- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
CDC25A
Gene Name  | CDC25A (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 1C25 |
| Synonyms | CDC25A | |
| Protein Name | CDC25A | |
| Alternative Name(s) | M-phase inducer phosphatase 1;3.1.3.48;Dual specificity phosphatase Cdc25A; | |
| Protein Family | Belongs to the MPI phosphatase family | |
| EntrezGene ID | 993 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P30304 (protein sequence) | |
| Enzyme Class | 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 59087 Dalton | |
| Protein Length | 524 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000164045 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG3772 | eggNOG - COG5105 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | N/A | ||
| Function (UniProt annotation) | |||
| Tyrosine protein phosphatase which functions as adosage-dependent inducer of mitotic progression Directlydephosphorylates CDK1 and stimulates its kinase activity Alsodephosphorylates CDK2 in complex with cyclin E, in vitro | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate | |||
| Protein Sequence | |||
| MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYEQPLEVKNNSNLQRMGSSEST DSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALKRSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCL HSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASL WTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPKESTNPEKAHETLHQSLSLAS SPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYISPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAV NLHMEEEVEDFLLKKPIVPTDGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| DOC_CYCLIN_1 | 11-RRLLF-15 | Cyclin recognition site | [RK].L.{0,1}[FYLIVMP] | MOD_CDK_SPxxK_3 | 113-LGCSPALK-120 | CDK Phosphorylation Site | ...([ST])P..[RK] |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000079 | P:regulation of cyclin-dependent protein serine/threonine kinase activity |
| GO:0000082 | P:G1/S transition of mitotic cell cycle |
| GO:0000086 | P:G2/M transition of mitotic cell cycle |
| GO:0004721 | F:phosphoprotein phosphatase activity |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0005654 | C:nucleoplasm |
| GO:0005829 | C:cytosol |
| GO:0008283 | P:cell proliferation |
| GO:0009314 | P:response to radiation |
| GO:0016579 | P:protein deubiquitination |
| GO:0019901 | F:protein kinase binding |
| GO:0034644 | P:cellular response to UV |
| GO:0051087 | F:chaperone binding |
| GO:0051301 | P:cell division |
| GO:0051726 | P:regulation of cell cycle |
| GO:1902751 | P:positive regulation of cell cycle G2/M phase transition |
CDC25A is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in CDC25A (P30304) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| CDC14B | O60729 | NA | In vitro and in vivo | 21379580, | Europe PMC |  |
| CDC14A | Q9UNH5 | Ser-116_KLLGCsPALKR,, Ser-321 _LSLASsPKGTI, | In vitro | 17172867, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04110 | Cell cycle | Mitotic cell cycle progression is accomplished through a reproducible sequence of events, DNA replication (S phase) and mitosis (M phase) separated temporally by gaps known as G1 and G2 phases. Cyclin-dependent kinases (CDKs) are key regulatory enzymes, each consisting of a catalytic CDK subunit and an activating cyclin subunit. CDKs regulate the cell's progression through the phases of the cell cycle by modulating the activity of key substrates. Downstream targets of CDKs include transcription factor E2F and its regulator Rb. Precise activation and inactivation of CDKs at specific points in the cell cycle are required for orderly cell division. Cyclin-CDK inhibitors (CKIs), such as p16Ink4a, p15Ink4b, p27Kip1, and p21Cip1, are involved in the negative regulation of CDK activities, thus providing a pathway through which the cell cycle is negatively regulated.Eukaryotic cells respond to DNA damage by activating signaling pathways that promote cell cycle arrest and DNA repair. In response to DNA damage, the checkpoint kinase ATM phosphorylates and activates Chk2, which in turn directly phosphorylates and activates p53 tumor suppressor protein. p53 and its transcriptional targets play an important role in both G1 and G2 checkpoints. ATR-Chk1-mediated protein degradation of Cdc25A protein phosphatase is also a mechanism conferring intra-S-phase checkpoint activation. |
| hsa04218 | Cellular senescence | Cellular senescence is a state of irreversible cellular arrest and can be triggered by a number of factors, such as telomere shortening, oncogene activation, irradiation, DNA damage and oxidative stress. It is characterized by enlarged flattened morphology, senescence-associated beta-galactosidase (SA-b-gal) activity, secretion of inflammatory cytokines, growth factors and matrix metalloproteinases, as part of the senescence-associated secretory phenotype (SASP). Cellular senescence is functionally associated with many biological processes including aging, tumor suppression, placental biology, embryonic development, and wound healing. |
| hsa04914 | Progesterone-mediated oocyte maturation | Xenopus oocytes are naturally arrested at G2 of meiosis I. Exposure to either insulin/IGF-1 or the steroid hormone progesterone breaks this arrest and induces resumption of the two meiotic division cycles and maturation of the oocyte into a mature, fertilizable egg. This process is termed oocyte maturation. The transition is accompanied by an increase in maturation promoting factor (MPF or Cdc2/cyclin B) which precedes germinal vesicle breakdown (GVBD). Most reports point towards the Mos-MEK1-ERK2 pathway [where ERK is an extracellular signal-related protein kinase, MEK is a MAPK/ERK kinase and Mos is a p42(MAPK) activator] and the polo-like kinase/CDC25 pathway as responsible for the activation of MPF in meiosis, most likely triggered by a decrease in cAMP. |
| hsa05206 | MicroRNAs in cancer | MicroRNA (miRNA) is a cluster of small non-encoding RNA molecules of 21 - 23 nucleotides in length, which controls gene expression post-transcriptionally either via the degradation of target mRNAs or the inhibition of protein translation. Using high-throughput profiling, dysregulation of miRNAs has been widely observed in different stages of cancer. The upregulation (overexpression) of specific miRNAs could lead to the repression of tumor suppressor gene expression, and conversely the downregulation of specific miRNAs could result in an increase of oncogene expression; both these situations induce subsequent malignant effects on cell proliferation, differentiation, and apoptosis that lead to tumor growth and progress. The miRNA signatures of cancer observed in various studies differ significantly. These inconsistencies occur due to the differences in the study populations and methodologies used. This pathway map shows the summarized results from various studies in 9 cancers, each of which is presented in a review article. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-1362277 | Transcription of E2F targets under negative control by DREAM complex. | DREAM complex is evolutionarily conserved and is reponsible for transcriptional repressession of cell cycle-regulated genes in G0 and early G1 |
| R-HSA-156711 | Polo-like kinase mediated events. | At mitotic entry, Plk1 phosphorylates and activates Cdc25C phosphatase, whereas it phosphorylates and down-regulates Wee1A (Watanabe et al. 2004). Plk1 also phosphorylates and inhibits Myt1 activity (Sagata 2005). Cyclin B1-bound Cdc2, which is the target of Cdc25C, Wee1A, and Myt1, functions in a feedback loop and phosphorylates the latter components (Cdc25C, Wee1A, Myt1). The Cdc2- dependent phosphorylation provides docking sites for the polo-box domain of Plk1, thus promoting the Plk1-dependent regulation of these components and, as a result, activation of Cdc2-Cyclin B1. PLK1 phosphorylates and activates the transcription factor FOXM1 which stimulates the expression of a number of genes needed for G2/M transition, including PLK1, thereby creating a positive feedback loop (Laoukili et al. 2005, Fu et al. 2008, Sadasivam et al. 2012, Chen et al. 2013) |
| R-HSA-176187 | Activation of ATR in response to replication stress. | Genotoxic stress caused by DNA damage or stalled replication forks can lead to genomic instability. To guard against such instability, genotoxically-stressed cells activate checkpoint factors that halt or slow cell cycle progression. Among the pathways affected are DNA replication by reduction of replication origin firing, and mitosis by inhibiting activation of cyclin-dependent kinases (Cdks). A key factor involved in the response to stalled replication forks is the ATM- and rad3-related (ATR) kinase, a member of the phosphoinositide-3-kinase-related kinase (PIKK) family. Rather than responding to particular lesions in DNA, ATR and its binding partner ATRIP (ATR-interacting protein) sense replication fork stalling indirectly by associating with persistent ssDNA bound by RPA. These structures would be formed, for example, by dissociation of the replicative helicase from the leading or lagging strand DNA polymerase when the polymerase encounters a DNA lesion that blocks DNA synthesis. Along with phosphorylating the downstream transducer kinase Chk1 and the tumor suppressor p53, activated ATR modifies numerous factors that regulate cell cycle progression or the repair of DNA damage. The persistent ssDNA also stimulates recruitment of the RFC-like Rad17-Rfc2-5 alternative clamp-loading complex, which subsequently loads the Rad9-Hus1-Rad1 complex onto the DNA. The latter '9-1-1' complex serves to facilitate Chk1 binding to the stalled replication fork, where Chk1 is phosphorylated by ATR and thereby activated. Upon activation, Chk1 can phosphorylate additional substrates including the Cdc25 family of phosphatases (Cdc25A, Cdc25B, and Cdc25C). These enzymes catalyze the removal of inhibitory phosphate residues from cyclin-dependent kinases (Cdks), allowing their activation. In particular, Cdc25A primarily functions at the G1/S transition to dephosphorylate Cdk2 at Thr 14 and Tyr 15, thus positively regulating the Cdk2-cyclin E complex for S-phase entry. Cdc25A also has mitotic functions. Phosphorylation of Cdc25A at Ser125 by Chk1 leads to Cdc25A ubiquitination and degradation, thus inhibiting DNA replication origin firing. In contrast, Cdc25B and Cdc25C regulate the onset of mitosis through dephosphorylation and activation of Cdk1-cyclin B complexes. In response to replication stress, Chk1 phosphorylates Cdc25B and Cdc25C leading to Cdc25B/C complex formation with 14-3-3 proteins. As these complexes are sequestered in the cytoplasm, they are unable to activate the nuclear Cdk1-cyclin B complex for mitotic entry. These events are outlined in the figure. Persistent single-stranded DNA associated with RPA binds claspin (A) and ATR:ATRIP (B), leading to claspin phosphorylation (C). In parallel, the same single-stranded DNA:RPA complex binds RAD17:RFC (D), enabling the loading of RAD9:HUS1:RAD1 (9-1-1) complex onto the DNA (E). The resulting complex of proteins can then repeatedly bind (F) and phosphorylate (G) CHK1, activating multiple copies of CHK1 |
| R-HSA-5689880 | Ub-specific processing proteases. | Ub-specific processing proteases (USPs) are the largest of the DUB families with more than 50 members in humans. The USP catalytic domain varies considerably in size and consists of six conserved motifs with N- or C-terminal extensions and insertions occurring between the conserved motifs (Ye et al. 2009). Two highly conserved regions comprise the catalytic triad, the Cys-box (Cys) and His-box (His and Asp/Asn) (Nijman et al. 2005, Ye et al. 2009, Reyes-Turcu & Wilkinson 2009). They recognize their substrates by interactions of the variable regions with the substrate protein directly, or via scaffolds or adapters in multiprotein complexes |
| R-HSA-69202 | Cyclin E associated events during G1/S transition. | The transition from the G1 to S phase is controlled by the Cyclin E:Cdk2 complexes. As the Cyclin E:Cdk2 complexes are formed, the Cdk2 is phosphorylated by the Wee1 and Myt1 kinases. This phosphorylation keeps the Cdk2 inactive. In yeast this control is called the cell size checkpoint control. The dephosphorylation of the Cdk2 by Cdc25A activates the Cdk2, and is coordinated with the cells reaching the proper size, and with the DNA synthesis machinery being ready. The Cdk2 then phosphorylates G1/S specific proteins, including proteins required for DNA replication initiation. The beginning of S-phase is marked by the first nucleotide being laid down on the primer during DNA replication at the early-firing origins.Failure to appropriately regulate cyclin E accumulation can lead to accelerated S phase entry, genetic instability, and tumorigenesis. The amount of\n cyclin E protein in the cell is controlled by ubiquitin-mediated proteolysis (see Woo, 2003).This pathway has not yet been annotated in Reactome |
| R-HSA-69273 | Cyclin A/B1/B2 associated events during G2/M transition. | Cell cycle progression is regulated by cyclin-dependent protein kinases at both the G1/S and the G2/M transitions. The G2/M transition is regulated through the phosphorylation of nuclear lamins and histones (reviewed in Sefton, 2001).The two B-type cyclins localize to different regions within the cell and are thought to have specific roles as CDK1-activating subunits (see Bellanger et al., 2007). Cyclin B1 is primarily cytoplasmic during interphase and translocates into the nucleus at the onset of mitosis (Jackman et al., 1995; Hagting et al., 1999). Cyclin B2 colocalizes with the Golgi apparatus and contributes to its fragmentation during mitosis (Jackman et al., 1995; Draviam et al., 2001) |
| R-HSA-69601 | Ubiquitin Mediated Degradation of Phosphorylated Cdc25A. | cdc25A protein is degraded by the ubiquitin-proteasome machinery in both terminally differentiating and cycling cells (Bernardi et al. 2000) |
| R-HSA-69656 | Cyclin A:Cdk2-associated events at S phase entry. | Cyclin A:Cdk2 plays a key role in S phase entry by phosphorylation of proteins including Cdh1, Rb, p21 and p27. During G1 phase of the cell cycle, cyclin A is synthesized and associates with Cdk2. After forming in the cytoplasm, the Cyclin A:Cdk2 complexes are translocated to the nucleus (Jackman et al.,2002). Prior to S phase entry, the activity of Cyclin A:Cdk2 complexes is negatively regulated through Tyr 15 phosphorylation of Cdk2 (Gu et al., 1995) and also by the association of the cyclin kinase inhibitors (CKIs), p27 and p21. Phosphorylation of cyclin-dependent kinases (CDKs) by the CDK-activating kinase (CAK) is required for the activation of the CDK2 kinase activity (Aprelikova et al., 1995). The entry into S phase is promoted by the removal of inhibitory Tyr 15 phosphates from the Cdk2 subunit of Cyclin A:Cdk2 complex by the Cdc25 phosphatases (Blomberg and Hoffmann, 1999) and by SCF(Skp2)-mediated degradation of p27/p21 (see Ganoth et al., 2001). \r\nWhile Cdk2 is thought to play a primary role in regulating entry into S phase, recent evidence indicates that Cdk1 is equally capable of promoting entry into S phase and the initiation of DNA replication (see Bashir and Pagano, 2005). Thus, Cdk1 complexes may also play a significant role at this point in the cell cycle |
| R-HSA-8862803 | Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models. | Post-mitotic neurons do not have an active cell cycle. However, deregulation of Cyclin Dependent Kinase-5 (CDK5) activity in these neurons can aberrantly activate various components of cell cycle leading to neuronal death (Chang et al. 2012). Random activation of cell cycle proteins has been shown to play a key role in the pathogenesis of several neurodegenerative disorders (Yang et al. 2003, Lopes et al. 2009). CDK5 is not activated by the canonical cyclins, but binds to its own specific partners, CDK5R1 and CDK5R2 (aka p35 and p39, respectively) (Tsai et al. 1994, Tang et al. 1995). Expression of p35 is nearly ubiquitous, whereas p39 is largely expressed in the central nervous system. A variety of neurotoxic insults such as beta-amyloid (A-beta), ischemia, excitotoxicity and oxidative stress disrupt the intracellular calcium homeostasis in neurons, thereby leading to the activation of calpain, which cleaves p35 into p25 and p10 (Lee et al. 2000). p25 has a six-fold longer half-life compared to p35 and lacks the membrane anchoring signal, which results in its constitutive activation and mislocalization of the CDK5:p25 complex to the cytoplasm and the nucleus. There, CDK5:p25 is able to access and phosphorylate a variety of atypical targets, triggering a cascade of neurotoxic pathways that culminate in neuronal death. One such neurotoxic pathway involves CDK5-mediated random activation of cell cycle proteins which culminate in neuronal death. Exposure of primary cortical neurons to oligomeric beta-amyloid (1-42) hyper-activates CDK5 due to p25 formation, which in turn phosphorylates CDC25A, CDC25B and CDC25C. CDK5 phosphorylates CDC25A at S40, S116 and S261; CDC25B at S50, T69, S160, S321 and S470; and CDC25C at T48, T67, S122, T130, S168 and S214. CDK5-mediated phosphorylation of CDC25A, CDC25B and CDC25C not only increases their phosphatase activities but also facilitates their release from 14-3-3 inhibitory binding. CDC25A, CDC25B and CDC25C in turn activate CDK1, CDK2 and CDK4 kinases causing neuronal death. Consistent with this mechanism, higher CDC25A, CDC25B and CDC25C activities were observed in human Alzheimer's disease (AD) clinical samples, as compared to age-matched controls |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| APP | Reconstituted Complex | physical | 21832049, (Europe PMC) | NA | BioGRID |
| ATXN7L3B | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| BTRC | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex, anti tag coimmunoprecipitation, coimmunoprecipitation, experimental interaction detection, pull down | direct interaction, physical, physical association, ubiquitination reaction | 14603323, 14681206, 14752276, 15536641, 15798217, 16338364, 19477924, 19615732, 20348946, 25332235, 25900982, 26091241, 27880917, 28514442, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| CAMK1D | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCDC28A | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CCNA1 | Affinity Capture-MS, Affinity Capture-Western | physical | 10926775, 27432908, (Europe PMC) | NA | BioGRID |
| CCNA2 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CCNB1 | Affinity Capture-MS, Affinity Capture-Western, proximity ligation assay | physical, physical association | 1836978, 23397142, 27432908, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CCNE1 | Affinity Capture-Western, Reconstituted Complex | physical | 8617791, 9891079, (Europe PMC) | NA | BioGRID |
| CCNI | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCT8L1P | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDC20 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDC25A | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDK2 | Affinity Capture-MS, Biochemical Activity, Reconstituted Complex | physical | 16191191, 27432908, 8617791, (Europe PMC) | NA | BioGRID |
| CDK3 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDK5 | Biochemical Activity | physical | 22899714, (Europe PMC) | NA | BioGRID |
| CHEK1 | Affinity Capture-MS, Biochemical Activity, Reconstituted Complex, protein kinase assay | phosphorylation reaction, physical | 12399544, 12676583, 12759351, 12963847, 17292828, 18480045, 27432908, 9278511, (Europe PMC) | 0.44 | BioGRID, IntAct |
| CHEK2 | Biochemical Activity, Reconstituted Complex, coimmunoprecipitation | phosphorylation reaction, physical | 10724175, 11298456, 12676583, 12759351, 18480045, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| CSNK1A1 | Biochemical Activity | physical | 20348946, (Europe PMC) | NA | BioGRID |
| CUL1 | Affinity Capture-MS, Affinity Capture-Western | physical | 12234927, 14603323, 14681206, 14752276, 15536641, 27432908, (Europe PMC) | NA | BioGRID |
| CUL3 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DMD | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DNAJC10 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DUSP7 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DUSP8 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| EEF1A1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EGFR | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 11912208, (Europe PMC) | NA | BioGRID |
| FAM193B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FAM91A1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| FBXW11 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, coimmunoprecipitation, proximity-dependent biotin identification, pull down, tandem affinity purification | association, physical, physical association | 14603323, 14681206, 15798217, 16338364, 22017875, 25332235, 25515538, 25609649, 25900982, 27432908, 27880917, 28330616, 28514442, 29150431, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| FGF21 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FTH1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FZR1 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 12234927, 19477924, (Europe PMC) | NA | BioGRID |
| GOPC | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| GTF2I | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| HLA-C | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IL3RA | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IPO5 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| LMO2 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAP3K5 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 11416155, (Europe PMC) | NA | BioGRID |
| MAPK14 | Reconstituted Complex | physical | 12963847, (Europe PMC) | NA | BioGRID |
| MCM3AP | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MTAP | Two-hybrid | physical | 21988832, (Europe PMC) | NA | BioGRID |
| NAA10 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NFKBIB | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NFYA | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NPLOC4 | Affinity Capture-Western | physical | 24429874, (Europe PMC) | NA | BioGRID |
| NXF1 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| PEX19 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PIM1 | Affinity Capture-Western, Reconstituted Complex | physical | 10373478, (Europe PMC) | NA | BioGRID |
| PKM | Biochemical Activity, Reconstituted Complex, protein kinase assay | phosphorylation reaction, physical | 24606918, 27485204, (Europe PMC) | 0.44 | BioGRID, IntAct |
| POLR1D | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PTP4A1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| RAD23A | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| RAF1 | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 7644510, 7744247, 9230211, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ROCK1 | Biochemical Activity | physical | 14657354, (Europe PMC) | NA | BioGRID |
| SCYL1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SFN | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SKP1 | Affinity Capture-MS, Affinity Capture-Western, proximity-dependent biotin identification, pull down | association, physical | 12234927, 14603323, 14752276, 15536641, 27432908, 28330616, (Europe PMC) | 0.46 | BioGRID, IntAct |
| SMAD3 | Affinity Capture-Western, Two-hybrid, two hybrid array | physical, physical association | 15798217, 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SOX5 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SRC | Biochemical Activity | physical | 27485204, (Europe PMC) | NA | BioGRID |
| STIP1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| TRIB3 | Affinity Capture-Western | physical | 20606298, (Europe PMC) | NA | BioGRID |
| UBE4B | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| VAMP8 | Two-hybrid | physical | 21988832, (Europe PMC) | NA | BioGRID |
| VCP | Affinity Capture-Western | physical | 24429874, (Europe PMC) | NA | BioGRID |
| WDR11 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| XPO1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAB | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid | association, physical, physical association | 27432908, 28330616, 7644510, (Europe PMC) | 0.71 | BioGRID, IntAct |
| YWHAE | Two-hybrid, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down, two hybrid | physical, physical association | 14559997, 7644510, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| YWHAG | Affinity Capture-MS, proximity-dependent biotin identification, pull down | association, physical | 27432908, 28330616, (Europe PMC) | 0.46 | BioGRID, IntAct |
| YWHAH | Affinity Capture-MS, proximity-dependent biotin identification, pull down | association, physical | 27432908, 28330616, (Europe PMC) | 0.46 | BioGRID, IntAct |
| YWHAQ | Reconstituted Complex, coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical | 15161933, 19289404, 28330616, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| YWHAZ | Affinity Capture-MS, Two-hybrid, far western blotting, pull down | direct interaction, physical, physical association | 11912208, 15161933, 27432908, 28514442, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| CALR | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| CAMK1D | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCNB1 | Affinity Capture-MS, Affinity Capture-Western, proximity ligation assay | physical, physical association | 1836978, 23397142, 27432908, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CCNI | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CHEK1 | Affinity Capture-MS, Biochemical Activity, Reconstituted Complex, protein kinase assay | phosphorylation reaction, physical | 12399544, 12676583, 12759351, 12963847, 17292828, 18480045, 27432908, 9278511, (Europe PMC) | 0.44 | BioGRID, IntAct |
| CHEK2 | Biochemical Activity, Reconstituted Complex, coimmunoprecipitation | phosphorylation reaction, physical | 10724175, 11298456, 12676583, 12759351, 18480045, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| CUL3 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DMD | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DUSP8 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| EEF1A1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EGLN3 | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| FAM193B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FBXW11 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, coimmunoprecipitation, proximity-dependent biotin identification, pull down, tandem affinity purification | association, physical, physical association | 14603323, 14681206, 15798217, 16338364, 22017875, 25332235, 25515538, 25609649, 25900982, 27432908, 27880917, 28330616, 28514442, 29150431, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| FGF21 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FTH1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HLA-C | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IL3RA | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LMO2 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LRRK2 | protein array | direct interaction | 24947832, (Europe PMC) | 0.44 | IntAct |
| MAPKAPK2 | protein kinase assay | phosphorylation reaction | 17292828, (Europe PMC) | 0.44 | IntAct |
| MCM3AP | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MTAP | two hybrid array | physical association | 21988832, (Europe PMC) | 0.37 | IntAct |
| NAA10 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NFKBIB | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NFYA | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PDIA3 | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| PEX19 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PKM | Biochemical Activity, Reconstituted Complex, protein kinase assay | phosphorylation reaction, physical | 24606918, 27485204, (Europe PMC) | 0.44 | BioGRID, IntAct |
| POLR1D | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPM1G | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| RAF1 | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 7644510, 7744247, 9230211, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SCYL1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SKP1 | Affinity Capture-MS, Affinity Capture-Western, proximity-dependent biotin identification, pull down | association, physical | 12234927, 14603323, 14752276, 15536641, 27432908, 28330616, (Europe PMC) | 0.46 | BioGRID, IntAct |
| SMAD3 | Affinity Capture-Western, Two-hybrid, two hybrid array | physical, physical association | 15798217, 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SOX5 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| VAMP8 | two hybrid array | physical association | 21988832, (Europe PMC) | 0.37 | IntAct |
| XPO1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAB | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid | association, physical, physical association | 27432908, 28330616, 7644510, (Europe PMC) | 0.71 | BioGRID, IntAct |
| YWHAE | Two-hybrid, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down, two hybrid | physical, physical association | 14559997, 7644510, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| YWHAG | Affinity Capture-MS, proximity-dependent biotin identification, pull down | association, physical | 27432908, 28330616, (Europe PMC) | 0.46 | BioGRID, IntAct |
| YWHAH | Affinity Capture-MS, proximity-dependent biotin identification, pull down | association, physical | 27432908, 28330616, (Europe PMC) | 0.46 | BioGRID, IntAct |
| YWHAQ | Reconstituted Complex, coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical | 15161933, 19289404, 28330616, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| YWHAZ | Affinity Capture-MS, Two-hybrid, far western blotting, pull down | direct interaction, physical, physical association | 11912208, 15161933, 27432908, 28514442, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| CHEK2 | Biochemical Activity, Reconstituted Complex, coimmunoprecipitation | phosphorylation reaction, physical | 10724175, 11298456, 12676583, 12759351, 18480045, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| DUSP8 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FAM193B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FBXW11 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, coimmunoprecipitation, proximity-dependent biotin identification, pull down, tandem affinity purification | association, physical, physical association | 14603323, 14681206, 15798217, 16338364, 22017875, 25332235, 25515538, 25609649, 25900982, 27432908, 27880917, 28330616, 28514442, 29150431, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| YWHAE | Two-hybrid, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down, two hybrid | physical, physical association | 14559997, 7644510, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| YWHAQ | Reconstituted Complex, coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical | 15161933, 19289404, 28330616, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| YWHAZ | Affinity Capture-MS, Two-hybrid, far western blotting, pull down | direct interaction, physical, physical association | 11912208, 15161933, 27432908, 28514442, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| APP | Reconstituted Complex | physical | 21832049, (Europe PMC) | NA | BioGRID |
| ATXN7L3B | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| BTRC | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex, anti tag coimmunoprecipitation, coimmunoprecipitation, experimental interaction detection, pull down | direct interaction, physical, physical association, ubiquitination reaction | 14603323, 14681206, 14752276, 15536641, 15798217, 16338364, 19477924, 19615732, 20348946, 25332235, 25900982, 26091241, 27880917, 28514442, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| CALR | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| CAMK1D | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCDC28A | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CCNA1 | Affinity Capture-MS, Affinity Capture-Western | physical | 10926775, 27432908, (Europe PMC) | NA | BioGRID |
| CCNA2 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CCNB1 | Affinity Capture-MS, Affinity Capture-Western, proximity ligation assay | physical, physical association | 1836978, 23397142, 27432908, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CCNE1 | Affinity Capture-Western, Reconstituted Complex | physical | 8617791, 9891079, (Europe PMC) | NA | BioGRID |
| CCNI | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CCT8L1P | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDC20 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDC25A | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDK2 | Affinity Capture-MS, Biochemical Activity, Reconstituted Complex | physical | 16191191, 27432908, 8617791, (Europe PMC) | NA | BioGRID |
| CDK3 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| CDK5 | Biochemical Activity | physical | 22899714, (Europe PMC) | NA | BioGRID |
| CHEK1 | Affinity Capture-MS, Biochemical Activity, Reconstituted Complex, protein kinase assay | phosphorylation reaction, physical | 12399544, 12676583, 12759351, 12963847, 17292828, 18480045, 27432908, 9278511, (Europe PMC) | 0.44 | BioGRID, IntAct |
| CHEK2 | Biochemical Activity, Reconstituted Complex, coimmunoprecipitation | phosphorylation reaction, physical | 10724175, 11298456, 12676583, 12759351, 18480045, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| CSNK1A1 | Biochemical Activity | physical | 20348946, (Europe PMC) | NA | BioGRID |
| CUL1 | Affinity Capture-MS, Affinity Capture-Western | physical | 12234927, 14603323, 14681206, 14752276, 15536641, 27432908, (Europe PMC) | NA | BioGRID |
| CUL3 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DMD | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DNAJC10 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DUSP7 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| DUSP8 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| EEF1A1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EGFR | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 11912208, (Europe PMC) | NA | BioGRID |
| EGLN3 | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| FAM193B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FAM91A1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| FBXW11 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, coimmunoprecipitation, proximity-dependent biotin identification, pull down, tandem affinity purification | association, physical, physical association | 14603323, 14681206, 15798217, 16338364, 22017875, 25332235, 25515538, 25609649, 25900982, 27432908, 27880917, 28330616, 28514442, 29150431, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| FGF21 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FTH1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FZR1 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 12234927, 19477924, (Europe PMC) | NA | BioGRID |
| GOPC | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| GTF2I | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| HLA-C | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IL3RA | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IPO5 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| LMO2 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LRRK2 | protein array | direct interaction | 24947832, (Europe PMC) | 0.44 | IntAct |
| MAP3K5 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 11416155, (Europe PMC) | NA | BioGRID |
| MAPK14 | Reconstituted Complex | physical | 12963847, (Europe PMC) | NA | BioGRID |
| MAPKAPK2 | protein kinase assay | phosphorylation reaction | 17292828, (Europe PMC) | 0.44 | IntAct |
| MCM3AP | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MTAP | Two-hybrid | physical | 21988832, (Europe PMC) | NA | BioGRID |
| MTAP | two hybrid array | physical association | 21988832, (Europe PMC) | 0.37 | IntAct |
| NAA10 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NFKBIB | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NFYA | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NPLOC4 | Affinity Capture-Western | physical | 24429874, (Europe PMC) | NA | BioGRID |
| NXF1 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| PDIA3 | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| PEX19 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PIM1 | Affinity Capture-Western, Reconstituted Complex | physical | 10373478, (Europe PMC) | NA | BioGRID |
| PKM | Biochemical Activity, Reconstituted Complex, protein kinase assay | phosphorylation reaction, physical | 24606918, 27485204, (Europe PMC) | 0.44 | BioGRID, IntAct |
| POLR1D | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPM1G | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| PTP4A1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| RAD23A | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| RAF1 | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 7644510, 7744247, 9230211, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ROCK1 | Biochemical Activity | physical | 14657354, (Europe PMC) | NA | BioGRID |
| SCYL1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SFN | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SKP1 | Affinity Capture-MS, Affinity Capture-Western, proximity-dependent biotin identification, pull down | association, physical | 12234927, 14603323, 14752276, 15536641, 27432908, 28330616, (Europe PMC) | 0.46 | BioGRID, IntAct |
| SMAD3 | Affinity Capture-Western, Two-hybrid, two hybrid array | physical, physical association | 15798217, 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SOX5 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SRC | Biochemical Activity | physical | 27485204, (Europe PMC) | NA | BioGRID |
| STIP1 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| TRIB3 | Affinity Capture-Western | physical | 20606298, (Europe PMC) | NA | BioGRID |
| UBE4B | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| VAMP8 | Two-hybrid | physical | 21988832, (Europe PMC) | NA | BioGRID |
| VAMP8 | two hybrid array | physical association | 21988832, (Europe PMC) | 0.37 | IntAct |
| VCP | Affinity Capture-Western | physical | 24429874, (Europe PMC) | NA | BioGRID |
| WDR11 | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| XPO1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAB | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid | association, physical, physical association | 27432908, 28330616, 7644510, (Europe PMC) | 0.71 | BioGRID, IntAct |
| YWHAE | Two-hybrid, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down, two hybrid | physical, physical association | 14559997, 7644510, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| YWHAG | Affinity Capture-MS, proximity-dependent biotin identification, pull down | association, physical | 27432908, 28330616, (Europe PMC) | 0.46 | BioGRID, IntAct |
| YWHAH | Affinity Capture-MS, proximity-dependent biotin identification, pull down | association, physical | 27432908, 28330616, (Europe PMC) | 0.46 | BioGRID, IntAct |
| YWHAQ | Reconstituted Complex, coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical | 15161933, 19289404, 28330616, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| YWHAZ | Affinity Capture-MS, Two-hybrid, far western blotting, pull down | direct interaction, physical, physical association | 11912208, 15161933, 27432908, 28514442, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |