Top
FLNA
Localization (UniProt annotation) Cytoplasm, cell cortex Cytoplasm,cytoskeleton Function (UniProt annotation) Promotes orthogonal branching of actin filaments andlinks actin filaments to membrane glycoproteins Anchors varioustransmembrane proteins to the actin cytoskeleton and serves as ascaffold for a wide range of cytoplasmic signaling proteinsInteraction with FLNA may allow neuroblast migration from theventricular zone into the cortical plate Tethers cell surface-localized furin, modulates its rate of internalization and directsits intracellular trafficking (By similarity) Involved inciliogenesis Plays a role in cell-cell contacts and adherensjunctions during the development of blood vessels, heart and brainorgans Plays a role in platelets morphology through interactionwith SYK that regulates ITAM- and ITAM-like-containing receptorsignaling, resulting in by platelet cytoskeleton organizationmaintenance (By similarity) Catalytic Activity (UniProt annotation) N/A Protein Sequence MSSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIAL
LEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEED
EEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYV
EDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANK
TTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
SACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQN
IGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEA
GEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE
ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAG
QGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGP
GLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSP
FSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGP
YEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDG
TCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE
AGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSV
DARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRV
HGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYS
ISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNH
DGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQ
YTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLH
EMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLK
RLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGL
SLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHK
VRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSP
FVVPVASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECP
EGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKV
VAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS
PYRVVVP
ELM Motif Motif Instance
Description Motif Regex NA NA NA NA
FLNA is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa04010 MAPK signaling pathway The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli. hsa04510 Focal adhesion Cell-matrix adhesions play essential roles in important biological processes including cell motility, cell proliferation, cell differentiation, regulation of gene expression and cell survival. At the cell-extracellular matrix contact points, specialized structures are formed and termed focal adhesions, where bundles of actin filaments are anchored to transmembrane receptors of the integrin family through a multi-molecular complex of junctional plaque proteins. Some of the constituents of focal adhesions participate in the structural link between membrane receptors and the actin cytoskeleton, while others are signalling molecules, including different protein kinases and phosphatases, their substrates, and various adapter proteins. Integrin signaling is dependent upon the non-receptor tyrosine kinase activities of the FAK and src proteins as well as the adaptor protein functions of FAK, src and Shc to initiate downstream signaling events. These signalling events culminate in reorganization of the actin cytoskeleton; a prerequisite for changes in cell shape and motility, and gene expression. Similar morphological alterations and modulation of gene expression are initiated by the binding of growth factors to their respective receptors, emphasizing the considerable crosstalk between adhesion- and growth factor-mediated signalling. hsa05132 Salmonella infection Salmonella infection usually presents as a self-limiting gastroenteritis or the more severe typhoid fever and bacteremia. The common disease-causing Salmonella species in human is a single species, Salmonella enterica, which has numerous serovars.Following intestinal colonization Salmonella inject effector proteins into the host cells using a type III secretion system (T3SS), T3SS1. Then a small group of effector proteins induce rearrangement of the actin cytoskeleton resulting in membrane ruffles and rapid internalization of the bacteria.The T3SS2 is responsible for translocating effector proteins that direct Salmonella-containing vacuole (SCV) maturation. The majority of the bacteria are known to survive and replicate in SCV. hsa05205 Proteoglycans in cancer Many proteoglycans (PGs) in the tumor microenvironment have been shown to be key macromolecules that contribute to biology of various types of cancer including proliferation, adhesion, angiogenesis and metastasis, affecting tumor progress. The four main types of proteoglycans include hyaluronan (HA), which does not occur as a PG but in free form, heparan sulfate proteoglycans (HSPGs), chondroitin sulfate proteoglycans (CSPGs), dematan sulfate proteoglycans (DSPG) and keratan sulfate proteoglycans (KSPGs) [BR:00535]. Among these proteoglycans such as HA, acting with CD44, promotes tumor cell growth and migration, whereas other proteoglycans such as syndecans (-1~-4), glypican (-1, -3) and perlecan may interact with growth factors, cytokines, morphogens and enzymes through HS chains [BR: 00536], also leading to tumor growth and invasion. In contrast, some of the small leucine-rich proteolgycans, such as decorin and lumican, can function as tumor repressors, and modulate the signaling pathways by the interaction of their core proteins and multiple receptors.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-114608 Platelet degranulation. Platelets function as exocytotic cells, secreting a plethora of effector molecules at sites of vascular injury. Platelets contain a number of distinguishable storage granules including alpha granules, dense granules and lysosomes. On activation platelets release a variety of proteins, largely from storage granules but also as the result of apparent cell lysis. These act in an autocrine or paracrine fashion to modulate cell signaling. Alpha granules contain mainly polypeptides such as fibrinogen, von Willebrand factor, growth factors and protease inhibitors that that supplement thrombin generation at the site of injury. Dense granules contain small molecules, particularly adenosine diphosphate (ADP), adenosine triphosphate (ATP), serotonin and calcium, all recruit platelets to the site of injury. \n\nThe molecular mechanism which facilitates granule release involves soluble NSF attachment protein receptors (SNAREs), which assemble into complexes to form a universal membrane fusion apparatus. Although all cells use SNAREs for membrane fusion, different cells possess different SNARE isoforms. Platelets and chromaffin cells use many of the same chaperone proteins to regulate SNARE-mediated secretion (Fitch-Tewfik & Flaumenhaft 2013) R-HSA-430116 GP1b-IX-V activation signalling. The platelet GPIb complex (GP1b-IX-V) together with GPVI are primarily responsible for regulating the initial adhesion of platelets to the damaged blood vessel and platelet activation. The importance of GPIb is demonstrated by the bleeding problems in patients with Bernard-Soulier syndrome where this receptor is either absent or defective. GP1b-IX-V binds von Willebrand Factor (vWF) to resting platelets, particularly under conditions of high shear stress. This transient interaction is the first stage of the vascular repair process. Activation of GP1b-IX-V on exposure of the fibrous matrix following atherosclerotic plaque rupture, or in occluded arteries, is a major contributory factor leading to thrombus formation leading to heart attack or stroke.\nGpIb also binds thrombin (Yamamoto et al. 1986), at a site distinct from the site of vWF binding, acting as a docking site for thrombin which then activates Proteinase Activated Receptors leading to enhanced platelet activation (Dormann et al. 2000) R-HSA-446353 Cell-extracellular matrix interactions. Cell-extracellular matrix (ECM) interactions play a critical role in regulating a variety of cellular processes in multicellular organisms including motility, shape change, survival, proliferation and differentiation. Cell-ECM contact is mediated by transmembrane cell adhesion receptors, such as integrins, that interact with extracellular matrix proteins as well as a number of cytoplasmic adaptor proteins. Many of these adaptor proteins physically interact with the actin cytoskeleton or function in signal transduction. Several protein complexes interact with the cytoplasmic tail of integrins and function in transducing bi-directional signals between the ECM and intracellular signaling pathways (reviewed in Sepulveda et al., 2005).Early events that are triggered by interactions with ECM, such as formation/turnover of Focal Adhesions, regulation of actin dynamics and protrusion of lamellipodia to promote cellular spreading and motility are modulated by PINCH- ILK- parvin complexes (see Sepulveda et al., 2005). A number of partners of the PINCH-ILK-parvin complex components have been identified that regulate and/or mediate the functions of these complexes (reviewed in Wu, 2004). Interactions with some of these partners modulate cytoskeletal remodeling and cell spreading R-HSA-5627123 RHO GTPases activate PAKs. The PAKs (p21-activated kinases) are a family of serine/threonine kinases mainly implicated in cytoskeletal rearrangements. All PAKs share a conserved catalytic domain located at the carboxyl terminus and a highly conserved motif in the amino terminus known as p21-binding domain (PBD) or Cdc42/Rac interactive binding (CRIB) domain. There are six mammalian PAKs that can be divided into two classes: class I (or conventional) PAKs (PAK1-3) and class II PAKs (PAK4-6). Conventional PAKs are important regulators of cytoskeletal dynamics and cell motility and are additionally implicated in transcription through MAPK (mitogen-activated protein kinase) cascades, death and survival signaling and cell cycle progression (Chan and Manser 2012).PAK1, PAK2 and PAK3 are direct effectors of RAC1 and CDC42 GTPases. RAC1 and CDC42 bind to the CRIB domain. This binding induces a conformational change that disrupts inactive PAK homodimers and relieves autoinhibition of the catalytic carboxyl terminal domain (Manser et al. 1994, Manser et al. 1995, Zhang et al. 1998, Lei et al. 2000, Parrini et al. 2002; reviewed by Daniels and Bokoch 1999, Szczepanowska 2009). Autophosphorylation of a conserved threonine residue in the catalytic domain of PAKs (T423 in PAK1, T402 in PAK2 and T436 in PAK3) is necessary for the kinase activity of PAK1, PAK2 and PAK3. Autophosphorylation of PAK1 serine residue S144, PAK2 serine residue S141, and PAK3 serine residue S154 disrupts association of PAKs with RAC1 or CDC42 and enhances kinase activity (Lei et al. 2000, Chong et al. 2001, Parrini et al. 2002, Jung and Traugh 2005, Wang et al. 2011). LIMK1 is one of the downstream targets of PAK1 and is activated through PAK1-mediated phosphorylation of the threonine residue T508 within its activation loop (Edwards et al. 1999). Further targets are the myosin regulatory light chain (MRLC), myosin light chain kinase (MLCK), filamin, cortactin, p41Arc (a subunit of the Arp2/3 complex), caldesmon, paxillin and RhoGDI, to mention a few (Szczepanowska 2009).
Class II PAKs also have a CRIB domain, but lack a defined autoinhibitory domain and proline-rich regions. They do not require GTPases for their kinase activity, but their interaction with RAC or CDC42 affects their subcellular localization. Only conventional PAKs will be annotated here
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABLIM1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ACAD10 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ACTB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ACTG1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ACTN4 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID ACTR2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ACTR3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ADAMTSL4 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ADRB2 Affinity Capture-MS physical 23798571 , (Europe PMC )NA BioGRID AFAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AGO3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 19167051 , (Europe PMC )0.35 BioGRID, IntAct AKAP12 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID AKAP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ALKBH3 Affinity Capture-MS physical 25944111 , (Europe PMC )NA BioGRID ANLN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ANTXR1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ANXA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2A1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2B1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2M1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct APC Two-hybrid physical 20936779 , (Europe PMC )NA BioGRID APOH Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID AR Two-hybrid physical 12682292 , (Europe PMC )NA BioGRID ARFGEF2 Co-localization physical 24089482 , (Europe PMC )NA BioGRID ARHGAP11A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARHGAP21 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARPC1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARPC3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARPC4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARPC5L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARRB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 17620599 , (Europe PMC )0.35 BioGRID, IntAct ARRB2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17620599 , 17984062 , (Europe PMC )0.35 BioGRID, IntAct ASB2 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 18799729 , 21737450 , 21750192 , 24052262 , (Europe PMC )NA BioGRID BANF1 Affinity Capture-MS physical 19759913 , (Europe PMC )NA BioGRID BASP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BMP2K Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BRCA1 Affinity Capture-MS physical 22990118 , 26831064 , (Europe PMC )NA BioGRID BRCA2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11602572 , (Europe PMC )NA BioGRID BSG Affinity Capture-MS physical 23463506 , (Europe PMC )NA BioGRID BTK Affinity Capture-MS, pull down association, physical 21080425 , (Europe PMC )0.35 BioGRID, IntAct CALM1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID CAMK2G Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct CAMKK2 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct CAPN6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CAPZA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAPZA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAPZB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CARD8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CASR Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11390379 , 11390380 , (Europe PMC )NA BioGRID CCDC8 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CD44 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CD59 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CD81 Affinity Capture-MS, Affinity Capture-Western physical 23463506 , (Europe PMC )NA BioGRID CDC73 Affinity Capture-MS physical 27462432 , (Europe PMC )NA BioGRID CDH1 Proximity Label-MS physical 25468996 , (Europe PMC )NA BioGRID CDK2 Affinity Capture-MS physical 21319273 , (Europe PMC )NA BioGRID CEP162 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CFL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CFL2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHMP4B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLINT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTC Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CMIP Affinity Capture-Western, Two-hybrid physical 15128042 , (Europe PMC )NA BioGRID COBL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CORO1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CORO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CORO2A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CPLX1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID CPM Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CRK Co-localization, peptide array, proximity ligation assay physical, physical association 17474147 , 25241761 , (Europe PMC )0.59 BioGRID, IntAct CRY1 Affinity Capture-MS physical 25756610 , (Europe PMC )NA BioGRID CRY2 Affinity Capture-MS physical 25756610 , (Europe PMC )NA BioGRID CTTN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CYBRD1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID DAB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DAPK3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DBN1 Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation association, physical 22939629 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct DCN Reconstituted Complex physical 12106908 , (Europe PMC )NA BioGRID DIXDC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DMWD Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct DNAAF5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID DRD2 Affinity Capture-Western physical 12181426 , (Europe PMC )NA BioGRID DRD3 Two-hybrid physical 11911837 , (Europe PMC )NA BioGRID DSG2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DYNC1H1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID DYNC1LI1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID DYNC1LI2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ECT2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID ELP1 Affinity Capture-MS, Affinity Capture-Western physical 18303054 , (Europe PMC )NA BioGRID EPS15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ESR1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct F3 Reconstituted Complex physical 9490735 , (Europe PMC )NA BioGRID FABP1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct FAM90A1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FBLIM1 Affinity Capture-Western, Two-hybrid physical 12679033 , (Europe PMC )NA BioGRID FBXW11 Affinity Capture-MS physical 25900982 , (Europe PMC )NA BioGRID FILIP1 Affinity Capture-Western, Two-hybrid physical 12055638 , (Europe PMC )NA BioGRID FLII Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FLNB Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, two hybrid association, colocalization, physical, physical association 12393796 , 22939629 , 26344197 , 26496610 , (Europe PMC )0.35, 0.54 BioGRID, IntAct FLOT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FLOT2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct FOXRED2 Affinity Capture-MS physical 22119785 , (Europe PMC )NA BioGRID FSCN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct G3BP1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct GNAI1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GNAS Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GNB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GNG12 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GP1BA Affinity Capture-Western, Co-localization, proximity ligation assay physical, physical association 11700320 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct GRB2 Affinity Capture-MS, peptide array, pull down association, physical, physical association 12577067 , 17474147 , 21706016 , (Europe PMC )0.56 BioGRID, IntAct GSN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HDAC5 Affinity Capture-MS physical 21081666 , (Europe PMC )NA BioGRID HEY1 Affinity Capture-MS physical 27129302 , (Europe PMC )NA BioGRID HIST1H3E Affinity Capture-MS physical 26527279 , (Europe PMC )NA BioGRID HMGB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA1 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID HNRNPD Two-hybrid physical 15231747 , (Europe PMC )NA BioGRID HSP90AA1 Affinity Capture-MS physical 16263121 , (Europe PMC )NA BioGRID HSP90AB1 Affinity Capture-MS, Co-localization, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity ligation assay association, physical, physical association 16263121 , 25241761 , 26496610 , (Europe PMC )0.67 BioGRID, IntAct, MINT HSPB7 Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 28514442 , (Europe PMC )0.70 BioGRID, IntAct ICAM1 Affinity Capture-MS, Affinity Capture-Western physical 23463506 , (Europe PMC )NA BioGRID IGSF8 Affinity Capture-MS, Affinity Capture-Western physical 23463506 , (Europe PMC )NA BioGRID IKBIP Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID ILF2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID INF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct IQCB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21565611 , (Europe PMC )0.35 BioGRID, IntAct IQGAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ISG15 Affinity Capture-MS physical 16009940 , (Europe PMC )NA BioGRID ITGA4 Affinity Capture-MS, affinity chromatography technology physical, physical association 10604475 , 22623428 , (Europe PMC )0.40 BioGRID, IntAct ITGB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti bait coimmunoprecipitation, fluorescence microscopy, pull down colocalization, direct interaction, physical, physical association 10604475 , 11807098 , 15225631 , 17690686 , 18177638 , 9722563 , (Europe PMC )0.40, 0.82 BioGRID, IntAct, MINT ITGB3 Two-hybrid, nuclear magnetic resonance, surface plasmon resonance direct interaction, physical, physical association 11807098 , 25849143 , (Europe PMC )0.61 BioGRID, IntAct ITGB6 Two-hybrid physical 11807098 , (Europe PMC )NA BioGRID ITGB7 Reconstituted Complex, anti tag coimmunoprecipitation, filter binding, pull down, saturation binding direct interaction, physical, physical association 11781567 , 15225631 , 17690686 , 21926999 , (Europe PMC )0.56, 0.74 BioGRID, IntAct, MINT ITPR3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ITPRID2 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID JUP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KCND2 Affinity Capture-Western physical 20498229 , (Europe PMC )NA BioGRID KCNE4 Affinity Capture-Western, Two-hybrid physical 20498229 , (Europe PMC )NA BioGRID KCTD10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KIAA1211 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID KLHL12 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct LGALS1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID LGALS14 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct LIG4 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID LIMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LMNA Proximity Label-MS, Two-hybrid physical 16248985 , 22412018 , (Europe PMC )NA BioGRID LUZP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MAP3K3 Co-localization, proximity ligation assay, tandem affinity purification physical, physical association 14743216 , 25241761 , (Europe PMC )0.59 BioGRID, IntAct MAPK14 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct MAPRE1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MCM2 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MCM5 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MCPH1 Two-hybrid physical 29150431 , (Europe PMC )NA BioGRID MDC1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID MISP Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MPRIP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MTNR1A Affinity Capture-MS, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 17215244 , 26514267 , (Europe PMC )0.37 BioGRID, IntAct MTNR1B Reconstituted Complex, Two-hybrid, tandem affinity purification, two hybrid association, physical, physical association 17215244 , 26514267 , (Europe PMC )0.55 BioGRID, IntAct MYBL2 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation physical 18548008 , (Europe PMC )NA BioGRID MYC Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MYH11 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYH9 Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation association, physical 22939629 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO18A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO19 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MYO1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO1E Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO5A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO5C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NEXN Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID NLGN3 Two-hybrid, anti bait coimmunoprecipitation, confocal microscopy, two hybrid association, colocalization, physical, physical association 25464930 , (Europe PMC )0.27, 0.37, 0.43 BioGRID, IntAct NMD3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NPHP1 Affinity Capture-Western, Two-hybrid physical 12006559 , (Europe PMC )NA BioGRID NPM1 Affinity Capture-MS physical 23402259 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID OTUD1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct OTUD5 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct PALLD Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PALM Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PAN2 Affinity Capture-MS physical 23398456 , (Europe PMC )NA BioGRID PDIA3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PDLIM7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PFDN2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PFDN4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PFDN5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PHLDB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical, physical association 20236936 , 26496610 , (Europe PMC )0.56 BioGRID, IntAct PIK3C2A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PLEC Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PLEKHG3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPME1 Affinity Capture-MS physical 26499835 , (Europe PMC )NA BioGRID PPP1CA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP1CB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP1CC Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP1R12A Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PPP1R18 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP1R9B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RAB8B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RAI14 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RALA Affinity Capture-Western, Reconstituted Complex physical 10051605 , (Europe PMC )NA BioGRID RANBP2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RBM39 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID REL Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct RFLNA Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID RPA1 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA2 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA3 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPS23 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID S100A10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SEC13 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SELE Reconstituted Complex physical 8609175 , (Europe PMC )NA BioGRID SH2B3 Affinity Capture-Western, Two-hybrid physical 11163396 , (Europe PMC )NA BioGRID SHBG Two-hybrid physical 15862967 , (Europe PMC )NA BioGRID SIRT6 Affinity Capture-MS physical 24169447 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SMAD3 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMURF1 Affinity Capture-MS physical 23184937 , (Europe PMC )NA BioGRID SORBS2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPECC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTAN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTBN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTBN2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SRC Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct SRRM2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SRSF11 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SSH2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STAU1 Affinity Capture-MS physical 23125841 , (Europe PMC )NA BioGRID STON2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SVIL Affinity Capture-MS, Two-hybrid physical 20309963 , 26496610 , (Europe PMC )NA BioGRID SYNPO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYNPO2 Affinity Capture-Western, Two-hybrid physical 20554076 , 23434281 , (Europe PMC )NA BioGRID TCF4 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct TDRD15 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TES Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28378594 , (Europe PMC )0.35 BioGRID, IntAct TJP1 Affinity Capture-MS, pull down association, physical 16944923 , (Europe PMC )0.35 BioGRID, IntAct TMOD1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TMOD3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TP53 Affinity Capture-MS physical 25144556 , (Europe PMC )NA BioGRID TP53BP1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID TPM1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID TPM2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TPM4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TPRN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TRA2B Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TRAF2 Affinity Capture-Western, Co-localization, proximity ligation assay physical, physical association 10617615 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct TRIM55 Two-hybrid physical 18157088 , (Europe PMC )NA BioGRID TRIO Reconstituted Complex, Two-hybrid physical 11146652 , (Europe PMC )NA BioGRID TSGA10 Affinity Capture-MS physical 20797700 , (Europe PMC )NA BioGRID TTC41P Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TWF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TXNDC16 Affinity Capture-MS physical 22119785 , (Europe PMC )NA BioGRID TXNIP Proximity Label-MS physical 27437069 , (Europe PMC )NA BioGRID UAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct USP19 Two-hybrid physical 23500468 , (Europe PMC )NA BioGRID USP45 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct VBP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct VHL Two-hybrid physical 12169691 , 8674032 , (Europe PMC )NA BioGRID WDR1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ZBTB1 Affinity Capture-MS physical 24657165 , (Europe PMC )NA BioGRID ZBTB20 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABL1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct ABLIM1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ACTB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ACTG1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ACTN4 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct ACTR2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ACTR3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ADAMTSL4 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct AFAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AGO3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 19167051 , (Europe PMC )0.35 BioGRID, IntAct AKAP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ANLN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ANTXR1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ANXA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2A1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2B1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2M1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct APC two hybrid pooling approach physical association 20936779 , (Europe PMC )0.37 IntAct ARHGAP11A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARHGAP21 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARHGAP24 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, pull down, two hybrid colocalization, direct interaction, physical association 16862148 , 21926999 , (Europe PMC )0.44, 0.64 IntAct ARPC1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARPC3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARPC4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARPC5L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARRB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 17620599 , (Europe PMC )0.35 BioGRID, IntAct ARRB2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17620599 , 17984062 , (Europe PMC )0.35 BioGRID, IntAct BASP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BMP2K Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BTK Affinity Capture-MS, pull down association, physical 21080425 , (Europe PMC )0.35 BioGRID, IntAct CAMK2G Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct CAMKK2 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct CAPZA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAPZA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAPZB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CCNB2 anti bait coimmunoprecipitation, far western blotting, imaging technique, protein kinase assay, pull down colocalization, direct interaction, phosphorylation reaction, physical association 17408621 , (Europe PMC )0.68 IntAct, MINT CD44 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CD59 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CENPA tandem affinity purification association 20080577 , (Europe PMC )0.35 IntAct CEP162 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CFL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CFL2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHMP4B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLINT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTC Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct COBL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CORO1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CORO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CORO2A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CPM Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CRK Co-localization, peptide array, proximity ligation assay physical, physical association 17474147 , 25241761 , (Europe PMC )0.59 BioGRID, IntAct CTTN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CYBRD1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DAB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DAPK3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DBN1 Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation association, physical 22939629 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct DIXDC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DMWD Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct DSG2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DUX4 pull down association 26816005 , (Europe PMC )0.35 IntAct EHMT2 anti tag coimmunoprecipitation association 26028330 , (Europe PMC )0.35 IntAct EPS15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ESR1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct ESR2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct FABP1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct FLII Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FLNA cross-linking study physical association 2391361 , (Europe PMC )0.40 IntAct FLNB Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, two hybrid association, colocalization, physical, physical association 12393796 , 22939629 , 26344197 , 26496610 , (Europe PMC )0.35, 0.54 BioGRID, IntAct FLOT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FLOT2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct FOXC1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, pull down colocalization, physical association 15684392 , (Europe PMC )0.61 IntAct FSCN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FYN peptide array physical association 17474147 , (Europe PMC )0.40 IntAct G3BP1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct GABARAPL1 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GNAI1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GNAS Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GNB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GNG12 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GP1BA Affinity Capture-Western, Co-localization, proximity ligation assay physical, physical association 11700320 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct GRB2 Affinity Capture-MS, peptide array, pull down association, physical, physical association 12577067 , 17474147 , 21706016 , (Europe PMC )0.56 BioGRID, IntAct GSN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HERC2 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct HMGB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HSP90AB1 Affinity Capture-MS, Co-localization, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity ligation assay association, physical, physical association 16263121 , 25241761 , 26496610 , (Europe PMC )0.67 BioGRID, IntAct, MINT HSPB7 Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 28514442 , (Europe PMC )0.70 BioGRID, IntAct IKBKB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct IKBKG tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct INF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct IQCB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21565611 , (Europe PMC )0.35 BioGRID, IntAct IQGAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ITGA2B nuclear magnetic resonance, surface plasmon resonance direct interaction, physical association 25849143 , (Europe PMC )0.61 IntAct ITGA4 Affinity Capture-MS, affinity chromatography technology physical, physical association 10604475 , 22623428 , (Europe PMC )0.40 BioGRID, IntAct ITGB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti bait coimmunoprecipitation, fluorescence microscopy, pull down colocalization, direct interaction, physical, physical association 10604475 , 11807098 , 15225631 , 17690686 , 18177638 , 9722563 , (Europe PMC )0.40, 0.82 BioGRID, IntAct, MINT ITGB3 Two-hybrid, nuclear magnetic resonance, surface plasmon resonance direct interaction, physical, physical association 11807098 , 25849143 , (Europe PMC )0.61 BioGRID, IntAct ITGB4 pull down physical association 15225631 , (Europe PMC )0.40 IntAct, MINT ITGB7 Reconstituted Complex, anti tag coimmunoprecipitation, filter binding, pull down, saturation binding direct interaction, physical, physical association 11781567 , 15225631 , 17690686 , 21926999 , (Europe PMC )0.56, 0.74 BioGRID, IntAct, MINT ITPR3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT JUP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KCNJ2 pull down physical association 12923176 , (Europe PMC )0.40 IntAct KCTD10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KLHL12 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct LGALS14 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct LIMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LUZP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MAP3K1 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MAP3K3 Co-localization, proximity ligation assay, tandem affinity purification physical, physical association 14743216 , 25241761 , (Europe PMC )0.59 BioGRID, IntAct MAP3K7 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MAPK14 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct MAPRE1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MISP anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MPRIP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MTNR1A Affinity Capture-MS, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 17215244 , 26514267 , (Europe PMC )0.37 BioGRID, IntAct MTNR1B Reconstituted Complex, Two-hybrid, tandem affinity purification, two hybrid association, physical, physical association 17215244 , 26514267 , (Europe PMC )0.55 BioGRID, IntAct MYB anti tag coimmunoprecipitation association 18548008 , (Europe PMC )0.35 IntAct, MINT MYC Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MYH11 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYH9 Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation association, physical 22939629 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO18A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO19 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MYO1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO1E Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO5A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO5C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NEXN anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct NLGN3 Two-hybrid, anti bait coimmunoprecipitation, confocal microscopy, two hybrid association, colocalization, physical, physical association 25464930 , (Europe PMC )0.27, 0.37, 0.43 BioGRID, IntAct NRP1 isothermal titration calorimetry, surface plasmon resonance direct interaction 24021649 , (Europe PMC )0.56 IntAct, MINT OPRM1 anti tag coimmunoprecipitation, confocal microscopy, pull down, two hybrid colocalization, physical association 14573758 , (Europe PMC )0.60 IntAct OTUD1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct OTUD5 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct PAK1 two hybrid physical association 17389360 , (Europe PMC )0.37 IntAct PALLD Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PALM Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PDLIM7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PHLDB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical, physical association 20236936 , 26496610 , (Europe PMC )0.56 BioGRID, IntAct PIK3C2A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PIK3R1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PLCG1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PLEC Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PLEKHG3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct POLR1C anti bait coimmunoprecipitation physical association 22307607 , (Europe PMC )0.40 IntAct PPP1CA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP1CB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP1CC Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP1R12A anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct PPP1R18 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP1R9B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PRKACB protein kinase assay phosphorylation reaction 15225631 , (Europe PMC )0.44 IntAct, MINT PRR5 anti tag coimmunoprecipitation association 17461779 , (Europe PMC )0.35 IntAct PSEN1 coimmunoprecipitation, two hybrid physical association 9437013 , (Europe PMC )0.51 IntAct, MINT PSEN2 coimmunoprecipitation, two hybrid physical association 9437013 , (Europe PMC )0.51 IntAct, MINT RAI14 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct REL Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct RFLNA two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 25416956 , (Europe PMC )0.49, 0.56 IntAct RIPK3 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct RPS9 anti bait coimmunoprecipitation association 17461779 , (Europe PMC )0.35 IntAct S100A10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SEC13 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SLX4 anti tag coimmunoprecipitation association 19596235 , (Europe PMC )0.35 IntAct SMAD3 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT SORBS2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPECC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTAN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTBN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTBN2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SRC Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct SSFA2 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct SSH2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STON2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SVIL anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct SYNPO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TAB2 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TCF4 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct TES Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28378594 , (Europe PMC )0.35 BioGRID, IntAct TJP1 Affinity Capture-MS, pull down association, physical 16944923 , (Europe PMC )0.35 BioGRID, IntAct TMOD1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TMOD3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TNFRSF1B tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TPM2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TPM4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TPRN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TRAF2 Affinity Capture-Western, Co-localization, proximity ligation assay physical, physical association 10617615 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct TRIM24 anti bait coimmunoprecipitation physical association 22307607 , (Europe PMC )0.40 IntAct TTN two hybrid physical association 16902413 , (Europe PMC )0.37 IntAct, MINT TUBA1A pull down association 27291054 , (Europe PMC )0.35 IntAct TUBB3 pull down association 27291054 , (Europe PMC )0.35 IntAct TWF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct UAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ULK2 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct USP45 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct WDR1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct YWHAZ pull down physical association 15161933 , (Europe PMC )0.40 IntAct, MINT ZBTB20 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source HSP90AB1 Affinity Capture-MS, Co-localization, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity ligation assay association, physical, physical association 16263121 , 25241761 , 26496610 , (Europe PMC )0.67 BioGRID, IntAct, MINT ITGB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti bait coimmunoprecipitation, fluorescence microscopy, pull down colocalization, direct interaction, physical, physical association 10604475 , 11807098 , 15225631 , 17690686 , 18177638 , 9722563 , (Europe PMC )0.40, 0.82 BioGRID, IntAct, MINT ITGB4 pull down physical association 15225631 , (Europe PMC )0.40 IntAct, MINT ITGB7 Reconstituted Complex, anti tag coimmunoprecipitation, filter binding, pull down, saturation binding direct interaction, physical, physical association 11781567 , 15225631 , 17690686 , 21926999 , (Europe PMC )0.56, 0.74 BioGRID, IntAct, MINT JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYB anti tag coimmunoprecipitation association 18548008 , (Europe PMC )0.35 IntAct, MINT NRP1 isothermal titration calorimetry, surface plasmon resonance direct interaction 24021649 , (Europe PMC )0.56 IntAct, MINT PRKACB protein kinase assay phosphorylation reaction 15225631 , (Europe PMC )0.44 IntAct, MINT PSEN1 coimmunoprecipitation, two hybrid physical association 9437013 , (Europe PMC )0.51 IntAct, MINT PSEN2 coimmunoprecipitation, two hybrid physical association 9437013 , (Europe PMC )0.51 IntAct, MINT SMAD3 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT TTN two hybrid physical association 16902413 , (Europe PMC )0.37 IntAct, MINT YWHAZ pull down physical association 15161933 , (Europe PMC )0.40 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCE1 Affinity Capture-MS physical 25659154 , (Europe PMC )NA BioGRID ABL1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct ABLIM1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ACAD10 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ACTB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ACTG1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ACTN4 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID ACTN4 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct ACTR2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ACTR3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ADAMTSL4 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct ADRB2 Affinity Capture-MS physical 23798571 , (Europe PMC )NA BioGRID AFAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AGO3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 19167051 , (Europe PMC )0.35 BioGRID, IntAct AKAP12 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID AKAP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ALKBH3 Affinity Capture-MS physical 25944111 , (Europe PMC )NA BioGRID ANLN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ANTXR1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ANXA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2A1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2B1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2M1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct APC Two-hybrid physical 20936779 , (Europe PMC )NA BioGRID APC two hybrid pooling approach physical association 20936779 , (Europe PMC )0.37 IntAct APOH Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID AR Two-hybrid physical 12682292 , (Europe PMC )NA BioGRID ARFGEF2 Co-localization physical 24089482 , (Europe PMC )NA BioGRID ARHGAP11A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARHGAP21 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARHGAP24 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, pull down, two hybrid colocalization, direct interaction, physical association 16862148 , 21926999 , (Europe PMC )0.44, 0.64 IntAct ARPC1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARPC3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARPC4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARPC5L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARRB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 17620599 , (Europe PMC )0.35 BioGRID, IntAct ARRB2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17620599 , 17984062 , (Europe PMC )0.35 BioGRID, IntAct ASB2 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 18799729 , 21737450 , 21750192 , 24052262 , (Europe PMC )NA BioGRID BANF1 Affinity Capture-MS physical 19759913 , (Europe PMC )NA BioGRID BASP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BMP2K Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BRCA1 Affinity Capture-MS physical 22990118 , 26831064 , (Europe PMC )NA BioGRID BRCA2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11602572 , (Europe PMC )NA BioGRID BSG Affinity Capture-MS physical 23463506 , (Europe PMC )NA BioGRID BTK Affinity Capture-MS, pull down association, physical 21080425 , (Europe PMC )0.35 BioGRID, IntAct CALM1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID CAMK2G Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct CAMKK2 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct CAPN6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CAPZA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAPZA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAPZB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CARD8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CASR Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11390379 , 11390380 , (Europe PMC )NA BioGRID CCDC8 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CCNB2 anti bait coimmunoprecipitation, far western blotting, imaging technique, protein kinase assay, pull down colocalization, direct interaction, phosphorylation reaction, physical association 17408621 , (Europe PMC )0.68 IntAct, MINT CD44 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CD59 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CD81 Affinity Capture-MS, Affinity Capture-Western physical 23463506 , (Europe PMC )NA BioGRID CDC73 Affinity Capture-MS physical 27462432 , (Europe PMC )NA BioGRID CDH1 Proximity Label-MS physical 25468996 , (Europe PMC )NA BioGRID CDK2 Affinity Capture-MS physical 21319273 , (Europe PMC )NA BioGRID CENPA tandem affinity purification association 20080577 , (Europe PMC )0.35 IntAct CEP162 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CFL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CFL2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHMP4B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLINT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTC Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CMIP Affinity Capture-Western, Two-hybrid physical 15128042 , (Europe PMC )NA BioGRID COBL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CORO1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CORO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CORO2A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CPLX1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID CPM Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CRK Co-localization, peptide array, proximity ligation assay physical, physical association 17474147 , 25241761 , (Europe PMC )0.59 BioGRID, IntAct CRY1 Affinity Capture-MS physical 25756610 , (Europe PMC )NA BioGRID CRY2 Affinity Capture-MS physical 25756610 , (Europe PMC )NA BioGRID CTTN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CYBRD1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID DAB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DAPK3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DBN1 Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation association, physical 22939629 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct DCN Reconstituted Complex physical 12106908 , (Europe PMC )NA BioGRID DIXDC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DMWD Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct DNAAF5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID DRD2 Affinity Capture-Western physical 12181426 , (Europe PMC )NA BioGRID DRD3 Two-hybrid physical 11911837 , (Europe PMC )NA BioGRID DSG2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DUX4 pull down association 26816005 , (Europe PMC )0.35 IntAct DYNC1H1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID DYNC1LI1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID DYNC1LI2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ECT2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID EHMT2 anti tag coimmunoprecipitation association 26028330 , (Europe PMC )0.35 IntAct ELP1 Affinity Capture-MS, Affinity Capture-Western physical 18303054 , (Europe PMC )NA BioGRID EPS15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ESR1 Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient, tandem affinity purification association, physical 21182205 , 25604459 , (Europe PMC )0.60 BioGRID, IntAct ESR2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct F3 Reconstituted Complex physical 9490735 , (Europe PMC )NA BioGRID FABP1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct FAM90A1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FBLIM1 Affinity Capture-Western, Two-hybrid physical 12679033 , (Europe PMC )NA BioGRID FBXW11 Affinity Capture-MS physical 25900982 , (Europe PMC )NA BioGRID FILIP1 Affinity Capture-Western, Two-hybrid physical 12055638 , (Europe PMC )NA BioGRID FLII Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FLNA cross-linking study physical association 2391361 , (Europe PMC )0.40 IntAct FLNB Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, two hybrid association, colocalization, physical, physical association 12393796 , 22939629 , 26344197 , 26496610 , (Europe PMC )0.35, 0.54 BioGRID, IntAct FLOT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FLOT2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct FOXC1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, pull down colocalization, physical association 15684392 , (Europe PMC )0.61 IntAct FOXRED2 Affinity Capture-MS physical 22119785 , (Europe PMC )NA BioGRID FSCN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FYN peptide array physical association 17474147 , (Europe PMC )0.40 IntAct G3BP1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct GABARAPL1 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GNAI1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GNAS Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GNB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GNG12 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GP1BA Affinity Capture-Western, Co-localization, proximity ligation assay physical, physical association 11700320 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct GRB2 Affinity Capture-MS, peptide array, pull down association, physical, physical association 12577067 , 17474147 , 21706016 , (Europe PMC )0.56 BioGRID, IntAct GSN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HDAC5 Affinity Capture-MS physical 21081666 , (Europe PMC )NA BioGRID HERC2 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct HEY1 Affinity Capture-MS physical 27129302 , (Europe PMC )NA BioGRID HIST1H3E Affinity Capture-MS physical 26527279 , (Europe PMC )NA BioGRID HMGB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA1 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID HNRNPD Two-hybrid physical 15231747 , (Europe PMC )NA BioGRID HSP90AA1 Affinity Capture-MS physical 16263121 , (Europe PMC )NA BioGRID HSP90AB1 Affinity Capture-MS, Co-localization, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity ligation assay association, physical, physical association 16263121 , 25241761 , 26496610 , (Europe PMC )0.67 BioGRID, IntAct, MINT HSPB7 Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 28514442 , (Europe PMC )0.70 BioGRID, IntAct ICAM1 Affinity Capture-MS, Affinity Capture-Western physical 23463506 , (Europe PMC )NA BioGRID IGSF8 Affinity Capture-MS, Affinity Capture-Western physical 23463506 , (Europe PMC )NA BioGRID IKBIP Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID IKBKB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct IKBKG tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct ILF2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID INF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct IQCB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21565611 , (Europe PMC )0.35 BioGRID, IntAct IQGAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ISG15 Affinity Capture-MS physical 16009940 , (Europe PMC )NA BioGRID ITGA2B nuclear magnetic resonance, surface plasmon resonance direct interaction, physical association 25849143 , (Europe PMC )0.61 IntAct ITGA4 Affinity Capture-MS, affinity chromatography technology physical, physical association 10604475 , 22623428 , (Europe PMC )0.40 BioGRID, IntAct ITGB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, affinity chromatography technology, anti bait coimmunoprecipitation, fluorescence microscopy, pull down colocalization, direct interaction, physical, physical association 10604475 , 11807098 , 15225631 , 17690686 , 18177638 , 9722563 , (Europe PMC )0.40, 0.82 BioGRID, IntAct, MINT ITGB3 Two-hybrid, nuclear magnetic resonance, surface plasmon resonance direct interaction, physical, physical association 11807098 , 25849143 , (Europe PMC )0.61 BioGRID, IntAct ITGB4 pull down physical association 15225631 , (Europe PMC )0.40 IntAct, MINT ITGB6 Two-hybrid physical 11807098 , (Europe PMC )NA BioGRID ITGB7 Reconstituted Complex, anti tag coimmunoprecipitation, filter binding, pull down, saturation binding direct interaction, physical, physical association 11781567 , 15225631 , 17690686 , 21926999 , (Europe PMC )0.56, 0.74 BioGRID, IntAct, MINT ITPR3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ITPRID2 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT JUP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KCND2 Affinity Capture-Western physical 20498229 , (Europe PMC )NA BioGRID KCNE4 Affinity Capture-Western, Two-hybrid physical 20498229 , (Europe PMC )NA BioGRID KCNJ2 pull down physical association 12923176 , (Europe PMC )0.40 IntAct KCTD10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KIAA1211 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID KLHL12 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct LGALS1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID LGALS14 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct LIG4 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID LIMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LMNA Proximity Label-MS, Two-hybrid physical 16248985 , 22412018 , (Europe PMC )NA BioGRID LUZP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MAP3K1 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MAP3K3 Co-localization, proximity ligation assay, tandem affinity purification physical, physical association 14743216 , 25241761 , (Europe PMC )0.59 BioGRID, IntAct MAP3K7 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MAPK14 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct MAPRE1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MCM2 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MCM5 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MCPH1 Two-hybrid physical 29150431 , (Europe PMC )NA BioGRID MDC1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID MISP Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MISP anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MPRIP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MTNR1A Affinity Capture-MS, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 17215244 , 26514267 , (Europe PMC )0.37 BioGRID, IntAct MTNR1B Reconstituted Complex, Two-hybrid, tandem affinity purification, two hybrid association, physical, physical association 17215244 , 26514267 , (Europe PMC )0.55 BioGRID, IntAct MYB anti tag coimmunoprecipitation association 18548008 , (Europe PMC )0.35 IntAct, MINT MYBL2 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation physical 18548008 , (Europe PMC )NA BioGRID MYC Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MYH11 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYH9 Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation association, physical 22939629 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO18A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO19 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MYO19 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MYO1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO1E Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO5A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO5C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NEXN Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID NEXN anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct NLGN3 Two-hybrid, anti bait coimmunoprecipitation, confocal microscopy, two hybrid association, colocalization, physical, physical association 25464930 , (Europe PMC )0.27, 0.37, 0.43 BioGRID, IntAct NMD3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NPHP1 Affinity Capture-Western, Two-hybrid physical 12006559 , (Europe PMC )NA BioGRID NPM1 Affinity Capture-MS physical 23402259 , (Europe PMC )NA BioGRID NRP1 isothermal titration calorimetry, surface plasmon resonance direct interaction 24021649 , (Europe PMC )0.56 IntAct, MINT NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID OPRM1 anti tag coimmunoprecipitation, confocal microscopy, pull down, two hybrid colocalization, physical association 14573758 , (Europe PMC )0.60 IntAct OTUD1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct OTUD5 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct PAK1 two hybrid physical association 17389360 , (Europe PMC )0.37 IntAct PALLD Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PALM Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PAN2 Affinity Capture-MS physical 23398456 , (Europe PMC )NA BioGRID PDIA3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PDLIM7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PFDN2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PFDN4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PFDN5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PHLDB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical, physical association 20236936 , 26496610 , (Europe PMC )0.56 BioGRID, IntAct PIK3C2A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PIK3R1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PLCG1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PLEC Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PLEKHG3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct POLR1C anti bait coimmunoprecipitation physical association 22307607 , (Europe PMC )0.40 IntAct PPME1 Affinity Capture-MS physical 26499835 , (Europe PMC )NA BioGRID PPP1CA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP1CB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP1CC Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP1R12A Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PPP1R12A anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct PPP1R18 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP1R9B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PRKACB protein kinase assay phosphorylation reaction 15225631 , (Europe PMC )0.44 IntAct, MINT PRR5 anti tag coimmunoprecipitation association 17461779 , (Europe PMC )0.35 IntAct PSEN1 coimmunoprecipitation, two hybrid physical association 9437013 , (Europe PMC )0.51 IntAct, MINT PSEN2 coimmunoprecipitation, two hybrid physical association 9437013 , (Europe PMC )0.51 IntAct, MINT RAB8B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RAI14 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RALA Affinity Capture-Western, Reconstituted Complex physical 10051605 , (Europe PMC )NA BioGRID RANBP2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RBM39 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID REL Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct RFLNA Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID RFLNA two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 25416956 , (Europe PMC )0.49, 0.56 IntAct RIPK3 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct RPA1 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA2 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA3 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPS23 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID RPS9 anti bait coimmunoprecipitation association 17461779 , (Europe PMC )0.35 IntAct S100A10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SEC13 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SELE Reconstituted Complex physical 8609175 , (Europe PMC )NA BioGRID SH2B3 Affinity Capture-Western, Two-hybrid physical 11163396 , (Europe PMC )NA BioGRID SHBG Two-hybrid physical 15862967 , (Europe PMC )NA BioGRID SIRT6 Affinity Capture-MS physical 24169447 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SLX4 anti tag coimmunoprecipitation association 19596235 , (Europe PMC )0.35 IntAct SMAD3 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMURF1 Affinity Capture-MS physical 23184937 , (Europe PMC )NA BioGRID SORBS2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPECC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTAN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTBN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTBN2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SRC Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct SRRM2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SRSF11 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SSFA2 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct SSH2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STAU1 Affinity Capture-MS physical 23125841 , (Europe PMC )NA BioGRID STON2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SVIL Affinity Capture-MS, Two-hybrid physical 20309963 , 26496610 , (Europe PMC )NA BioGRID SVIL anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct SYNPO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYNPO2 Affinity Capture-Western, Two-hybrid physical 20554076 , 23434281 , (Europe PMC )NA BioGRID TAB2 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TCF4 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct TDRD15 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TES Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28378594 , (Europe PMC )0.35 BioGRID, IntAct TJP1 Affinity Capture-MS, pull down association, physical 16944923 , (Europe PMC )0.35 BioGRID, IntAct TMOD1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TMOD3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TNFRSF1B tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TP53 Affinity Capture-MS physical 25144556 , (Europe PMC )NA BioGRID TP53BP1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID TPM1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID TPM2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TPM4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TPRN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TRA2B Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TRAF2 Affinity Capture-Western, Co-localization, proximity ligation assay physical, physical association 10617615 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct TRIM24 anti bait coimmunoprecipitation physical association 22307607 , (Europe PMC )0.40 IntAct TRIM55 Two-hybrid physical 18157088 , (Europe PMC )NA BioGRID TRIO Reconstituted Complex, Two-hybrid physical 11146652 , (Europe PMC )NA BioGRID TSGA10 Affinity Capture-MS physical 20797700 , (Europe PMC )NA BioGRID TTC41P Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TTN two hybrid physical association 16902413 , (Europe PMC )0.37 IntAct, MINT TUBA1A pull down association 27291054 , (Europe PMC )0.35 IntAct TUBB3 pull down association 27291054 , (Europe PMC )0.35 IntAct TWF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TXNDC16 Affinity Capture-MS physical 22119785 , (Europe PMC )NA BioGRID TXNIP Proximity Label-MS physical 27437069 , (Europe PMC )NA BioGRID UAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ULK2 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct USP19 Two-hybrid physical 23500468 , (Europe PMC )NA BioGRID USP45 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct VBP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct VHL Two-hybrid physical 12169691 , 8674032 , (Europe PMC )NA BioGRID WDR1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct YWHAZ pull down physical association 15161933 , (Europe PMC )0.40 IntAct, MINT ZBTB1 Affinity Capture-MS physical 24657165 , (Europe PMC )NA BioGRID ZBTB20 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
AKT1 S2152_TRRRRAPsVANVGSH , NA NA PhosphoSitePlus , CAMK2A S2523_VTGPRLVsNHSLHET , NA NA PhosphoSitePlus , CAMK2G S2515_GGSPFKAsVTGPRLV , in vitro, in vivo 11290523 ,(Europe PMC )HPRD, CDK1 S1084_LQGGSAGsPARFTID , S1436_GGHQVPGsPFKVPVH , S1459_KCSGPGLsPGMVRAN , S1533_GDEEVPRsPFKVKVL , S1630_GGDEIPFsPYRVRAV , NA NA PhosphoSitePlus , CaM-KII_group S2523_VTGPRLVsNHSLHET , LTP 11290523 ,(Europe PMC )PhosphoELM , MAP3K7 T1286_SVDARALtQTGGPHV , NA NA PhosphoSitePlus , PAK1 S2152_TRRRRAPsVANVGSH , S2292_FEDRKDGsCGVAYVV , S2370_AIDAKVHsPSGALEE , LTP 12198493 ,(Europe PMC )PhosphoELM , PhosphoSitePlus , PRKACA S2152_TRRRRAPsVANVGSH , NA NA PhosphoSitePlus , RPS6KA1 S2152_TRRRRAPsVANVGSH , NA NA PhosphoSitePlus , RSK_group S2152_TRRRRAPsVANVGSH , LTP 15024089 ,(Europe PMC )PhosphoELM , Unknown S1081_GPGLQGGsAGSPARF , S1084_LQGGSAGsPARFTID , S11_SHSRAGQsAAGAAPG , S1338_VDVTYDGsPVPSSPF , S1343_DGSPVPSsPFQVPVT , S1436_GGHQVPGsPFKVPVH , S1459_KCSGPGLsPGMVRAN , S1533_GDEEVPRsPFKVKVL , S1630_GGDEIPFsPYRVRAV , S1726_KYVICVRsGGEHVPN , S1938_DYSILVKsNEQHVPG , S2024_GEHLVHVsKNGQHVA , S2025_EHLVHVKsNGQHVAS , S2045_VISQSEIsDASRVRV , S2053_DASRVRVsGQGLHEG , S2120_NYIINIKsADQHVPG , S2123_INIKFADsHVPGSPF , S2128_ADQHVPGsPFSVKVT , S2144_EGRVKESsTRRRRAP , S2150_SITRRRRsPSVANVG , S2152_TRRRRAPsVANVGSH , S2155_RRAPSVAsVGSHCDL , S2158_PSVANVGsHCDLSLK , S2162_NVGSHCDsSLKIPEI , S2276_GGLAIAVsGPSKAEI , S2319_NEEHIPDsPFVVPVA , S2321_EHIPDSPsVVPVASP , S2327_PFVVPVAsPSGDARR , S2330_VPVASPSsDARRLTV , S2335_PSGDARRsTVSSLQE , S2406_VYLIDVKsNGTHIPG , S2414_NGTHIPGsPFKIRVG , S2502_YLISIKYsGPYHIGG , S2510_GPYHIGGsPFKAKVT , S2_MsSSHSRAG , S3_MSsSHSRAGQ , S4_MSSsHSRAGQS , S564_GGQNIGRsPFEVKVG , S6_MSSSHsRAGQSAA , S757_GGVSIPNsPFRVNVG , S966_SPFSVAVsPSLDLSK , T1089_AGSPARFtIDTKGAG , T1288_DARALTQtGGPHVKA , T1334_GLHSVDVtYDGSPVP , T2328_FVVPVAStSGDARRL , T23_APGGGVDtRDAEMPA , T2478_KVKMDCQtCPEGYRV , T31_RDAEMPAtEKDLAED , Y1047_PYEVEVTyDGVPVPG , Y1525_PYSISVLyGDEEVPR , Y1604_QDNHDGTyTVAYVPD , Y2380_GALEECYyTEIDQDK , Y2388_TEIDQDKyAVRFIPR , Y2479_VKMDCQEyPEGYRVT , Y373_AKSPFEVyVDKSQGD , HTP, in vitro, in vivo 15225631 , 15302935 , 15592455 , 16964243 , 17081983 , 17322306 , 17408621 , 17924679 , 18083107 , 18088087 , 18212344 , 18220336 , 18452278 , 18491316 , 18578522 , 18669648 , 18691976 , 18767875 , 19007248 , 19413330 , 19415658 , 19651622 , 19664994 , 19664995 , 20058876 , 20068231 , 20166139 ,(Europe PMC )HPRD, PhosphoELM ,