Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PGP
Gene Name  | PGP (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PGP | |
| Protein Name | PGP |
|
| Alternative Name(s) |
Glycerol-3-phosphate phosphatase;G3PP;3.1.3.21;Aspartate-based ubiquitous Mg(2+)-dependent phosphatase;AUM;3.1.3.48;Phosphoglycolate phosphatase;PGP; | |
| EntrezGene ID | 283871 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | A6NDG6 (protein sequence) | |
| Enzyme Class | EC 3.1.3.21 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 34006 Dalton | |
| Protein Length | 321 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000184207 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: HAD | Historic class: HAD-like hydrolase | CATH ID: 3.40.50.1000, 3.40.50.10410 | SCOP Fold: HAD | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| N/A | |||
| Function (UniProt annotation) | |||
| Glycerol-3-phosphate phosphatase hydrolyzing glycerol-3-phosphate into glycerol Thereby, regulates the cellular levels ofglycerol-3-phosphate a metabolic intermediate of glucose, lipidand energy metabolism Was also shown to have a 2-phosphoglycolatephosphatase activity and a tyrosine-protein phosphatase activityHowever, their physiological relevance is unclear(PubMed:26755581) In vitro, has also a phosphatase activitytoward ADP, ATP, GDP and GTP (By similarity) | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate Glycerol 1-phosphate + H(2)O = glycerol +phosphate | |||
| Protein Sequence | |||
| MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARGKRLGFITNNSSKTRAAYAEK LRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPKAYVLGSPALAAELEAVGVASVGVGPEPLQGEGPGDWLHAP LEPDVRAVVVGFDPHFSYMKLTKALRYLQQPGCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFI FDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIADLLPALQ G |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000121 | F:glycerol-1-phosphatase activity |
| GO:0000287 | F:magnesium ion binding |
| GO:0004721 | F:phosphoprotein phosphatase activity |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0005829 | C:cytosol |
| GO:0006114 | P:glycerol biosynthetic process |
| GO:0006650 | P:glycerophospholipid metabolic process |
| GO:0008967 | F:phosphoglycolate phosphatase activity |
| GO:0016311 | P:dephosphorylation |
| GO:0035335 | P:peptidyl-tyrosine dephosphorylation |
| GO:0043136 | F:glycerol-3-phosphatase activity |
| GO:0045721 | P:negative regulation of gluconeogenesis |
| GO:0098519 | F:nucleotide phosphatase activity |
