DEPOD - human DEPhOsphorylation Database

Basic Information
Phosphatases
Pathway
Interacting Proteins
Phosphorylating Kinases

Gene Name	LYN (QuickGO)	Interactive visualization of LYN structures (A quick tutorial to explore the interctive visulaization) Representative structure: 1W1F
Synonyms	LYN, JTK8
Protein Name	LYN
Alternative Name(s)	Tyrosine-protein kinase Lyn;2.7.10.2;Lck/Yes-related novel protein tyrosine kinase;V-yes-1 Yamaguchi sarcoma viral related oncogene homolog;p53Lyn;p56Lyn;
Protein Family	Belongs to the protein kinase superfamily Tyr proteinkinase family SRC subfamily
EntrezGene ID	4067 (Comparitive Toxicogenomics)
UniProt AC (Human)	P07948 (protein sequence)
Enzyme Class	2.7.10.2 (BRENDA )
Molecular Weight	58574 Dalton
Protein Length	512 amino acids (AA)
Genome Browsers	NCBI \| ENSG00000254087 (Ensembl) \| UCSC
Crosslinking annotations	Query our ID-mapping table
Orthologues	Quest For Orthologues (QFO) \| GeneTree \| eggNOG - KOG0197 \| eggNOG - COG0515
Phosphorylation Network	Visualize

Domain organization, Expression, Diseases

(show / hide)

Localization, Function, Catalytic activity and Sequence

(show / hide)

Localization (UniProt annotation)
Cell membrane Nucleus CytoplasmCytoplasm, perinuclear region Golgi apparatus Membrane Note=Accumulates in thenucleus by inhibition of CRM1-mediated nuclear export Nuclearaccumulation is increased by inhibition of its kinase activityThe trafficking from the Golgi apparatus to the plasma membraneoccurs in a kinase domain-dependent but kinase activityindependent manner and is mediated by exocytic vesiculartransport Detected on plasma membrane lipid rafts
Function (UniProt annotation)
Non-receptor tyrosine-protein kinase that transmitssignals from cell surface receptors and plays an important role inthe regulation of innate and adaptive immune responses,hematopoiesis, responses to growth factors and cytokines, integrinsignaling, but also responses to DNA damage and genotoxic agentsFunctions primarily as negative regulator, but can also functionas activator, depending on the context Required for theinitiation of the B-cell response, but also for its down-regulation and termination Plays an important role in theregulation of B-cell differentiation, proliferation, survival andapoptosis, and is important for immune self-tolerance Actsdownstream of several immune receptors, including the B-cellreceptor, CD79A, CD79B, CD5, CD19, CD22, FCER1, FCGR2, FCGR1A,TLR2 and TLR4 Plays a role in the inflammatory response tobacterial lipopolysaccharide Mediates the responses to cytokinesand growth factors in hematopoietic progenitors, platelets,erythrocytes, and in mature myeloid cells, such as dendriticcells, neutrophils and eosinophils Acts downstream of EPOR, KIT,MPL, the chemokine receptor CXCR4, as well as the receptors forIL3, IL5 and CSF2 Plays an important role in integrin signalingRegulates cell proliferation, survival, differentiation,migration, adhesion, degranulation, and cytokine release Down-regulates signaling pathways by phosphorylation of immunoreceptortyrosine-based inhibitory motifs (ITIM), that then serve asbinding sites for phosphatases, such as PTPN6/SHP-1, PTPN11/SHP-2and INPP5D/SHIP-1, that modulate signaling by dephosphorylation ofkinases and their substrates Phosphorylates LIME1 in response toCD22 activation Phosphorylates BTK, CBL, CD5, CD19, CD72, CD79A,CD79B, CSF2RB, DOK1, HCLS1, LILRB3/PIR-B, MS4A2/FCER1B, SYK andTEC Promotes phosphorylation of SIRPA, PTPN6/SHP-1, PTPN11/SHP-2and INPP5D/SHIP-1 Mediates phosphorylation of the BCR-ABL fusionprotein Required for rapid phosphorylation of FER in response toFCER1 activation Mediates KIT phosphorylation Acts as aneffector of EPOR (erythropoietin receptor) in controlling KITexpression and may play a role in erythroid differentiation duringthe switch between proliferation and maturation Depending on thecontext, activates or inhibits several signaling cascadesRegulates phosphatidylinositol 3-kinase activity and AKT1activation Regulates activation of the MAP kinase signalingcascade, including activation of MAP2K1/MEK1, MAPK1/ERK2,MAPK3/ERK1, MAPK8/JNK1 and MAPK9/JNK2 Mediates activation ofSTAT5A and/or STAT5B Phosphorylates LPXN on 'Tyr-72' Kinaseactivity facilitates TLR4-TLR6 heterodimerization and signalinitiation
Catalytic Activity (UniProt annotation)
ATP + a [protein]-L-tyrosine = ADP + a[protein]-L-tyrosine phosphate
Protein Sequence
MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPD DLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESET LKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAW EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITE YMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAR EGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP

Motif information from Eukaryotic Linear Motif atlas (ELM)

(show / hide)

Gene Ontology (P: Process; F: Function and C: Component terms)

(show / hide)

GO:0001782	P:B cell homeostasis
GO:0001817	P:regulation of cytokine production
GO:0001932	P:regulation of protein phosphorylation
GO:0001933	P:negative regulation of protein phosphorylation
GO:0001934	P:positive regulation of protein phosphorylation
GO:0002223	P:stimulatory C-type lectin receptor signaling pathway
GO:0002250	P:adaptive immune response
GO:0002431	P:Fc receptor mediated stimulatory signaling pathway
GO:0002513	P:tolerance induction to self antigen
GO:0002553	P:histamine secretion by mast cell
GO:0002576	P:platelet degranulation
GO:0002762	P:negative regulation of myeloid leukocyte differentiation
GO:0002768	P:immune response-regulating cell surface receptor signaling pathway
GO:0002774	P:Fc receptor mediated inhibitory signaling pathway
GO:0002902	P:regulation of B cell apoptotic process
GO:0004713	F:protein tyrosine kinase activity
GO:0004715	F:non-membrane spanning protein tyrosine kinase activity
GO:0005102	F:signaling receptor binding
GO:0005161	F:platelet-derived growth factor receptor binding
GO:0005178	F:integrin binding
GO:0005524	F:ATP binding
GO:0005634	C:nucleus
GO:0005737	C:cytoplasm
GO:0005758	C:mitochondrial intermembrane space
GO:0005794	C:Golgi apparatus
GO:0005829	C:cytosol
GO:0005886	C:plasma membrane
GO:0005913	C:cell-cell adherens junction
GO:0006468	P:protein phosphorylation
GO:0006954	P:inflammatory response
GO:0006974	P:cellular response to DNA damage stimulus
GO:0006991	P:response to sterol depletion
GO:0007165	P:signal transduction
GO:0007169	P:transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007417	P:central nervous system development
GO:0007596	P:blood coagulation
GO:0008284	P:positive regulation of cell proliferation
GO:0008285	P:negative regulation of cell proliferation
GO:0009636	P:response to toxic substance
GO:0009725	P:response to hormone
GO:0009743	P:response to carbohydrate
GO:0010976	P:positive regulation of neuron projection development
GO:0014003	P:oligodendrocyte development
GO:0014069	C:postsynaptic density
GO:0014070	P:response to organic cyclic compound
GO:0016032	P:viral process
GO:0016301	F:kinase activity
GO:0017124	F:SH3 domain binding
GO:0018108	P:peptidyl-tyrosine phosphorylation
GO:0019899	F:enzyme binding
GO:0030061	C:mitochondrial crista
GO:0030168	P:platelet activation
GO:0030218	P:erythrocyte differentiation
GO:0030335	P:positive regulation of cell migration
GO:0030889	P:negative regulation of B cell proliferation
GO:0031175	P:neuron projection development
GO:0031234	C:extrinsic component of cytoplasmic side of plasma membrane
GO:0031295	P:T cell costimulation
GO:0031625	F:ubiquitin protein ligase binding
GO:0031663	P:lipopolysaccharide-mediated signaling pathway
GO:0031668	P:cellular response to extracellular stimulus
GO:0032868	P:response to insulin
GO:0033003	P:regulation of mast cell activation
GO:0033628	P:regulation of cell adhesion mediated by integrin
GO:0034136	P:negative regulation of toll-like receptor 2 signaling pathway
GO:0034144	P:negative regulation of toll-like receptor 4 signaling pathway
GO:0034605	P:cellular response to heat
GO:0034666	C:integrin alpha2-beta1 complex
GO:0038083	P:peptidyl-tyrosine autophosphorylation
GO:0038095	P:Fc-epsilon receptor signaling pathway
GO:0038096	P:Fc-gamma receptor signaling pathway involved in phagocytosis
GO:0042493	P:response to drug
GO:0042531	P:positive regulation of tyrosine phosphorylation of STAT protein
GO:0042629	C:mast cell granule
GO:0043015	F:gamma-tubulin binding
GO:0043200	P:response to amino acid
GO:0043208	F:glycosphingolipid binding
GO:0043231	C:intracellular membrane-bounded organelle
GO:0043304	P:regulation of mast cell degranulation
GO:0043407	P:negative regulation of MAP kinase activity
GO:0043552	P:positive regulation of phosphatidylinositol 3-kinase activity
GO:0044325	F:ion channel binding
GO:0045087	P:innate immune response
GO:0045121	C:membrane raft
GO:0045646	P:regulation of erythrocyte differentiation
GO:0046777	P:protein autophosphorylation
GO:0046875	F:ephrin receptor binding
GO:0048013	P:ephrin receptor signaling pathway
GO:0048471	C:perinuclear region of cytoplasm
GO:0048678	P:response to axon injury
GO:0050663	P:cytokine secretion
GO:0050707	P:regulation of cytokine secretion
GO:0050727	P:regulation of inflammatory response
GO:0050777	P:negative regulation of immune response
GO:0050853	P:B cell receptor signaling pathway
GO:0050855	P:regulation of B cell receptor signaling pathway
GO:0050861	P:positive regulation of B cell receptor signaling pathway
GO:0050900	P:leukocyte migration
GO:0051219	F:phosphoprotein binding
GO:0051272	P:positive regulation of cellular component movement
GO:0051279	P:regulation of release of sequestered calcium ion into cytosol
GO:0060252	P:positive regulation of glial cell proliferation
GO:0060369	P:positive regulation of Fc receptor mediated stimulatory signaling pathway
GO:0060397	P:JAK-STAT cascade involved in growth hormone signaling pathway
GO:0070062	C:extracellular exosome
GO:0070304	P:positive regulation of stress-activated protein kinase signaling cascade
GO:0070372	P:regulation of ERK1 and ERK2 cascade
GO:0070373	P:negative regulation of ERK1 and ERK2 cascade
GO:0070447	P:positive regulation of oligodendrocyte progenitor proliferation
GO:0070667	P:negative regulation of mast cell proliferation
GO:0070668	P:positive regulation of mast cell proliferation
GO:0071300	P:cellular response to retinoic acid
GO:0090025	P:regulation of monocyte chemotaxis
GO:0090330	P:regulation of platelet aggregation
GO:0097028	P:dendritic cell differentiation
GO:0098978	C:glutamatergic synapse
GO:0099091	C:postsynaptic specialization
GO:0140031	intracellular component
GO:1902532	F:phosphorylation-dependent protein binding

Top

LYN