- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
CTNND1
Gene Name  | CTNND1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 3L6X |
| Synonyms | CTNND1, KIAA0384 | |
| Protein Name | CTNND1 | |
| Alternative Name(s) | Catenin delta-1;Cadherin-associated Src substrate;CAS;p120 catenin;p120(ctn);p120(cas); | |
| Protein Family | Belongs to the beta-catenin family | |
| EntrezGene ID | 1500 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | O60716 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 108170 Dalton | |
| Protein Length | 968 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000198561 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG1048 | eggNOG - ENOG410Y21Q | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Nucleus Cellmembrane Note=Interaction with GLIS2 promotesnuclear translocation (By similarity) Detected at cell-cellcontacts (PubMed:15240885, PubMed:17047063) NANOS1 induces itstranslocation from sites of cell-cell contact to the cytoplasm(PubMed:17047063) CDH1 enhances cell membrane localization(PubMed:15240885) Isoforms 4A and 1AB are excluded from thenucleus (PubMed:11896187) Isoform 1A: Nucleus Isoform 2A: Nucleus Isoform 3A: Nucleus | |||
| Function (UniProt annotation) | |||
| Binds to and inhibits the transcriptional repressorZBTB33, which may lead to activation of target genes of the Wntsignaling pathway (By similarity) Associates with and regulatesthe cell adhesion properties of both C-, E- and N-cadherins, beingcritical for their surface stability Implicated both in celltransformation by SRC and in ligand-induced receptor signalingthrough the EGF, PDGF, CSF-1 and ERBB2 receptors Promotes GLIS2C-terminal cleavage | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKF SDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGP DGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEER YRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRS YEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKV KTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLS SHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIF IVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPA NDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLT NEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQ GIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSD KKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQV SYPSMQKI | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| TRG_NES_CRM1_1 | 942-ESLEEELDVLVLDDE-956 | NES Nuclear Export Signal | ([DEQ].{0,1}[LIM].{2,3}[LIVMF][^P]{2,3}[LMVF].[LMIV].{0,3}[DE])|([DE].{0,1}[LIM].{2,3}[LIVMF][^P]{2,3}[LMVF].[LMIV].{0,3}[DEQ]) |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0005102 | F:signaling receptor binding |
| GO:0005634 | C:nucleus |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0005886 | C:plasma membrane |
| GO:0005911 | C:cell-cell junction |
| GO:0005915 | C:zonula adherens |
| GO:0006351 | P:transcription |
| GO:0006355 | DNA-templated |
| GO:0007155 | P:regulation of transcription |
| GO:0007420 | DNA-templated |
| GO:0016055 | P:cell adhesion |
| GO:0019901 | P:brain development |
| GO:0030027 | P:Wnt signaling pathway |
| GO:0030426 | F:protein kinase binding |
| GO:0030496 | C:lamellipodium |
| GO:0034332 | C:growth cone |
| GO:0035635 | C:midbody |
| GO:0043197 | P:adherens junction organization |
| GO:0045296 | P:entry of bacterium into host cell |
| GO:0070062 | C:dendritic spine |
| GO:0090090 | F:cadherin binding |
| GO:0098609 | C:extracellular exosome |
| GO:0098685 | P:negative regulation of canonical Wnt signaling pathway |
| GO:0098686 | P:cell-cell adhesion |
| GO:0098831 | C:Schaffer collateral - CA1 synapse |
| GO:0098978 | C:hippocampal mossy fiber to CA3 synapse |
| GO:0099072 | C:presynaptic active zone cytoplasmic component |
| GO:0099092 | C:glutamatergic synapse |
CTNND1 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in CTNND1 (O60716) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PTPRM | P28827 | NA | In vitro and in vivo | 10753936, | Europe PMC |  |
| PTPRK | Q15262 | Tyr-228_GGSDNyGSLSR, Tyr-904_SLDNNySTPNE, | In vitro and in vivo | 30924770, | Europe PMC | |
| PTPRJ | Q12913 | NA | In vitro | 12370829, | Europe PMC | |
| PTPRT | O14522 | NA | In vitro | 16973135, | Europe PMC | |
| PTPN6 | P29350 | NA | In vivo | 10835420, | Europe PMC | |
| PTPN1 | P18031 | NA | In vitro | 18515860, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04015 | Rap1 signaling pathway | Rap1 is a small GTPase that controls diverse processes, such as cell adhesion, cell-cell junction formation and cell polarity. Like all G proteins, Rap1 cycles between an inactive GDP-bound and an active GTP-bound conformation. A variety of extracellular signals control this cycle through the regulation of several unique guanine nucleotide exchange factors (GEFs) and GTPase activating proteins (GAPs). Rap1 plays a dominant role in the control of cell-cell and cell-matrix interactions by regulating the function of integrins and other adhesion molecules in various cell types. Rap1 also regulates MAP kinase (MAPK) activity in a manner highly dependent on the context of cell types. |
| hsa04520 | Adherens junction | Cell-cell adherens junctions (AJs), the most common type of intercellular adhesions, are important for maintaining tissue architecture and cell polarity and can limit cell movement and proliferation. At AJs, E-cadherin serves as an essential cell adhesion molecules (CAMs). The cytoplasmic tail binds beta-catenin, which in turn binds alpha-catenin. Alpha-catenin is associated with F-actin bundles directly and indirectly. The integrity of the cadherin-catenin complex is negatively regulated by phosphorylation of beta-catenin by receptor tyrosine kinases (RTKs) and cytoplasmic tyrosine kinases (Fer, Fyn, Yes, and Src), which leads to dissociation of the cadherin-catenin complex. Integrity of this complex is positively regulated by beta -catenin phosphorylation by casein kinase II, and dephosphorylation by protein tyrosine phosphatases. Changes in the phosphorylation state of beta-catenin affect cell-cell adhesion, cell migration and the level of signaling beta-catenin. Wnt signaling acts as a positive regulator of beta-catenin by inhibiting beta-catenin degradation, which stabilizes beta-catenin, and causes its accumulation. Cadherin may acts as a negative regulator of signaling beta-catenin as it binds beta-catenin at the cell surface and thereby sequesters it from the nucleus. Nectins also function as CAMs at AJs, but are more highly concentrated at AJs than E-cadherin. Nectins transduce signals through Cdc42 and Rac, which reorganize the actin cytoskeleton, regulate the formation of AJs, and strengthen cell-cell adhesion. |
| hsa04670 | Leukocyte transendothelial migration | Leukocyte migaration from the blood into tissues is vital for immune surveillance and inflammation. During this diapedesis of leukocytes, the leukocytes bind to endothelial cell adhesion molecules (CAM) and then migrate across the vascular endothelium. A leukocyte adherent to CAMs on the endothelial cells moves forward by leading-edge protrusion and retraction of its tail. In this process, alphaL /beta2 integrin activates through Vav1, RhoA, which subsequently activates the kinase p160ROCK. ROCK activation leads to MLC phosphorylation, resulting in retraction of the actin cytoskeleton. Moreover, Leukocytes activate endothelial cell signals that stimulate endothelial cell retraction during localized dissociation of the endothelial cell junctions. ICAM-1-mediated signals activate an endothelial cell calcium flux and PKC, which are required for ICAM-1 dependent leukocyte migration. VCAM-1 is involved in the opening of the endothelial passagethrough which leukocytes can extravasate. In this regard, VCAM-1 ligation induces NADPH oxidase activation and the production of reactive oxygen species (ROS) in a Rac-mediated manner, with subsequent activation of matrix metallopoteinases and loss of VE-cadherin-mediated adhesion. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-418990 | Adherens junctions interactions. | The adherens junctions (AJ) are multiprotein complexes that promote homotypic cell adhesion in nearly all types of tissue by linking membrane and cytoskeletal components at discrete contact regions (reviewed in Hartsock & Nelson 2008; Gumbiner 2005; Ebnet, 2008). The molecular constituents of adherens junctions form adhesive units which are organized into higher order junctional adhesions that create a zipper-like seal between adjacent cells. Junctional adhesions function in epithelial cell polarization and in the coupling of cytoskeletons in adjacent cells that allow coordinated movements. During embryonic development, AJs function in specifying adhesion between cells and contribute in the sorting of different cell types. AJs also regulate cell polarity and shape, promote cell-cell communication and help mediate contact inhibition of cell growth. This module covers transdimerization events involving AJ transmembrane proteins (cadherins and nectins) (Gumbiner 2005; Ebnet 2008; Hartsock & Nelson 2008) |
| R-HSA-5218920 | VEGFR2 mediated vascular permeability. | The free radical nitric oxide (NO), produced by endothelial NO synthase (eNOS), is an important vasoactive substance in normal vascular biology and pathophysiology. It plays an important role in vascular functions such as vascular dilation and angiogenesis (Murohara et al. 1998, Ziche at al. 1997). NO has been reported to be a downstream mediator in the angiogenic response mediated by VEGF, but the mechanism by which NO promotes neovessel formation is not clear (Babaei & Stewart 2002). Persistent vasodilation and increase in vascular permeability in the existing vasculature is observed during the early steps of angiogenesis, suggesting that these hemodynamic changes are indispensable during an angiogenic processes. NO production by VEGF can occur either through the activation of PI3K or through a PLC-gamma dependent manner. Once activated both pathways converge on AKT phosphorylation of eNOS, releasing NO (Lin & Sessa 2006). VEGF also regulates vascular permeability by promoting VE-cadherin endocytosis at the cell surface through a VEGFR-2-Src-Vav2-Rac-PAK signalling axis |
| R-HSA-8876493 | InlA-mediated entry of Listeria monocytogenes into host cells. | The pathogenic bacteria Listeria monocytogenes can enter host cells through endocytosis triggered by binding of the bacterial cell wall protein internalin (InlA) to the E-cadherin (CDH1) complex at the host cell plasma membrane (Mengaud et al. 1996, Lecuit et al. 1999). Binding of InlA to CDH1, similar to CDH1 engagement during normal cell-to-cell adhesion, triggers activation of the SRC protein tyrosine kinase and phosphorylation of CDH1 and CDH1-bound beta-catenin (CTNNB1) (Fujita et al. 2002, McLachlan et al. 2007, Sousa et al. 2007, Bonazzi et al. 2008). Integrins likely contribute to CDH1-triggered SRC activation, and ERKs (MAPK1 and MAPK3), ROCKs and MLCK may also be involved (Avizienyte et al. 2002, Avizienyte et al. 2004, Martinez-Rico et al. 2010). FAK1 (PTK2), a SRC-regulated protein tyrosine kinase, may contribute to SRC-mediated regulation of CDH1 (Avizienyte et al. 2002).Phosphorylation of CDH1 and CTNNB1 by SRC creates docking sites for a CBL-like ubiquitin protein ligase Hakai (CBLL1). CBLL1 ubiquitinates SRC-phosphorylated CDH1 and CTNNB1 upon InlA binding, as well as in the context of CDH1-mediated cell-to-cell adhesion, thus triggering CDH1 endocytosis (Fujita et al. 2002, Bonazzi et al. 2008, Mukherjee et al. 2012).CBLL1 may also undergo SRC-mediated phosphorylation and subsequent autoubiquitination (Fujita et al. 2002).Both clathrin-mediated and caveolin-mediated endocytosis are implicated in the InlA-mediated entry of Listeria monocytogenes to host cells (Veiga et al. 2007). SRC-mediated phosphorylation of cortactin and the ARP2/3 complex involved in actin polymerization is implicated in CDH1 endocytosis and Listeria monocytogenes internalization (Sousa et al. 2007, Ren et al. 2009) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AP2M1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| APP | Reconstituted Complex | physical | 21244100, 21832049, (Europe PMC) | NA | BioGRID |
| ARRB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17620599, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATP4A | Affinity Capture-MS | physical | 17255364, (Europe PMC) | NA | BioGRID |
| AURKA | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| BMI1 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| BTRC | Affinity Capture-Western | physical | 27316454, (Europe PMC) | NA | BioGRID |
| CCDC8 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CDC5L | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CDH1 | Affinity Capture-Western, Co-crystal Structure, Co-localization, FRET, Proximity Label-MS, Reconstituted Complex, Two-hybrid, fluorescence microscopy, proximity ligation assay, x-ray crystallography | colocalization, direct interaction, physical, physical association | 10409703, 12427869, 12640114, 12707304, 19711372, 20371349, 21670201, 22715382, 22752307, 22850631, 23180380, 24424122, 25468996, 7542250, 7651399, 7876318, 9535896, (Europe PMC) | 0.27, 0.40, 0.44 | BioGRID, IntAct |
| CDH2 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 12604612, 14625392, 20371349, 21357690, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CDH3 | Affinity Capture-Western | physical | 23180380, 8660921, (Europe PMC) | NA | BioGRID |
| CDH5 | Affinity Capture-MS, Affinity Capture-Western | physical | 11855855, 28514442, 9378757, (Europe PMC) | NA | BioGRID |
| CDH8 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CEP135 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| COL17A1 | Reconstituted Complex, Two-hybrid | physical | 10321838, (Europe PMC) | NA | BioGRID |
| CSNK1E | Affinity Capture-Western | physical | 21670201, (Europe PMC) | NA | BioGRID |
| CTDSPL | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CTNNA1 | Affinity Capture-Western | physical | 7651399, (Europe PMC) | NA | BioGRID |
| CTNNA3 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CTNNB1 | Affinity Capture-Western | physical | 11712088, 9535896, (Europe PMC) | NA | BioGRID |
| CTTN | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 12835311, 17576929, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, tandem affinity purification, ubiquitin reconstruction | association, physical, physical association | 15657067, 24189400, 24658140, 24797263, 25402006, 27316454, 9535896, (Europe PMC) | 0.66 | BioGRID, IntAct |
| ERBIN | Reconstituted Complex | physical | 11821434, (Europe PMC) | NA | BioGRID |
| FOXB1 | Affinity Capture-MS, tandem affinity purification | association, physical | 25609649, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| FYN | Affinity Capture-Western, Biochemical Activity | physical | 12640114, 12835311, (Europe PMC) | NA | BioGRID |
| G3BP1 | Affinity Capture-MS | physical | 26777405, (Europe PMC) | NA | BioGRID |
| GSK3B | Affinity Capture-Western | physical | 28069439, (Europe PMC) | NA | BioGRID |
| HNRNPL | Affinity Capture-RNA | physical | 28611215, (Europe PMC) | NA | BioGRID |
| IFI16 | Affinity Capture-MS | physical | 25693804, (Europe PMC) | NA | BioGRID |
| KCTD6 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.49, 0.56 | BioGRID, IntAct |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| LCK | Biochemical Activity | physical | 12835311, (Europe PMC) | NA | BioGRID |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MTMR7 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| MUC1 | Affinity Capture-Western, Co-localization, Reconstituted Complex | physical | 11181067, (Europe PMC) | NA | BioGRID |
| MYC | Affinity Capture-MS, tandem affinity purification | association, physical | 21150319, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NXF1 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| OTUB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26752685, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PLPP3 | Affinity Capture-Western, Far Western, Reconstituted Complex | physical | 20123964, (Europe PMC) | NA | BioGRID |
| PPP4R1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSEN1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 10208590, 28069439, (Europe PMC) | NA | BioGRID |
| PTPN6 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex | physical | 10835420, (Europe PMC) | NA | BioGRID |
| PTPRJ | Affinity Capture-Western, Biochemical Activity, biochemical, coimmunoprecipitation, fluorescence technology, pull down | colocalization, dephosphorylation reaction, physical, physical association | 12370829, 12475979, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| PTPRM | Affinity Capture-Western, Biochemical Activity | physical | 10753936, (Europe PMC) | NA | BioGRID |
| RIPK3 | Affinity Capture-MS | physical | 21903422, (Europe PMC) | NA | BioGRID |
| SNCA | Reconstituted Complex | physical | 18541383, (Europe PMC) | NA | BioGRID |
| SOX2 | Affinity Capture-MS | physical | 23667531, (Europe PMC) | NA | BioGRID |
| SQSTM1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SRC | Affinity Capture-Western | physical | 12640114, (Europe PMC) | NA | BioGRID |
| SUMO2 | Reconstituted Complex | physical | 19394292, (Europe PMC) | NA | BioGRID |
| TMEM17 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TMEM216 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VCP | Affinity Capture-MS | physical | 23383273, (Europe PMC) | NA | BioGRID |
| WDR48 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| YES1 | Affinity Capture-Western | physical | 12640114, (Europe PMC) | NA | BioGRID |
| ZBTB33 | Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach | physical, physical association | 10207085, 15548582, 15564377, 19615783, 20382170, 21670201, 22276175, 24498333, (Europe PMC) | 0.40, 0.49 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AP2M1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARRB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17620599, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CAMK2D | anti tag coimmunoprecipitation | association | 29426014, (Europe PMC) | 0.35 | IntAct |
| CDC5L | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CDH1 | Affinity Capture-Western, Co-crystal Structure, Co-localization, FRET, Proximity Label-MS, Reconstituted Complex, Two-hybrid, fluorescence microscopy, proximity ligation assay, x-ray crystallography | colocalization, direct interaction, physical, physical association | 10409703, 12427869, 12640114, 12707304, 19711372, 20371349, 21670201, 22715382, 22752307, 22850631, 23180380, 24424122, 25468996, 7542250, 7651399, 7876318, 9535896, (Europe PMC) | 0.27, 0.40, 0.44 | BioGRID, IntAct |
| CDH2 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 12604612, 14625392, 20371349, 21357690, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CEP135 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CTTN | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 12835311, 17576929, (Europe PMC) | 0.40 | BioGRID, IntAct |
| EGFR | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, tandem affinity purification, ubiquitin reconstruction | association, physical, physical association | 15657067, 24189400, 24658140, 24797263, 25402006, 27316454, 9535896, (Europe PMC) | 0.66 | BioGRID, IntAct |
| EZR | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| FOXB1 | Affinity Capture-MS, tandem affinity purification | association, physical | 25609649, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| FRMD5 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy | association, colocalization, physical association | 22846708, (Europe PMC) | 0.54 | IntAct, MINT |
| HSCB | anti bait coimmunoprecipitation | association | 28380382, (Europe PMC) | 0.35 | IntAct |
| KCTD6 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.49, 0.56 | BioGRID, IntAct |
| KSR1 | anti tag coimmunoprecipitation | association | 27086506, (Europe PMC) | 0.35 | IntAct |
| LAMP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MCM7 | anti bait coimmunoprecipitation | association | 23764002, (Europe PMC) | 0.35 | IntAct |
| MTNR1B | tandem affinity purification | association | 26514267, (Europe PMC) | 0.35 | IntAct |
| MYC | Affinity Capture-MS, tandem affinity purification | association, physical | 21150319, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NANOS1 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | physical association | 17047063, (Europe PMC) | 0.40, 0.52 | IntAct |
| OTUB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26752685, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PABPC1 | anti bait coimmunoprecipitation, confocal microscopy | association, colocalization | 28877994, (Europe PMC) | 0.43 | IntAct |
| PLEKHA7 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, proximity ligation assay | association, colocalization, physical association | 19041755, 28877994, (Europe PMC) | 0.35, 0.66 | IntAct |
| PLPP3 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, far western blotting, pull down | colocalization, physical association | 20123964, (Europe PMC) | 0.64 | IntAct |
| PPP4R1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PTPRJ | Affinity Capture-Western, Biochemical Activity, biochemical, coimmunoprecipitation, fluorescence technology, pull down | colocalization, dephosphorylation reaction, physical, physical association | 12370829, 12475979, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| RET | anti bait coimmunoprecipitation | physical association | 21357690, (Europe PMC) | 0.40 | IntAct |
| SQSTM1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TARBP2 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| TGOLN2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TMEM17 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TMEM216 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TNRC6A | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| TUBA1A | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| TUBB3 | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| WDR48 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| WRAP73 | anti tag coimmunoprecipitation | association | 26545777, (Europe PMC) | 0.35 | IntAct |
| YAP1 | anti bait coimmunoprecipitation | association | 21376238, (Europe PMC) | 0.35 | IntAct |
| ZBTB33 | Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach | physical, physical association | 10207085, 15548582, 15564377, 19615783, 20382170, 21670201, 22276175, 24498333, (Europe PMC) | 0.40, 0.49 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| FOXB1 | Affinity Capture-MS, tandem affinity purification | association, physical | 25609649, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| FRMD5 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy | association, colocalization, physical association | 22846708, (Europe PMC) | 0.54 | IntAct, MINT |
| PTPRJ | Affinity Capture-Western, Biochemical Activity, biochemical, coimmunoprecipitation, fluorescence technology, pull down | colocalization, dephosphorylation reaction, physical, physical association | 12370829, 12475979, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AGO2 | anti bait coimmunoprecipitation, confocal microscopy | association, colocalization | 28877994, (Europe PMC) | 0.43 | IntAct |
| AP2M1 | Affinity Capture-MS, tandem affinity purification | association, physical | 24189400, (Europe PMC) | 0.35 | BioGRID, IntAct |
| APP | Reconstituted Complex | physical | 21244100, 21832049, (Europe PMC) | NA | BioGRID |
| ARRB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17620599, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATP4A | Affinity Capture-MS | physical | 17255364, (Europe PMC) | NA | BioGRID |
| AURKA | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| BMI1 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| BTRC | Affinity Capture-Western | physical | 27316454, (Europe PMC) | NA | BioGRID |
| CAMK2D | anti tag coimmunoprecipitation | association | 29426014, (Europe PMC) | 0.35 | IntAct |
| CCDC8 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CDC5L | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CDH1 | Affinity Capture-Western, Co-crystal Structure, Co-localization, FRET, Proximity Label-MS, Reconstituted Complex, Two-hybrid, fluorescence microscopy, proximity ligation assay, x-ray crystallography | colocalization, direct interaction, physical, physical association | 10409703, 12427869, 12640114, 12707304, 19711372, 20371349, 21670201, 22715382, 22752307, 22850631, 23180380, 24424122, 25468996, 7542250, 7651399, 7876318, 9535896, (Europe PMC) | 0.27, 0.40, 0.44 | BioGRID, IntAct |
| CDH2 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 12604612, 14625392, 20371349, 21357690, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CDH3 | Affinity Capture-Western | physical | 23180380, 8660921, (Europe PMC) | NA | BioGRID |
| CDH5 | Affinity Capture-MS, Affinity Capture-Western | physical | 11855855, 28514442, 9378757, (Europe PMC) | NA | BioGRID |
| CDH8 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CEP135 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| COL17A1 | Reconstituted Complex, Two-hybrid | physical | 10321838, (Europe PMC) | NA | BioGRID |
| CSNK1E | Affinity Capture-Western | physical | 21670201, (Europe PMC) | NA | BioGRID |
| CTDSPL | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CTNNA1 | Affinity Capture-Western | physical | 7651399, (Europe PMC) | NA | BioGRID |
| CTNNA3 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CTNNB1 | Affinity Capture-Western | physical | 11712088, 9535896, (Europe PMC) | NA | BioGRID |
| CTTN | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 12835311, 17576929, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| EGFR | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, tandem affinity purification, ubiquitin reconstruction | association, physical, physical association | 15657067, 24189400, 24658140, 24797263, 25402006, 27316454, 9535896, (Europe PMC) | 0.66 | BioGRID, IntAct |
| ERBIN | Reconstituted Complex | physical | 11821434, (Europe PMC) | NA | BioGRID |
| EZR | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| FOXB1 | Affinity Capture-MS, tandem affinity purification | association, physical | 25609649, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| FRMD5 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy | association, colocalization, physical association | 22846708, (Europe PMC) | 0.54 | IntAct, MINT |
| FYN | Affinity Capture-Western, Biochemical Activity | physical | 12640114, 12835311, (Europe PMC) | NA | BioGRID |
| G3BP1 | Affinity Capture-MS | physical | 26777405, (Europe PMC) | NA | BioGRID |
| GSK3B | Affinity Capture-Western | physical | 28069439, (Europe PMC) | NA | BioGRID |
| HNRNPL | Affinity Capture-RNA | physical | 28611215, (Europe PMC) | NA | BioGRID |
| HSCB | anti bait coimmunoprecipitation | association | 28380382, (Europe PMC) | 0.35 | IntAct |
| IFI16 | Affinity Capture-MS | physical | 25693804, (Europe PMC) | NA | BioGRID |
| KCTD6 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.49, 0.56 | BioGRID, IntAct |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KSR1 | anti tag coimmunoprecipitation | association | 27086506, (Europe PMC) | 0.35 | IntAct |
| LAMP1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| LCK | Biochemical Activity | physical | 12835311, (Europe PMC) | NA | BioGRID |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MCM7 | anti bait coimmunoprecipitation | association | 23764002, (Europe PMC) | 0.35 | IntAct |
| MTMR7 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| MTNR1B | tandem affinity purification | association | 26514267, (Europe PMC) | 0.35 | IntAct |
| MUC1 | Affinity Capture-Western, Co-localization, Reconstituted Complex | physical | 11181067, (Europe PMC) | NA | BioGRID |
| MYC | Affinity Capture-MS, tandem affinity purification | association, physical | 21150319, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NANOS1 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | physical association | 17047063, (Europe PMC) | 0.40, 0.52 | IntAct |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NXF1 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| OTUB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26752685, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PABPC1 | anti bait coimmunoprecipitation, confocal microscopy | association, colocalization | 28877994, (Europe PMC) | 0.43 | IntAct |
| PLEKHA7 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, proximity ligation assay | association, colocalization, physical association | 19041755, 28877994, (Europe PMC) | 0.35, 0.66 | IntAct |
| PLPP3 | Affinity Capture-Western, Far Western, Reconstituted Complex | physical | 20123964, (Europe PMC) | NA | BioGRID |
| PLPP3 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, far western blotting, pull down | colocalization, physical association | 20123964, (Europe PMC) | 0.64 | IntAct |
| PPP4R1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSEN1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 10208590, 28069439, (Europe PMC) | NA | BioGRID |
| PTPN6 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex | physical | 10835420, (Europe PMC) | NA | BioGRID |
| PTPRJ | Affinity Capture-Western, Biochemical Activity, biochemical, coimmunoprecipitation, fluorescence technology, pull down | colocalization, dephosphorylation reaction, physical, physical association | 12370829, 12475979, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| PTPRM | Affinity Capture-Western, Biochemical Activity | physical | 10753936, (Europe PMC) | NA | BioGRID |
| RET | anti bait coimmunoprecipitation | physical association | 21357690, (Europe PMC) | 0.40 | IntAct |
| RIPK3 | Affinity Capture-MS | physical | 21903422, (Europe PMC) | NA | BioGRID |
| SNCA | Reconstituted Complex | physical | 18541383, (Europe PMC) | NA | BioGRID |
| SOX2 | Affinity Capture-MS | physical | 23667531, (Europe PMC) | NA | BioGRID |
| SQSTM1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SRC | Affinity Capture-Western | physical | 12640114, (Europe PMC) | NA | BioGRID |
| SUMO2 | Reconstituted Complex | physical | 19394292, (Europe PMC) | NA | BioGRID |
| TARBP2 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| TGOLN2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TMEM17 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TMEM216 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TNRC6A | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| TUBA1A | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| TUBB3 | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| VCP | Affinity Capture-MS | physical | 23383273, (Europe PMC) | NA | BioGRID |
| WDR48 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| WRAP73 | anti tag coimmunoprecipitation | association | 26545777, (Europe PMC) | 0.35 | IntAct |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| YAP1 | anti bait coimmunoprecipitation | association | 21376238, (Europe PMC) | 0.35 | IntAct |
| YES1 | Affinity Capture-Western | physical | 12640114, (Europe PMC) | NA | BioGRID |
| ZBTB33 | Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach | physical, physical association | 10207085, 15548582, 15564377, 19615783, 20382170, 21670201, 22276175, 24498333, (Europe PMC) | 0.40, 0.49 | BioGRID, IntAct |