Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PHPT1
Gene Name  | PHPT1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PHPT1, PHP14, CGI-202, HSPC141 | |
| Protein Name | PHPT1 |
|
| Alternative Name(s) |
14 kDa phosphohistidine phosphatase;3.9.1.3;Phosphohistidine phosphatase 1;PHPT1;Protein histidine phosphatase;PHP;Protein janus-A homolog; | |
| EntrezGene ID | 29085 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q9NRX4 (protein sequence) | |
| Enzyme Class | EC 3.9.1.3 (BRENDA ) | |
| Molecular Weight | 13833 Dalton | |
| Protein Length | 125 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000054148 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: PHP | Historic class: Janus family | CATH ID: 3.50.20.20 | SCOP Fold: PHP | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm | |||
| Function (UniProt annotation) | |||
| Exhibits phosphohistidine phosphatase activity | |||
| Catalytic Activity (UniProt annotation) | |||
| A [protein]-N-phospho-L-histidine + H(2)O = a[protein]-L-histidine + phosphate | |||
| Protein Sequence | |||
| MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRIS HQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0005829 | C:cytosol |
| GO:0006470 | P:protein dephosphorylation |
| GO:0019855 | F:calcium channel inhibitor activity |
| GO:0035774 | P:positive regulation of insulin secretion involved in cellular response to glucose stimulus |
| GO:0035971 | P:peptidyl-histidine dephosphorylation |
| GO:0044325 | F:ion channel binding |
| GO:0050860 | P:negative regulation of T cell receptor signaling pathway |
| GO:0051350 | P:negative regulation of lyase activity |
| GO:0070062 | C:extracellular exosome |
| GO:0101006 | F:protein histidine phosphatase activity |
| GO:2000147 | P:positive regulation of cell motility |
| GO:2000249 | P:regulation of actin cytoskeleton reorganization |
| GO:2000984 | P:negative regulation of ATP citrate synthase activity |
