZACN | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| ZMPSTE24 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |