- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
HDAC7
Gene Name  | HDAC7 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 3C0Z |
| Synonyms | HDAC7, HDAC7A | |
| Protein Name | HDAC7 | |
| Alternative Name(s) | Histone deacetylase 7;HD7;3.5.1.98;Histone deacetylase 7A;HD7a; | |
| Protein Family | Belongs to the histone deacetylase family HD type 2subfamily | |
| EntrezGene ID | 51564 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q8WUI4 (protein sequence) | |
| Enzyme Class | 3.5.1.98 (BRENDA ) | |
| Molecular Weight | 102927 Dalton | |
| Protein Length | 952 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000061273 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG1343 | eggNOG - COG0123 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Nucleus Cytoplasm Note=In the nucleus, itassociates with distinct subnuclear dot-like structures Shuttlesbetween the nucleus and the cytoplasm Treatment with EDN1 resultsin shuttling from the nucleus to the perinuclear region Theexport to cytoplasm depends on the interaction with the 14-3-3protein YWHAE and is due to its phosphorylation | |||
| Function (UniProt annotation) | |||
| Responsible for the deacetylation of lysine residues onthe N-terminal part of the core histones (H2A, H2B, H3 and H4)Histone deacetylation gives a tag for epigenetic repression andplays an important role in transcriptional regulation, cell cycleprogression and developmental events Histone deacetylases act viathe formation of large multiprotein complexes Involved in musclematuration by repressing transcription of myocyte enhancer factorssuch as MEF2A, MEF2B and MEF2C During muscle differentiation, itshuttles into the cytoplasm, allowing the expression of myocyteenhancer factors (By similarity) May be involved in Epstein-Barrvirus (EBV) latency, possibly by repressing the viral BZLF1 genePositively regulates the transcriptional repressor activity ofFOXP3 (PubMed:17360565) | |||
| Catalytic Activity (UniProt annotation) | |||
| Hydrolysis of an N(6)-acetyl-lysine residue ofa histone to yield a deacetylated histone | |||
| Protein Sequence | |||
| MDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAV ASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLK LRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSV APFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEAGGTLPSRLQPILLLDPSGSHAP LLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEPLPPSATAPPPPGPMQPRLEQLKTHVQVIKRSAKPSEKPRL RQIPSAEDLETDGGGPGQVVDDGLEHRELGHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGHRP LSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGL RSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARW AAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQ DPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPIAREFSPDLVLVSAGF DAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALEGGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNA IRSLEAVIRVHSKYWGCMQRLASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000118 | C:histone deacetylase complex |
| GO:0000122 | P:negative regulation of transcription by RNA polymerase II |
| GO:0001570 | P:vasculogenesis |
| GO:0003682 | F:chromatin binding |
| GO:0003714 | F:transcription corepressor activity |
| GO:0005080 | F:protein kinase C binding |
| GO:0005634 | C:nucleus |
| GO:0005654 | C:nucleoplasm |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0006351 | P:transcription |
| GO:0007043 | DNA-templated |
| GO:0019789 | P:cell-cell junction assembly |
| GO:0019901 | F:SUMO transferase activity |
| GO:0032041 | F:protein kinase binding |
| GO:0032703 | F:NAD-dependent histone deacetylase activity (H3-K14 specific) |
| GO:0033613 | P:negative regulation of interleukin-2 production |
| GO:0045668 | F:activating transcription factor binding |
| GO:0046872 | P:negative regulation of osteoblast differentiation |
| GO:0070491 | F:metal ion binding |
| GO:0071889 | F:repressing transcription factor binding |
| GO:0090050 | F:14-3-3 protein binding |
| GO:1901223 | P:positive regulation of cell migration involved in sprouting angiogenesis |
HDAC7 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in HDAC7 (Q8WUI4) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PPP2CA | P67775 | Ser-155_LRKTVsEPNLK,, Ser-181_LLRKEsAPPSL,, Ser-321_LSRTRsEPLPP,, Ser-449 in isoform 3_LSRAQsSPAAP, | In vitro and in vivo | 18339811, | Europe PMC |  |
| PPP2CB | P62714 | Ser-155_LRKTVsEPNLK,, Ser-181_LLRKEsAPPSL,, Ser-321_LSRTRsEPLPP,, Ser-449 in isoform 3_LSRAQsSPAAP, | In vitro and in vivo | 18339811, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa05034 | Alcoholism | Alcoholism, also called dependence on alcohol (ethanol), is a chronic relapsing disorder that is progressive and has serious detrimental health outcomes. As one of the primary mediators of the rewarding effects of alcohol, dopaminergic ventral tegmental area (VTA) projections to the nucleus accumbens (NAc) have been identified. Acute exposure to alcohol stimulates dopamine release into the NAc, which activates D1 receptors, stimulating PKA signaling and subsequent CREB-mediated gene expression, whereas chronic alcohol exposure leads to an adaptive downregulation of this pathway, in particular of CREB function. The decreased CREB function in the NAc may promote the intake of drugs of abuse to achieve an increase in reward and thus may be involved in the regulation of positive affective states of addiction. PKA signaling also affects NMDA receptor activity and may play an important role in neuroadaptation in response to chronic alcohol exposure. |
| hsa05165 | Human papillomavirus infection | Human papillomavirus (HPV) is a non-enveloped, double-stranded DNA virus. HPV infect mucoal and cutaneous epithelium resulting in several types of pathologies, most notably, cervical cancer. All types of HPV share a common genomic structure and encode eight proteins: E1, E2, E4, E5, E6, and E7 (early) and L1 and L2 (late). It has been demonstrated that E1 and E2 are involved in viral transcription and replication. The functions of the E4 protein is not yet fully understood. E5, E6, and E7 act as oncoproteins. E5 inhibits the V-ATPase, prolonging EGFR signaling and thereby promoting cell proliferation. The expression of E6 and E7 not only inhibits the tumor suppressors p53 and Rb, but also alters additional signalling pathways. Among these pathways, PI3K/Akt signalling cascade plays a very important role in HPV-induced carcinogenesis. The L1 and L2 proteins form icosahedral capsids for progeny virion generation. |
| hsa05203 | Viral carcinogenesis | There is a strong association between viruses and the development of human malignancies. We now know that at least six human viruses, Epstein-Barr virus (EBV), hepatitis B virus (HBV), hepatitis C virus (HCV), human papilloma virus (HPV), human T-cell lymphotropic virus (HTLV-1) and Kaposi's associated sarcoma virus (KSHV) contribute to 10-15% of the cancers worldwide. Via expression of many potent oncoproteins, these tumor viruses promote an aberrant cell-proliferation via modulating cellular cell-signaling pathways and escape from cellular defense system such as blocking apoptosis. Human tumor virus oncoproteins can also disrupt pathways that are necessary for the maintenance of the integrity of host cellular genome. Viruses that encode such activities can contribute to initiation as well as progression of human cancers. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-2122947 | NOTCH1 Intracellular Domain Regulates Transcription. | NICD1 produced by activation of NOTCH1 in response to Delta and Jagged ligands (DLL/JAG) presented in trans, traffics to the nucleus where it acts as a transcription regulator. In the nucleus, NICD1 displaces the NCOR corepressor complex from RBPJ (CSL). When bound to the co-repressor complex that includes NCOR proteins (NCOR1 and NCOR2) and HDAC histone deacetylases, RBPJ (CSL) represses transcription of NOTCH target genes (Kao et al. 1998, Zhou et al. 2000, Perissi et al. 2004, Perissi et al. 2008). Once the co-repressor complex is displaced, NICD1 recruits MAML (mastermind-like) to RBPJ, while MAML recruits histone acetyltransferases EP300 (p300) and PCAF, resulting in formation of the NOTCH coactivator complex that activates transcription from NOTCH regulatory elements. The minimal functional NOTCH coactivator complex that activates transcription from NOTCH regulatory elements is a heterotrimer composed of NICD, MAML and RBPJ (Fryer et al. 2002, Wallberg et al. 2002, Nam et al. 2006). NOTCH1 coactivator complex is known to activate transcription of HES1 (Jarriault et al. 1995), HES5 (Arnett et al. 2010), HEY genes (Fischer et al. 2004, Leimeister et al. 2000, Maier et al. 2000, Arnett et al. 2010) and MYC (Palomero et al. 2006) and likely regulates transcription of many other genes (Wang et al. 2011). NOTCH1 coactivator complex on any specific regulatory element may involve additional transcriptional regulatory proteins. HES1 binds TLE proteins, forming an evolutionarily conserved transcriptional corepressor involved in regulation of neurogenesis, segmentation and sex determination (Grbavec et al. 1996, Fisher et al. 1996, Paroush et al. 1994). After NOTCH1 coactivator complex is assembled on a NOTCH-responsive promoter, MAML (mastermind-like) recruits CDK8 in complex with cyclin C, triggering phosphorylation of conserved serine residues in TAD and PEST domains of NICD1 by CDK8. Phosphorylated NICD1 is recognized by the E3 ubiquitin ligase FBXW7 which ubiquitinates NICD1, leading to degradation of NICD1 and downregulation of NOTCH1 signaling. FBXW7-mediated ubiquitination and degradation of NOTCH1 depend on C-terminally located PEST domain sequences in NOTCH1 (Fryer et al. 2004, Oberg et al. 2001, Wu et al. 2001). The PEST domain of NOTCH1 and the substrate binding WD40 domain of FBXW7 are frequent targets of mutations in T-cell acute lymphoblastic leukemia - T-ALL (Welcker and Clurman 2008). NICD1, which normally has a short half-life, can be stabilized by binding to the hypoxia-inducable factor 1-alpha (HIF1A) which accumulates in the nucleus when oxygen levels are low. This results in HIF1A-induced inhibition of cellular differentiation that is NOTCH-dependent (Gustafsson et al. 2005) |
| R-HSA-2644606 | Constitutive Signaling by NOTCH1 PEST Domain Mutants. | As NOTCH1 PEST domain is intracellular, NOTCH1 PEST domain mutants are expected to behave as the wild-type NOTCH1 with respect to ligand binding and proteolytic cleavage mediated activation of signaling. However, once the NICD1 fragment of NOTCH1 is released, PEST domain mutations prolong its half-life and transcriptional activity through interference with FBXW7 (FBW7)-mediated ubiquitination and degradation of NICD1 (Weng et al. 2004, Thompson et al. 2007, O'Neil et al. 2007). All NOTCH1 PEST domain mutants annotated here (NOTCH1 Q2395*, NOTCH1 Q2440*, NOTCH1 P2474Afs*4 and NOTCH1 P2514Rfs*4) either have a truncated PEST domain or lack the PEST domain completely |
| R-HSA-2894862 | Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants. | When found in cis, HD and PEST domain mutations act synergistically, increasing NOTCH1 transcriptional activity up to ~40-fold, compared with up to ~10-fold and up to ~2-fold increase with HD mutations alone and PEST domain mutations alone, respectively (Weng et al. 2004). HD domain mutations enable spontaneous, ligand-independent, proteolytic release of the NICD1 fragment, although mutants remain responsive to ligand binding (Malecki et al. 2006), while PEST domain mutations prolong NICD1 half-life and transcriptional activity through interference with FBXW7 (FBW7)-mediated ubiquitination and degradation (Thompson et al. 2007, O'Neil et al. 2007). NOTCH1 HD+PEST domain mutants annotated here are NOTCH1 L1600P;P2514Rfs*4, NOTCH1 L1600P;Q2440*, NOTCH1 L1600P;Q2395* and NOTCH1 L1574P;P2474Afs*4 |
| R-HSA-3108214 | SUMOylation of DNA damage response and repair proteins. | Several factors that participate in DNA damage response and repair are SUMOylated (reviewed in Dou et al. 2011, Bekker-Jensen and Mailand 2011, Ulrich 2012, Psakhye and Jentsch 2012, Bologna and Ferrari 2013, Flotho and Melchior 2013, Jackson and Durocher 2013). SUMOylation can alter enzymatic activity and protein stability or it can serve to recruit additional factors. For example, SUMOylation of Thymine DNA glycosylase (TDG) causes TDG to lose affinity for its product, an abasic site opposite a G residue, and thus increases turnover of the enzyme. During repair of double-strand breaks SUMO1, SUMO2, SUMO3, and the SUMO E3 ligases PIAS1 and PIAS4 accumulate at double-strand breaks where BRCA1, HERC1, RNF168, MDC1, and TP53BP1 are SUMOylated. SUMOylation of BRCA1 may increase its ubiquitin ligase activity while SUMOylation of MDC1 and HERC2 appears to play a role in recruitment of proteins such as RNF4 and RNF8 to double strand breaks. Similarly SUMOylation of RPA1 (RPA70) recruits RAD51 in the homologous recombination pathway |
| R-HSA-8943724 | Regulation of PTEN gene transcription. | Transcription of the PTEN gene is regulated at multiple levels. Epigenetic repression involves the recruitment of Mi-2/NuRD upon SALL4 binding to the PTEN promoter (Yang et al. 2008, Lu et al. 2009) or EVI1-mediated recruitment of the polycomb repressor complex (PRC) to the PTEN promoter (Song et al. 2009, Yoshimi et al. 2011). Transcriptional regulation is also elicited by negative regulators, including NR2E1:ATN1 (atrophin-1) complex, JUN (c-Jun), SNAIL and SLUG (Zhang et al. 2006, Vasudevan et al. 2007, Escriva et al. 2008, Uygur et al. 2015) and positive regulators such as TP53 (p53), MAF1, ATF2, EGR1 or PPARG (Stambolic et al. 2001, Virolle et al. 2001, Patel et al. 2001, Shen et al. 2006, Li et al. 2016) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ADNP | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| AKAP12 | Synthetic Rescue | genetic | 22584896, (Europe PMC) | NA | BioGRID |
| AR | Affinity Capture-Western | physical | 16860317, (Europe PMC) | NA | BioGRID |
| BCL6 | Affinity Capture-Western, Reconstituted Complex | physical | 11929873, (Europe PMC) | NA | BioGRID |
| BCORL1 | Affinity Capture-Western | physical | 17379597, (Europe PMC) | NA | BioGRID |
| CALCOCO2 | Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 21516116, 25416956, (Europe PMC) | 0.37, 0.49, 0.56 | BioGRID, IntAct, MINT |
| CASP8 | Biochemical Activity | physical | 18458084, (Europe PMC) | NA | BioGRID |
| CBWD6 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CBY1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CGN | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CTNNB1 | Affinity Capture-MS, Affinity Capture-Western, Co-localization | physical | 20224040, 21836063, (Europe PMC) | NA | BioGRID |
| DCAF10 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DCLK1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DENND1A | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| EDNRA | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 11262386, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, ubiquitin reconstruction | physical, physical association | 24658140, 25402006, (Europe PMC) | 0.51 | BioGRID, IntAct |
| EIF4E2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| EP300 | Affinity Capture-Western | physical | 15280364, (Europe PMC) | NA | BioGRID |
| ESR1 | Affinity Capture-Western | physical | 19917725, (Europe PMC) | NA | BioGRID |
| FLYWCH2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| FOXA1 | Affinity Capture-Western | physical | 19917725, (Europe PMC) | NA | BioGRID |
| FOXP3 | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | physical, physical association | 17360565, (Europe PMC) | 0.40 | BioGRID, IntAct |
| GIGYF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| GNMT | Two-hybrid, two hybrid | physical, physical association | 21516116, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| HDAC1 | Reconstituted Complex | physical | 11279209, (Europe PMC) | NA | BioGRID |
| HDAC2 | Reconstituted Complex | physical | 11279209, (Europe PMC) | NA | BioGRID |
| HDAC3 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical | 11466315, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HDAC4 | Reconstituted Complex | physical | 11279209, (Europe PMC) | NA | BioGRID |
| HDAC5 | Reconstituted Complex | physical | 11279209, (Europe PMC) | NA | BioGRID |
| HDAC7 | Affinity Capture-MS, Reconstituted Complex | physical | 11279209, 23752268, (Europe PMC) | NA | BioGRID |
| HIF1A | Affinity Capture-Western, Two-hybrid | physical | 15280364, 21148070, (Europe PMC) | NA | BioGRID |
| HINT1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| IKZF1 | Affinity Capture-Western | physical | 12015313, (Europe PMC) | NA | BioGRID |
| IKZF3 | Affinity Capture-Western | physical | 12015313, (Europe PMC) | NA | BioGRID |
| IKZF4 | Affinity Capture-Western | physical | 12015313, (Europe PMC) | NA | BioGRID |
| INPP5E | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KAT5 | Affinity Capture-Western, Two-hybrid | physical | 12551922, (Europe PMC) | NA | BioGRID |
| KCTD3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KDM5B | Affinity Capture-Western | physical | 17373667, (Europe PMC) | NA | BioGRID |
| KIF13B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KLF4 | Affinity Capture-Western | physical | 17827213, (Europe PMC) | NA | BioGRID |
| KSR1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LIMA1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LRFN1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAGI1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MARK2 | Affinity Capture-Western, Biochemical Activity | physical | 16980613, (Europe PMC) | NA | BioGRID |
| MARK3 | Affinity Capture-Western, Biochemical Activity | physical | 16980613, (Europe PMC) | NA | BioGRID |
| MAST3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MEF2A | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 16956611, 16980305, 20590529, 22308472, (Europe PMC) | NA | BioGRID |
| MEF2C | Affinity Capture-Western, Reconstituted Complex | physical | 11279209, 18463162, (Europe PMC) | NA | BioGRID |
| MOCOS | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| MOV10 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| NCOR1 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical | 11466315, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NCOR2 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 11466315, 16956611, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NR2E1 | Affinity Capture-Western | physical | 17873065, (Europe PMC) | NA | BioGRID |
| NXF1 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| PML | Affinity Capture-Western | physical | 18463162, 22155184, (Europe PMC) | NA | BioGRID |
| PPM1H | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PPP1CB | Affinity Capture-MS, Affinity Capture-Western | physical | 17369396, (Europe PMC) | NA | BioGRID |
| PPP1R12A | Affinity Capture-MS, Affinity Capture-Western | physical | 17369396, (Europe PMC) | NA | BioGRID |
| PPP2CA | Affinity Capture-Western, Biochemical Activity | physical | 18339811, (Europe PMC) | NA | BioGRID |
| PRKD1 | Affinity Capture-Western | physical | 19029091, (Europe PMC) | NA | BioGRID |
| PRKD2 | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, protein kinase assay, pull down | phosphorylation reaction, physical, physical association | 17962809, (Europe PMC) | 0.64 | BioGRID, IntAct, MINT |
| RAP1GDS1 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| REL | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.49, 0.56 | BioGRID, IntAct |
| RHOA | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| RIPPLY1 | Two-hybrid | physical | 25416956, (Europe PMC) | NA | BioGRID |
| RTKN | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| RUNX2 | Affinity Capture-Western, Co-localization, Reconstituted Complex | physical | 17997710, (Europe PMC) | NA | BioGRID |
| SFN | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 15778465, 18339811, 23752268, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| SH3PXD2A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SHMT2 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| SIPA1L1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRGAP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TBL1X | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TBL1XR1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TESK2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TTF2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| UBE2I | Affinity Capture-Western, Reconstituted Complex | physical | 18625722, (Europe PMC) | NA | BioGRID |
| UGP2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| WDR73 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| YWHAB | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 17369396, 23752268, 24255178, (Europe PMC) | 0.53 | BioGRID, IntAct |
| YWHAE | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 17369396, 17979178, 20224040, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAG | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation | association, physical, physical association | 15324660, 17353931, 23752268, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| YWHAH | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 17979178, 20224040, 23752268, 26496610, (Europe PMC) | 0.35, 0.53 | BioGRID, IntAct |
| YWHAQ | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation | association, physical | 15161933, 16956611, 16980613, 17369396, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down | association, physical, physical association | 15161933, 20224040, 23752268, (Europe PMC) | 0.67 | BioGRID, IntAct, MINT |
| ZBTB16 | Reconstituted Complex | physical | 11929873, (Europe PMC) | NA | BioGRID |
| ZBTB21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ZFP36 | Affinity Capture-Western | physical | 19738286, (Europe PMC) | NA | BioGRID |
| ZMYM6 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| ZNF638 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ZYG11B | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| CBY1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CGN | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DCLK1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| EGFR | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, ubiquitin reconstruction | physical, physical association | 24658140, 25402006, (Europe PMC) | 0.51 | BioGRID, IntAct |
| EIF4E2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| FOXP3 | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | physical, physical association | 17360565, (Europe PMC) | 0.40 | BioGRID, IntAct |
| GIGYF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| GNMT | Two-hybrid, two hybrid | physical, physical association | 21516116, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| HDAC3 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical | 11466315, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| INPP5E | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KCTD3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KIF13B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KSR1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LIMA1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LRFN1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAGI1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAST3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MEF2C | anti tag coimmunoprecipitation | association | 23752268, (Europe PMC) | 0.35 | IntAct |
| NCOR1 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical | 11466315, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NCOR2 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 11466315, 16956611, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPM1H | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PRKD2 | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, protein kinase assay, pull down | phosphorylation reaction, physical, physical association | 17962809, (Europe PMC) | 0.64 | BioGRID, IntAct, MINT |
| REL | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.49, 0.56 | BioGRID, IntAct |
| RIPPLY1 | two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical association | 25416956, (Europe PMC) | 0.49, 0.56 | IntAct |
| SDCBP | phage display | direct interaction | 26787460, (Europe PMC) | 0.44 | IntAct, MINT |
| SFN | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 15778465, 18339811, 23752268, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| SH3PXD2A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SIPA1L1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRGAP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TBL1X | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TBL1XR1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TESK2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| YWHAB | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 17369396, 23752268, 24255178, (Europe PMC) | 0.53 | BioGRID, IntAct |
| YWHAE | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 17369396, 17979178, 20224040, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAG | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation | association, physical, physical association | 15324660, 17353931, 23752268, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| YWHAH | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 17979178, 20224040, 23752268, 26496610, (Europe PMC) | 0.35, 0.53 | BioGRID, IntAct |
| YWHAQ | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation | association, physical | 15161933, 16956611, 16980613, 17369396, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down | association, physical, physical association | 15161933, 20224040, 23752268, (Europe PMC) | 0.67 | BioGRID, IntAct, MINT |
| ZBTB21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ZNF638 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| GNMT | Two-hybrid, two hybrid | physical, physical association | 21516116, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PRKD2 | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, protein kinase assay, pull down | phosphorylation reaction, physical, physical association | 17962809, (Europe PMC) | 0.64 | BioGRID, IntAct, MINT |
| SDCBP | phage display | direct interaction | 26787460, (Europe PMC) | 0.44 | IntAct, MINT |
| SFN | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 15778465, 18339811, 23752268, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| YWHAG | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation | association, physical, physical association | 15324660, 17353931, 23752268, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| YWHAZ | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down | association, physical, physical association | 15161933, 20224040, 23752268, (Europe PMC) | 0.67 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ADNP | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| AKAP12 | Synthetic Rescue | genetic | 22584896, (Europe PMC) | NA | BioGRID |
| AR | Affinity Capture-Western | physical | 16860317, (Europe PMC) | NA | BioGRID |
| BCL6 | Affinity Capture-Western, Reconstituted Complex | physical | 11929873, (Europe PMC) | NA | BioGRID |
| BCORL1 | Affinity Capture-Western | physical | 17379597, (Europe PMC) | NA | BioGRID |
| CALCOCO2 | Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 21516116, 25416956, (Europe PMC) | 0.37, 0.49, 0.56 | BioGRID, IntAct, MINT |
| CASP8 | Biochemical Activity | physical | 18458084, (Europe PMC) | NA | BioGRID |
| CBWD6 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CBY1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CGN | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| CTNNB1 | Affinity Capture-MS, Affinity Capture-Western, Co-localization | physical | 20224040, 21836063, (Europe PMC) | NA | BioGRID |
| DCAF10 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DCLK1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| DENND1A | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| EDNRA | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 11262386, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, ubiquitin reconstruction | physical, physical association | 24658140, 25402006, (Europe PMC) | 0.51 | BioGRID, IntAct |
| EIF4E2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| EP300 | Affinity Capture-Western | physical | 15280364, (Europe PMC) | NA | BioGRID |
| ESR1 | Affinity Capture-Western | physical | 19917725, (Europe PMC) | NA | BioGRID |
| FLYWCH2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| FOXA1 | Affinity Capture-Western | physical | 19917725, (Europe PMC) | NA | BioGRID |
| FOXP3 | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | physical, physical association | 17360565, (Europe PMC) | 0.40 | BioGRID, IntAct |
| GIGYF1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| GNMT | Two-hybrid, two hybrid | physical, physical association | 21516116, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| HDAC1 | Reconstituted Complex | physical | 11279209, (Europe PMC) | NA | BioGRID |
| HDAC2 | Reconstituted Complex | physical | 11279209, (Europe PMC) | NA | BioGRID |
| HDAC3 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical | 11466315, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HDAC4 | Reconstituted Complex | physical | 11279209, (Europe PMC) | NA | BioGRID |
| HDAC5 | Reconstituted Complex | physical | 11279209, (Europe PMC) | NA | BioGRID |
| HDAC7 | Affinity Capture-MS, Reconstituted Complex | physical | 11279209, 23752268, (Europe PMC) | NA | BioGRID |
| HIF1A | Affinity Capture-Western, Two-hybrid | physical | 15280364, 21148070, (Europe PMC) | NA | BioGRID |
| HINT1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| IKZF1 | Affinity Capture-Western | physical | 12015313, (Europe PMC) | NA | BioGRID |
| IKZF3 | Affinity Capture-Western | physical | 12015313, (Europe PMC) | NA | BioGRID |
| IKZF4 | Affinity Capture-Western | physical | 12015313, (Europe PMC) | NA | BioGRID |
| INPP5E | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KAT5 | Affinity Capture-Western, Two-hybrid | physical | 12551922, (Europe PMC) | NA | BioGRID |
| KCTD3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KDM5B | Affinity Capture-Western | physical | 17373667, (Europe PMC) | NA | BioGRID |
| KIF13B | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| KLF4 | Affinity Capture-Western | physical | 17827213, (Europe PMC) | NA | BioGRID |
| KSR1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LIMA1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| LRFN1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MAGI1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MARK2 | Affinity Capture-Western, Biochemical Activity | physical | 16980613, (Europe PMC) | NA | BioGRID |
| MARK3 | Affinity Capture-Western, Biochemical Activity | physical | 16980613, (Europe PMC) | NA | BioGRID |
| MAST3 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| MEF2A | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 16956611, 16980305, 20590529, 22308472, (Europe PMC) | NA | BioGRID |
| MEF2C | Affinity Capture-Western, Reconstituted Complex | physical | 11279209, 18463162, (Europe PMC) | NA | BioGRID |
| MEF2C | anti tag coimmunoprecipitation | association | 23752268, (Europe PMC) | 0.35 | IntAct |
| MOCOS | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| MOV10 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| NCOR1 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical | 11466315, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NCOR2 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 11466315, 16956611, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NR2E1 | Affinity Capture-Western | physical | 17873065, (Europe PMC) | NA | BioGRID |
| NXF1 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| PML | Affinity Capture-Western | physical | 18463162, 22155184, (Europe PMC) | NA | BioGRID |
| PPM1H | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| PPP1CB | Affinity Capture-MS, Affinity Capture-Western | physical | 17369396, (Europe PMC) | NA | BioGRID |
| PPP1R12A | Affinity Capture-MS, Affinity Capture-Western | physical | 17369396, (Europe PMC) | NA | BioGRID |
| PPP2CA | Affinity Capture-Western, Biochemical Activity | physical | 18339811, (Europe PMC) | NA | BioGRID |
| PRKD1 | Affinity Capture-Western | physical | 19029091, (Europe PMC) | NA | BioGRID |
| PRKD2 | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, protein kinase assay, pull down | phosphorylation reaction, physical, physical association | 17962809, (Europe PMC) | 0.64 | BioGRID, IntAct, MINT |
| RAP1GDS1 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| REL | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.49, 0.56 | BioGRID, IntAct |
| RHOA | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| RIPPLY1 | Two-hybrid | physical | 25416956, (Europe PMC) | NA | BioGRID |
| RIPPLY1 | two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical association | 25416956, (Europe PMC) | 0.49, 0.56 | IntAct |
| RTKN | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| RUNX2 | Affinity Capture-Western, Co-localization, Reconstituted Complex | physical | 17997710, (Europe PMC) | NA | BioGRID |
| SDCBP | phage display | direct interaction | 26787460, (Europe PMC) | 0.44 | IntAct, MINT |
| SFN | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 15778465, 18339811, 23752268, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| SH3PXD2A | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SHMT2 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| SIPA1L1 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| SRGAP2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TBL1X | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TBL1XR1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TESK2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TTF2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| UBE2I | Affinity Capture-Western, Reconstituted Complex | physical | 18625722, (Europe PMC) | NA | BioGRID |
| UGP2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| WDR73 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| YWHAB | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 17369396, 23752268, 24255178, (Europe PMC) | 0.53 | BioGRID, IntAct |
| YWHAE | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 17369396, 17979178, 20224040, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAG | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation | association, physical, physical association | 15324660, 17353931, 23752268, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| YWHAH | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 17979178, 20224040, 23752268, 26496610, (Europe PMC) | 0.35, 0.53 | BioGRID, IntAct |
| YWHAQ | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation | association, physical | 15161933, 16956611, 16980613, 17369396, 23752268, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down | association, physical, physical association | 15161933, 20224040, 23752268, (Europe PMC) | 0.67 | BioGRID, IntAct, MINT |
| ZBTB16 | Reconstituted Complex | physical | 11929873, (Europe PMC) | NA | BioGRID |
| ZBTB21 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ZFP36 | Affinity Capture-Western | physical | 19738286, (Europe PMC) | NA | BioGRID |
| ZMYM6 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| ZNF638 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| ZYG11B | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |