- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
KRT8
Gene Name  | KRT8 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: NA |
| Synonyms | KRT8, CYK8 | |
| Protein Name | KRT8 | |
| Alternative Name(s) | Keratin, type II cytoskeletal 8;Cytokeratin-8;CK-8;Keratin-8;K8;Type-II keratin Kb8; | |
| Protein Family | Belongs to the intermediate filament family | |
| EntrezGene ID | 3856 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P05787 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 53704 Dalton | |
| Protein Length | 483 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000170421 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - ENOG410IG4R | eggNOG - ENOG410YY6B | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Nucleus, nucleoplasm Nucleus matrix | |||
| Function (UniProt annotation) | |||
| Together with KRT19, helps to link the contractileapparatus to dystrophin at the costameres of striated muscle | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEV DPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLK LEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQIS DTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAE IEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEES RLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDV LPK | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| MOD_ProDKin_1 | 71-SLLSPLV-77 | MAPK Phosphorylation Site | ...([ST])P.. |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0005198 | F:structural molecule activity |
| GO:0005634 | C:nucleus |
| GO:0005654 | C:nucleoplasm |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0005882 | C:intermediate filament |
| GO:0005911 | C:cell-cell junction |
| GO:0016010 | C:dystrophin-associated glycoprotein complex |
| GO:0016032 | P:viral process |
| GO:0016327 | C:apicolateral plasma membrane |
| GO:0016363 | C:nuclear matrix |
| GO:0030018 | C:Z disc |
| GO:0031424 | P:keratinization |
| GO:0033209 | P:tumor necrosis factor-mediated signaling pathway |
| GO:0042383 | C:sarcolemma |
| GO:0043034 | C:costamere |
| GO:0044877 | F:protein-containing complex binding |
| GO:0045095 | C:keratin filament |
| GO:0045111 | C:intermediate filament cytoskeleton |
| GO:0045214 | P:sarcomere organization |
| GO:0051599 | P:response to hydrostatic pressure |
| GO:0051707 | P:response to other organism |
| GO:0060706 | P:cell differentiation involved in embryonic placenta development |
| GO:0070062 | C:extracellular exosome |
| GO:0070268 | P:cornification |
| GO:0097110 | F:scaffold protein binding |
| GO:0097191 | P:extrinsic apoptotic signaling pathway |
| GO:0097284 | P:hepatocyte apoptotic process |
KRT8 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in KRT8 (P05787) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PPP2CA | P67775 | Ser-432 _YGGLTsPGLSY, | In vivo | 16554440, | Europe PMC |  |
| PPP2CB | P62714 | Ser-432 _YGGLTsPGLSY, | In vivo | 16554440, | Europe PMC | |
| PTP4A3 | O75365 | Ser-74_NQSLLsPLVLE,, Ser-432 _YGGLTsPGLSY, | In vivo | 19115206, | Europe PMC | |
[Feedback|Contribution]
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-6805567 | Keratinization. | Keratins are the major structural protein of vertebrate epidermis, constituting up to 85% of a fully differentiated keratinocyte (Fuchs 1995). Keratins belong to a superfamily of intermediate filament (IF) proteins that form alpha-helical coiled-coil dimers, which associate laterally and end-to-end to form approximately 10 nm diameter filaments. Keratin filaments are heteropolymeric, formed from equal amounts of acidic type I and basic /neutral type 2 keratins. Humans have 54 keratin genes (Schweitzer et al. 2006). They have highly specific expression patterns, related to the epithelial type and stage of differentiation. Roughly half of human keratins are specific to hair follicles (Langbein & Schweizer 2005). Keratin filaments bundle into tonofilaments that span the cytoplasm and bind to desmosomes and other cell membrane structures (Waschke 2008). This reflects their primary function, maintaining the mechanical stability of individual cells and epithelial tissues (Moll et al. 2008) |
| R-HSA-6809371 | Formation of the cornified envelope. | As keratinocytes progress towards the upper epidermis, they undergo a unique process of cell death termed cornification (Eckhart et al. 2013). This involves the crosslinking of keratinocyte proteins such as loricrin and involucrin by transglutaminases and the breakdown of the nucleus and other organelles by intracellular and secreted proteases (Eckhart et al. 2000, Denecker et al. 2008). This process is strictly regulated by the Ca2+ concentration gradient in the epidermis (Esholtz et al. 2014). Loricrin and involucrin are encoded in ‘Epidermal Differentiation Complex’ linked to a large number of genes encoding nonredundant components of the CE (Kypriotou et al. 2012, Niehues et al. 2016). Keratinocytes produce specialized proteins and lipids which are used to construct the cornified envelope (CE), a heavily crosslinked submembranous layer that confers rigidity to the upper epidermis, allows keratin filaments to attach to any location in the cell membrane (Kirfel et al. 2003) and acts as a water-impermeable barrier. The CE has two functional parts: covalently cross-linked proteins (10 nm thick) that comprise the backbone of the envelope and covalently linked lipids (5 nm thick) that coat the exterior (Eckert et al. 2005). Desmosomal components are crosslinked to the CE to form corneodesmosomes, which bind cornified cells together (Ishida-Yamamoto et al. 2011). Mature terminally differentiated cornified cells consist mostly of keratin filaments covalently attached to the CE embedded in lipid lamellae (Kalinin et al. 2002). The exact composition of the cornified envelope varies between epithelia (Steinert et al. 1998); the relative amino-acid composition of the proteins used may determine differential mechanical properties (Kartasova et al. 1996) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| APEX1 | Affinity Capture-MS | physical | 19188445, (Europe PMC) | NA | BioGRID |
| ASB12 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BYSL | Two-hybrid, three hybrid | association, physical | 9560222, (Europe PMC) | 0.31 | BioGRID, IntAct |
| CAV1 | Co-fractionation | physical | 20808760, (Europe PMC) | NA | BioGRID |
| CDH1 | Affinity Capture-MS | physical | 16212417, (Europe PMC) | NA | BioGRID |
| CLK1 | Biochemical Activity | physical | 26167880, (Europe PMC) | NA | BioGRID |
| CLN5 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CRK | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| EED | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| ESR1 | Reconstituted Complex | physical | 20348541, (Europe PMC) | NA | BioGRID |
| FAF2 | Affinity Capture-MS | physical | 22119785, (Europe PMC) | NA | BioGRID |
| FBXO25 | Biochemical Activity | physical | 23940030, (Europe PMC) | NA | BioGRID |
| FGFR3 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FN1 | Affinity Capture-MS | physical | 19738201, (Europe PMC) | NA | BioGRID |
| GRB2 | Affinity Capture-MS, Two-hybrid, pull down, two hybrid pooling approach | association, physical, physical association | 12577067, 20936779, (Europe PMC) | 0.55 | BioGRID, IntAct |
| HSPA4L | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| HSPA5 | Reconstituted Complex | physical | 9409741, (Europe PMC) | NA | BioGRID |
| IKBKG | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, two hybrid | physical, physical association | 20098747, 21988832, (Europe PMC) | 0.51 | BioGRID, IntAct |
| IQCB1 | Affinity Capture-MS | physical | 21565611, (Europe PMC) | NA | BioGRID |
| ITGA4 | Affinity Capture-MS | physical | 22623428, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KPNA2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KRT13 | Two-hybrid | physical | 25416956, (Europe PMC) | NA | BioGRID |
| KRT15 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| KRT17 | Two-hybrid | physical | 9630597, (Europe PMC) | NA | BioGRID |
| KRT18 | Two-hybrid, biophysical, confocal microscopy, cosedimentation, cosedimentation in solution, fluorescence microscopy, two hybrid, two hybrid array, two hybrid prey pooling approach | colocalization, physical, physical association | 10852826, 10954706, 11684708, 14756564, 21988832, 9630597, (Europe PMC) | 0.90 | BioGRID, IntAct |
| KRT31 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| KRT38 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| KRT40 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| MAPK1 | Biochemical Activity | physical | 11788583, (Europe PMC) | NA | BioGRID |
| MAPK14 | Biochemical Activity, Reconstituted Complex | physical | 11788583, (Europe PMC) | NA | BioGRID |
| MAPK8 | Affinity Capture-Western | physical | 11781324, (Europe PMC) | NA | BioGRID |
| NOS2 | Affinity Capture-MS | physical | 23438482, (Europe PMC) | NA | BioGRID |
| OTUD4 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PAN2 | Affinity Capture-MS | physical | 23398456, (Europe PMC) | NA | BioGRID |
| PKP1 | Reconstituted Complex, far western blotting, surface plasmon resonance | association, physical, physical association | 10852826, (Europe PMC) | 0.50 | BioGRID, IntAct |
| PLAT | Reconstituted Complex | physical | 9988531, (Europe PMC) | NA | BioGRID |
| PNN | Reconstituted Complex, Two-hybrid | physical | 10809736, (Europe PMC) | NA | BioGRID |
| PPEF2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PPL | Reconstituted Complex, Two-hybrid, fluorescence microscopy | colocalization, physical | 12366696, 22841549, (Europe PMC) | 0.27 | BioGRID, IntAct, MINT |
| PPP6C | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PRKCE | Affinity Capture-Western | physical | 1374067, (Europe PMC) | NA | BioGRID |
| QRSL1 | Two-hybrid | physical | 21900206, (Europe PMC) | NA | BioGRID |
| RCHY1 | Affinity Capture-Western, Reconstituted Complex | physical | 19282868, (Europe PMC) | NA | BioGRID |
| STAM2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TADA2A | Affinity Capture-MS | physical | 20508642, (Europe PMC) | NA | BioGRID |
| TES | Affinity Capture-MS | physical | 28378594, (Europe PMC) | NA | BioGRID |
| TFIP11 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| TJP1 | Affinity Capture-MS, pull down | association, physical | 16944923, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TRAF6 | Affinity Capture-Western | physical | 27586056, (Europe PMC) | NA | BioGRID |
| TROAP | Reconstituted Complex, pull down, three hybrid | association, physical | 9560222, (Europe PMC) | 0.45 | BioGRID, IntAct |
| UBASH3B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| USP32 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WBP2 | Reconstituted Complex | physical | 27578003, (Europe PMC) | NA | BioGRID |
| YWHAQ | Affinity Capture-MS | physical | 20618440, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| BYSL | Two-hybrid, three hybrid | association, physical | 9560222, (Europe PMC) | 0.31 | BioGRID, IntAct |
| CFTR | anti bait coimmunoprecipitation, confocal microscopy, proximity ligation assay, surface plasmon resonance | association, colocalization, direct interaction, physical association | 22038833, (Europe PMC) | 0.61 | IntAct |
| CLN5 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| DMD | far western blotting | association | 16000376, (Europe PMC) | 0.35 | IntAct |
| DNAJB6 | cosedimentation | physical association | 10954706, (Europe PMC) | 0.40 | IntAct |
| EBI-1059102 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| EBI-1059111 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| EBI-1059276 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| FGFR3 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GRB2 | Affinity Capture-MS, Two-hybrid, pull down, two hybrid pooling approach | association, physical, physical association | 12577067, 20936779, (Europe PMC) | 0.55 | BioGRID, IntAct |
| HSPA4L | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| IKBKG | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, two hybrid | physical, physical association | 20098747, 21988832, (Europe PMC) | 0.51 | BioGRID, IntAct |
| KPNA2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KRT15 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| KRT18 | Two-hybrid, biophysical, confocal microscopy, cosedimentation, cosedimentation in solution, fluorescence microscopy, two hybrid, two hybrid array, two hybrid prey pooling approach | colocalization, physical, physical association | 10852826, 10954706, 11684708, 14756564, 21988832, 9630597, (Europe PMC) | 0.90 | BioGRID, IntAct |
| KRT31 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| KRT38 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| KRT40 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| LILRB3 | affinity chromatography technology, confocal microscopy | association | 26769854, (Europe PMC) | 0.43 | IntAct |
| OTUD4 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PASK | peptide array | phosphorylation reaction | 21418524, (Europe PMC) | 0.44 | IntAct, MINT |
| PKP1 | Reconstituted Complex, far western blotting, surface plasmon resonance | association, physical, physical association | 10852826, (Europe PMC) | 0.50 | BioGRID, IntAct |
| PKP2 | far western blotting | physical association | 10852826, (Europe PMC) | 0.40 | IntAct |
| PPL | Reconstituted Complex, Two-hybrid, fluorescence microscopy | colocalization, physical | 12366696, 22841549, (Europe PMC) | 0.27 | BioGRID, IntAct, MINT |
| QRSL1 | two hybrid | physical association | 21900206, (Europe PMC) | 0.37 | IntAct, MINT |
| RAF1 | experimental interaction detection | association | 15314064, (Europe PMC) | 0.22 | IntAct, MINT |
| TFIP11 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| TJP1 | Affinity Capture-MS, pull down | association, physical | 16944923, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TROAP | Reconstituted Complex, pull down, three hybrid | association, physical | 9560222, (Europe PMC) | 0.45 | BioGRID, IntAct |
| USP32 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VIM | anti bait coimmunoprecipitation | association | 15846844, (Europe PMC) | 0.35 | IntAct |
| YBX1 | anti tag coimmunoprecipitation | physical association | 23986595, (Europe PMC) | 0.40 | IntAct |
| YWHAZ | tandem affinity purification | association | 20618440, (Europe PMC) | 0.35 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| PPL | Reconstituted Complex, Two-hybrid, fluorescence microscopy | colocalization, physical | 12366696, 22841549, (Europe PMC) | 0.27 | BioGRID, IntAct, MINT |
| QRSL1 | two hybrid | physical association | 21900206, (Europe PMC) | 0.37 | IntAct, MINT |
| RAF1 | experimental interaction detection | association | 15314064, (Europe PMC) | 0.22 | IntAct, MINT |
| YWHAZ | tandem affinity purification | association | 20618440, (Europe PMC) | 0.35 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| APEX1 | Affinity Capture-MS | physical | 19188445, (Europe PMC) | NA | BioGRID |
| ASB12 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BYSL | Two-hybrid, three hybrid | association, physical | 9560222, (Europe PMC) | 0.31 | BioGRID, IntAct |
| CAV1 | Co-fractionation | physical | 20808760, (Europe PMC) | NA | BioGRID |
| CDH1 | Affinity Capture-MS | physical | 16212417, (Europe PMC) | NA | BioGRID |
| CFTR | anti bait coimmunoprecipitation, confocal microscopy, proximity ligation assay, surface plasmon resonance | association, colocalization, direct interaction, physical association | 22038833, (Europe PMC) | 0.61 | IntAct |
| CLK1 | Biochemical Activity | physical | 26167880, (Europe PMC) | NA | BioGRID |
| CLN5 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CRK | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| DMD | far western blotting | association | 16000376, (Europe PMC) | 0.35 | IntAct |
| DNAJB6 | cosedimentation | physical association | 10954706, (Europe PMC) | 0.40 | IntAct |
| EBI-1059102 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| EBI-1059111 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| EBI-1059276 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| EED | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| ESR1 | Reconstituted Complex | physical | 20348541, (Europe PMC) | NA | BioGRID |
| FAF2 | Affinity Capture-MS | physical | 22119785, (Europe PMC) | NA | BioGRID |
| FBXO25 | Biochemical Activity | physical | 23940030, (Europe PMC) | NA | BioGRID |
| FGFR3 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FN1 | Affinity Capture-MS | physical | 19738201, (Europe PMC) | NA | BioGRID |
| GRB2 | Affinity Capture-MS, Two-hybrid, pull down, two hybrid pooling approach | association, physical, physical association | 12577067, 20936779, (Europe PMC) | 0.55 | BioGRID, IntAct |
| HSPA4L | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| HSPA5 | Reconstituted Complex | physical | 9409741, (Europe PMC) | NA | BioGRID |
| IKBKG | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, two hybrid | physical, physical association | 20098747, 21988832, (Europe PMC) | 0.51 | BioGRID, IntAct |
| IQCB1 | Affinity Capture-MS | physical | 21565611, (Europe PMC) | NA | BioGRID |
| ITGA4 | Affinity Capture-MS | physical | 22623428, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KPNA2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KRT13 | Two-hybrid | physical | 25416956, (Europe PMC) | NA | BioGRID |
| KRT15 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| KRT17 | Two-hybrid | physical | 9630597, (Europe PMC) | NA | BioGRID |
| KRT18 | Two-hybrid, biophysical, confocal microscopy, cosedimentation, cosedimentation in solution, fluorescence microscopy, two hybrid, two hybrid array, two hybrid prey pooling approach | colocalization, physical, physical association | 10852826, 10954706, 11684708, 14756564, 21988832, 9630597, (Europe PMC) | 0.90 | BioGRID, IntAct |
| KRT31 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| KRT38 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| KRT40 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| LILRB3 | affinity chromatography technology, confocal microscopy | association | 26769854, (Europe PMC) | 0.43 | IntAct |
| MAPK1 | Biochemical Activity | physical | 11788583, (Europe PMC) | NA | BioGRID |
| MAPK14 | Biochemical Activity, Reconstituted Complex | physical | 11788583, (Europe PMC) | NA | BioGRID |
| MAPK8 | Affinity Capture-Western | physical | 11781324, (Europe PMC) | NA | BioGRID |
| NOS2 | Affinity Capture-MS | physical | 23438482, (Europe PMC) | NA | BioGRID |
| OTUD4 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PAN2 | Affinity Capture-MS | physical | 23398456, (Europe PMC) | NA | BioGRID |
| PASK | peptide array | phosphorylation reaction | 21418524, (Europe PMC) | 0.44 | IntAct, MINT |
| PKP1 | Reconstituted Complex, far western blotting, surface plasmon resonance | association, physical, physical association | 10852826, (Europe PMC) | 0.50 | BioGRID, IntAct |
| PKP2 | far western blotting | physical association | 10852826, (Europe PMC) | 0.40 | IntAct |
| PLAT | Reconstituted Complex | physical | 9988531, (Europe PMC) | NA | BioGRID |
| PNN | Reconstituted Complex, Two-hybrid | physical | 10809736, (Europe PMC) | NA | BioGRID |
| PPEF2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PPL | Reconstituted Complex, Two-hybrid, fluorescence microscopy | colocalization, physical | 12366696, 22841549, (Europe PMC) | 0.27 | BioGRID, IntAct, MINT |
| PPP6C | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PRKCE | Affinity Capture-Western | physical | 1374067, (Europe PMC) | NA | BioGRID |
| QRSL1 | Two-hybrid | physical | 21900206, (Europe PMC) | NA | BioGRID |
| QRSL1 | two hybrid | physical association | 21900206, (Europe PMC) | 0.37 | IntAct, MINT |
| RAF1 | experimental interaction detection | association | 15314064, (Europe PMC) | 0.22 | IntAct, MINT |
| RCHY1 | Affinity Capture-Western, Reconstituted Complex | physical | 19282868, (Europe PMC) | NA | BioGRID |
| STAM2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TADA2A | Affinity Capture-MS | physical | 20508642, (Europe PMC) | NA | BioGRID |
| TES | Affinity Capture-MS | physical | 28378594, (Europe PMC) | NA | BioGRID |
| TFIP11 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| TJP1 | Affinity Capture-MS, pull down | association, physical | 16944923, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TRAF6 | Affinity Capture-Western | physical | 27586056, (Europe PMC) | NA | BioGRID |
| TROAP | Reconstituted Complex, pull down, three hybrid | association, physical | 9560222, (Europe PMC) | 0.45 | BioGRID, IntAct |
| UBASH3B | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| USP32 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VIM | anti bait coimmunoprecipitation | association | 15846844, (Europe PMC) | 0.35 | IntAct |
| WBP2 | Reconstituted Complex | physical | 27578003, (Europe PMC) | NA | BioGRID |
| YBX1 | anti tag coimmunoprecipitation | physical association | 23986595, (Europe PMC) | 0.40 | IntAct |
| YWHAQ | Affinity Capture-MS | physical | 20618440, (Europe PMC) | NA | BioGRID |
| YWHAZ | tandem affinity purification | association | 20618440, (Europe PMC) | 0.35 | IntAct, MINT |