DEPOD - human DEPhOsphorylation Database

Basic Information
Phosphatases
Pathway
Interacting Proteins
Phosphorylating Kinases

Gene Name	PDCD1 (QuickGO)	Interactive visualization of PDCD1 structures (A quick tutorial to explore the interctive visulaization) Representative structure: 5B8C
Synonyms	PDCD1, PD1,
Protein Name	PDCD1
Alternative Name(s)	Programmed cell death protein 1;Protein PD-1;hPD-1;CD279;
Protein Family	noSimilarity_annotations
EntrezGene ID	5133 (Comparitive Toxicogenomics)
UniProt AC (Human)	Q15116 (protein sequence)
Enzyme Class	N/A
Molecular Weight	31647 Dalton
Protein Length	288 amino acids (AA)
Genome Browsers	NCBI \|
Crosslinking annotations	Query our ID-mapping table
Orthologues	Quest For Orthologues (QFO) \| GeneTree

Domain organization, Expression, Diseases

(show / hide)

Protein Domain	InterPro \| Pfam \| SMART	3D Structure	PDB \| DrugPort \| ModBase \| SwissModel
Polypeptide organization (Pfam)
Gene Expression	Gene Expression Atlas The Human Protein Atlas	Disease	OMIM \| ClinVar
Protein-protein interactions	STRING \| IntAct \| MINT \| BioGRID
Phosphosites	Phospho.ELM \| PhosphoSitePlus

Localization, Function, Catalytic activity and Sequence

(show / hide)

Localization (UniProt annotation)
Membrane; Single-pass type I membraneprotein
Function (UniProt annotation)
Inhibitory cell surface receptor involved in theregulation of T-cell function during immunity and tolerance Uponligand binding, inhibits T-cell effector functions in an antigen-specific manner Possible cell death inducer, in association withother factors
Catalytic Activity (UniProt annotation)
N/A
Protein Sequence
MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLA AFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSP RPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL

Motif information from Eukaryotic Linear Motif atlas (ELM)

(show / hide)

ELM Motif	Motif Instance	Description	Motif Regex
NA	NA	NA	NA

Gene Ontology (P: Process; F: Function and C: Component terms)

(show / hide)

GO:0002644	P:negative regulation of tolerance induction
GO:0005886	C:plasma membrane
GO:0006915	P:apoptotic process
GO:0006959	P:humoral immune response
GO:0007275	P:multicellular organism development
GO:0009897	C:external side of plasma membrane
GO:0016021	C:integral component of membrane
GO:0031295	P:T cell costimulation
GO:0043066	P:negative regulation of apoptotic process
GO:0070234	P:positive regulation of T cell apoptotic process

PDCD1 is dephosphorylated by following phosphatases:

Phosphatase Gene Name	Phosphatase UniProt_AC	DephosphoSite and sequence (+/-5) in PDCD1 (Q15116)	Bioassay Type	PubMed ID	View in Europe PMC	Reliability of the interaction
PTPN11	Q06124	NA_NA,	in vitro and in vivo	28280247,	Europe PMC

KEGG Pathway
Reactome Pathway

Pathway ID	Pathway Name	Pathway Description (KEGG)
hsa04514	Cell adhesion molecules (CAMs)	Cell adhesion molecules are (glyco)proteins expressed on the cell surface and play a critical role in a wide array of biologic processes that include hemostasis, the immune response, inflammation, embryogenesis, and development of neuronal tissue. There are four main groups: the integrin family, the immunoglobulin superfamily, selectins, and cadherins. Membrane proteins that mediate immune cell–cell interactions fall into different categories, namely those involved in antigen recognition, costimulation and cellular adhesion. Furthermore cell-cell adhesions are important for brain morphology and highly coordinated brain functions such as memory and learning. During early development of the nervous system, neurons elongate their axons towards their targets and establish and maintain synapses through formation of cell-cell adhesions. Cell-cell adhesions also underpin axon-axon contacts and link neurons with supporting schwann cells and oligodendrocytes.
hsa04660	T cell receptor signaling pathway	Activation of T lymphocytes is a key event for an efficient response of the immune system. It requires the involvement of the T-cell receptor (TCR) as well as costimulatory molecules such as CD28. Engagement of these receptors through the interaction with a foreign antigen associated with major histocompatibility complex molecules and CD28 counter-receptors B7.1/B7.2, respectively, results in a series of signaling cascades. These cascades comprise an array of protein-tyrosine kinases, phosphatases, GTP-binding proteins and adaptor proteins that regulate generic and specialised functions, leading to T-cell proliferation, cytokine production and differentiation into effector cells.

Pathway ID	Pathway Name	Pathway Description (KEGG)
R-HSA-389948	PD-1 signaling.	The Programmed cell death protein 1 (PD-1) is one of the negative regulators of TCR signaling. PD-1 may exert its effects on cell differentiation and survival directly by inhibiting early activation events that are positively regulated by CD28 or indirectly through IL-2. PD-1 ligation inhibits the induction of the cell survival factor Bcl-xL and the expression of transcription factors associated with effector cell function, including GATA-3, Tbet, and Eomes. PD-1 exerts its inhibitory effects by bringing phosphatases SHP-1 and SHP-2 into the immune synapse, leading to dephosphorylation of CD3-zeta chain, PI3K and AKT

BioGRID
IntAct
MINT
ALL

Sorry, no BioGRID interacting protein information here!
[Feedback|Contribution]

Sorry, no IntAct interacting protein information here!
[Feedback|Contribution]

Sorry, no MINT interacting protein information here!
[Feedback|Contribution]

Sorry, no interacting protein information on this protein!
[Feedback|Contribution]

Sorry, no kinases are known to phosphorylate this protein!
[Feedback|Contribution]

Top

PDCD1