Top ACLY
Localization (UniProt annotation) Cytoplasm Function (UniProt annotation) ATP-citrate synthase is the primary enzyme responsiblefor the synthesis of cytosolic acetyl-CoA in many tissues Has acentral role in de novo lipid synthesis In nervous tissue it maybe involved in the biosynthesis of acetylcholine Catalytic Activity (UniProt annotation) ADP + phosphate + acetyl-CoA + oxaloacetate =ATP + citrate + CoA Protein Sequence MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDG
VKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKL
NPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYA
KTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGI
PIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSVP
SPRSLQGKSTTLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVFKNMADAM
RKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPATVGGIKPGCFKIGNTG
GMLDNILASKLYRPGSVAYVSRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTPGVKMIVVLGEIG
GTEEYKICRGIKEGRLTKPIVCWCIGTCATMFSSEVQFGHAGACANQASETAVAKNQALKEAGVFVPRSFDELGEIIQSV
YEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQELIYAGMPITEVFKEEMGIGGVLGLLWFQK
RLPKYSCQFIEMCLMVTADHGPAVSGAHNTIICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFV
NKMKKEGKLIMGIGHRVKSINNPDMRVQILKDYVRQHFPATPLLDYALEVEKITTSKKPNLILNVDGLIGVAFVDMLRNC
GSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISYVLPEHMSM
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
ACLY is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa00020 Citrate cycle (TCA cycle) The citrate cycle (TCA cycle, Krebs cycle) is an important aerobic pathway for the final steps of the oxidation of carbohydrates and fatty acids. The cycle starts with acetyl-CoA, the activated form of acetate, derived from glycolysis and pyruvate oxidation for carbohydrates and from beta oxidation of fatty acids. The two-carbon acetyl group in acetyl-CoA is transferred to the four-carbon compound of oxaloacetate to form the six-carbon compound of citrate. In a series of reactions two carbons in citrate are oxidized to CO2 and the reaction pathway supplies NADH for use in the oxidative phosphorylation and other metabolic processes. The pathway also supplies important precursor metabolites including 2-oxoglutarate. At the end of the cycle the remaining four-carbon part is transformed back to oxaloacetate. According to the genome sequence data, many organisms seem to lack genes for the full cycle [MD:M00009], but contain genes for specific segments [MD:M00010 M00011]. hsa01100 Metabolic pathways
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-163765 ChREBP activates metabolic gene expression. ChREBP (Carbohydrate Response Element Binding Protein) is a large multidomain protein containing a nuclear localization signal near its amino terminus, polyproline domains, a basic helix-loop-helix-leucine zipper domain, and a leucine-zipper-like domain (Uyeda et al., 2002). Its dephosphorylation in response to molecular signals associated with the well-fed state allows it to enter the nucleus, interact with MLX protein, and bind to ChRE DNA sequence motifs near Acetyl-CoA carboxylase, Fatty acid synthase, and Pyruvate kinase (L isoform) genes (Ishi et al.2004). This sequence of events is outlined schematically in the picture below (adapted from Kawaguchi et al. (2001) - copyright (2001) National Academy of Sciences, U.S.A.) R-HSA-6798695 Neutrophil degranulation. Neutrophils are the most abundant leukocytes (white blood cells), indispensable in defending the body against invading microorganisms. In response to infection, neutrophils leave the circulation and migrate towards the inflammatory focus. They contain several subsets of granules that are mobilized to fuse with the cell membrane or phagosomal membrane, resulting in the exocytosis or exposure of membrane proteins. Traditionally, neutrophil granule constituents are described as antimicrobial or proteolytic, but granules also introduce membrane proteins to the cell surface, changing how the neutrophil responds to its environment (Borregaard et al. 2007). Primed neutrophils actively secrete cytokines and other inflammatory mediators and can present antigens via MHC II, stimulating T-cells (Wright et al. 2010).Granules form during neutrophil differentiation. Granule subtypes can be distinguished by their content but overlap in structure and composition. The differences are believed to be a consequence of changing protein expression and differential timing of granule formation during the terminal processes of neutrophil differentiation, rather than sorting (Le Cabec et al. 1996). The classical granule subsets are Azurophil or primary granules (AG), secondary granules (SG) and gelatinase granules (GG). Neutrophils also contain exocytosable storage cell organelles, storage vesicles (SV), formed by endocytosis they contain many cell-surface markers and extracellular, plasma proteins (Borregaard et al. 1992). Ficolin-1-rich granules (FG) are like GGs highly exocytosable but gelatinase-poor (Rorvig et al. 2009) R-HSA-75105 Fatty acyl-CoA biosynthesis. Fatty acyl-CoA biosynthesis involves following steps:
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source APP Reconstituted Complex physical 21832049 , (Europe PMC )NA BioGRID ASB15 Affinity Capture-MS physical 24337577 , (Europe PMC )NA BioGRID ATF6 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT ATXN3 Affinity Capture-MS physical 29111377 , (Europe PMC )NA BioGRID BAG3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID BRCA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CAND1 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CCDC8 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CDKN2A Reconstituted Complex physical 17955473 , (Europe PMC )NA BioGRID CFTR Affinity Capture-MS physical 26618866 , (Europe PMC )NA BioGRID CRY1 Affinity Capture-MS physical 25756610 , (Europe PMC )NA BioGRID CRY2 Affinity Capture-MS physical 25756610 , (Europe PMC )NA BioGRID CS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CTH Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CUL2 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID DDIAS Two-hybrid physical 28079882 , (Europe PMC )NA BioGRID DERL1 Affinity Capture-MS physical 28137758 , (Europe PMC )NA BioGRID DNM1L Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DUSP13 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID EEF1D Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID FBXW7 Affinity Capture-MS physical 25720964 , (Europe PMC )NA BioGRID FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct GSK3B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HDAC5 Affinity Capture-MS physical 21081666 , (Europe PMC )NA BioGRID HGS Reconstituted Complex physical 19019082 , (Europe PMC )NA BioGRID HNRNPK Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HUWE1 Affinity Capture-MS physical 25147182 , (Europe PMC )NA BioGRID IKBKE Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct ISG15 Affinity Capture-MS physical 16009940 , (Europe PMC )NA BioGRID KAT2B Affinity Capture-Western physical 23932781 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KPNA2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID KPNA4 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID MAGED2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID MCM2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID MCM6 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NAPRT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NCL Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NME2 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NUP107 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NUP210L Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID PPP6C Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PRKAB1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct PRMT1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PYGB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RPE Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SDHA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SDHB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SHC1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID SIRT2 Affinity Capture-Western physical 23932781 , (Europe PMC )NA BioGRID SIRT6 Affinity Capture-MS physical 24169447 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SRRT Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID STAU1 Affinity Capture-MS physical 23125841 , (Europe PMC )NA BioGRID STIP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TERF1 Affinity Capture-MS physical 20811636 , (Europe PMC )NA BioGRID TERF2 Affinity Capture-MS physical 20811636 , (Europe PMC )NA BioGRID TFE3 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct TRIM25 Affinity Capture-MS physical 24399297 , (Europe PMC )NA BioGRID UBC Affinity Capture-MS, Reconstituted Complex physical 17550899 , 23314748 , (Europe PMC )NA BioGRID UBR4 Affinity Capture-Western physical 23932781 , (Europe PMC )NA BioGRID USP13 Affinity Capture-Western physical 27892457 , (Europe PMC )NA BioGRID WWOX Affinity Capture-MS physical 24550385 , (Europe PMC )NA BioGRID ZNF746 Affinity Capture-MS physical 25315684 , (Europe PMC )NA BioGRID
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ATF6 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT BCAR3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CCNA1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CDKN2A pull down association 17955473 , (Europe PMC )0.35 IntAct DNM1L Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct GSK3B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct IKBKE Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LRRK2 tandem affinity purification association 24725412 , (Europe PMC )0.35 IntAct NME2 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct NUP107 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct OTUB1 anti tag coimmunoprecipitation association 26752685 , (Europe PMC )0.35 IntAct PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PPP2R1A proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PPP2R2A proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PPP2R2B proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PPP2R2C proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PPP2R2D proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PRKAB1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct RIPK4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct TFAP2C two hybrid physical association 24835590 , (Europe PMC )0.37 IntAct TFE3 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct TNFRSF10D anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct VHL anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source APP Reconstituted Complex physical 21832049 , (Europe PMC )NA BioGRID ARF6 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ASB15 Affinity Capture-MS physical 24337577 , (Europe PMC )NA BioGRID ATF6 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT ATXN3 Affinity Capture-MS physical 29111377 , (Europe PMC )NA BioGRID BAG3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID BCAR3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct BRCA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID CAND1 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CCDC8 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CCNA1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CDKN2A Reconstituted Complex physical 17955473 , (Europe PMC )NA BioGRID CDKN2A pull down association 17955473 , (Europe PMC )0.35 IntAct CFTR Affinity Capture-MS physical 26618866 , (Europe PMC )NA BioGRID CRY1 Affinity Capture-MS physical 25756610 , (Europe PMC )NA BioGRID CRY2 Affinity Capture-MS physical 25756610 , (Europe PMC )NA BioGRID CS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CTH Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CUL2 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID DDIAS Two-hybrid physical 28079882 , (Europe PMC )NA BioGRID DERL1 Affinity Capture-MS physical 28137758 , (Europe PMC )NA BioGRID DNM1L Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DUSP13 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID EEF1D Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID FBXW7 Affinity Capture-MS physical 25720964 , (Europe PMC )NA BioGRID FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct GSK3B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HDAC5 Affinity Capture-MS physical 21081666 , (Europe PMC )NA BioGRID HGS Reconstituted Complex physical 19019082 , (Europe PMC )NA BioGRID HNRNPK Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HUWE1 Affinity Capture-MS physical 25147182 , (Europe PMC )NA BioGRID IKBKE Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct ISG15 Affinity Capture-MS physical 16009940 , (Europe PMC )NA BioGRID JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KAT2B Affinity Capture-Western physical 23932781 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KPNA2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID KPNA4 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID LRRK2 tandem affinity purification association 24725412 , (Europe PMC )0.35 IntAct MAGED2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID MCM2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID MCM6 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NAPRT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NCL Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NME2 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NUP107 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NUP210L Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID OTUB1 anti tag coimmunoprecipitation association 26752685 , (Europe PMC )0.35 IntAct PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PPP2R1A proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PPP2R2A proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PPP2R2B proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PPP2R2C proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PPP2R2D proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PPP6C Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PRKAB1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct PRMT1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PYGB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RIPK4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RPE Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SDHA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SDHB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SHC1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID SIRT2 Affinity Capture-Western physical 23932781 , (Europe PMC )NA BioGRID SIRT6 Affinity Capture-MS physical 24169447 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SRRT Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID STAU1 Affinity Capture-MS physical 23125841 , (Europe PMC )NA BioGRID STIP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TERF1 Affinity Capture-MS physical 20811636 , (Europe PMC )NA BioGRID TERF2 Affinity Capture-MS physical 20811636 , (Europe PMC )NA BioGRID TFAP2C two hybrid physical association 24835590 , (Europe PMC )0.37 IntAct TFE3 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct TNFRSF10D anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TRIM25 Affinity Capture-MS physical 24399297 , (Europe PMC )NA BioGRID UBC Affinity Capture-MS, Reconstituted Complex physical 17550899 , 23314748 , (Europe PMC )NA BioGRID UBR4 Affinity Capture-Western physical 23932781 , (Europe PMC )NA BioGRID USP13 Affinity Capture-Western physical 27892457 , (Europe PMC )NA BioGRID VHL anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct WWOX Affinity Capture-MS physical 24550385 , (Europe PMC )NA BioGRID ZNF746 Affinity Capture-MS physical 25315684 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
GSK-3_group S451_STSTPAPsRTASFSE , T447_NASGSTStPAPSRTA , LTP 2176822 ,(Europe PMC )PhosphoELM , GSK3B S451_STSTPAPsRTASFSE , T447_NASGSTStPAPSRTA , in vitro, in vivo 10653665 , 20058876 ,(Europe PMC )HPRD, PKA_group S455_PAPSRTAsFSESRAD , LTP 10653665 ,(Europe PMC )PhosphoELM , PRKACA S455_PAPSRTAsFSESRAD , in vitro, in vivo 10653665 , 17924679 , 18088087 , 18452278 , 18669648 , 18767875 , 19415658 ,(Europe PMC )HPRD, Unknown S1090_LYRHPWDsISYVLPE , S1100_YVLPEHMsM , S442_ANFLLNAsGSTSTPA , S455_PAPSRTAsFSESRAD , S459_RTASFSEsRADEVAP , S478_KPAMPQDsVPSPRSL , S481_MPQDSVPsPRSLQGK , S484_DSVPSPRsLQGKSTT , T445_LLNASGStSTPAPSR , T453_STPAPSRtASFSESR , Y131_YATREGDyVLFHHEG , Y672_GMSNELNyIISRTTD , Y682_SRTTDGVyEGVAIGG , HTP, LTP, in vitro, in vivo 10653665 , 15302935 , 15592455 , 16464493 , 17016520 , 17081983 , 17924679 , 18088087 , 18452278 , 18669648 , 18767875 , 19413330 , 19415658 , 19664994 , 19664995 , 20058876 ,(Europe PMC )HPRD, PhosphoELM ,
Statistics
