- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PGAM5
Gene Name  | PGAM5 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PGAM5 | |
| Protein Name | PGAM5 |
|
| Alternative Name(s) |
Serine/threonine-protein phosphatase PGAM5, mitochondrial;3.1.3.16;Bcl-XL-binding protein v68;Phosphoglycerate mutase family member 5; | |
| EntrezGene ID | 192111 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q96HS1 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 (BRENDA ) | |
| Molecular Weight | 32004 Dalton | |
| Protein Length | 289 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000247077 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: histidine phosphatase (HP) --> Family: PGAM | Historic class: Phosphoglycerate mutase | CATH ID: 3.40.50.1240 | SCOP Fold: HP | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Mitochondrion outer membrane Note=Isoform 2 overexpressionresults in the formation of disconnected punctuate mitochondriadistributed throughout the cytoplasm Isoform 1 overexpressionresults in the clustering of mitochondria around the nucleus | |||
| Function (UniProt annotation) | |||
| Displays phosphatase activity for serine/threonineresidues, and, dephosphorylates and activates MAP3K5 kinase Hasapparently no phosphoglycerate mutase activity May be regulatorof mitochondrial dynamics Substrate for a KEAP1-dependentubiquitin ligase complex Contributes to the repression of NFE2L2-dependent gene expression Acts as a central mediator forprogrammed necrosis induced by TNF, by reactive oxygen species andby calcium ionophore | |||
| Catalytic Activity (UniProt annotation) | |||
| [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVES GEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDII SRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCR ALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| DEG_Kelch_Keap1_1 | 77-NVESGE-82 | KEAP1 binding degron | [DNS].[DES][TNS]GE |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0004722 | F:protein serine/threonine phosphatase activity |
| GO:0005096 | F:GTPase activator activity |
| GO:0005739 | C:mitochondrion |
| GO:0005741 | C:mitochondrial outer membrane |
| GO:0016021 | C:integral component of membrane |
| GO:0016236 | P:macroautophagy |
| GO:0016791 | F:phosphatase activity |
| GO:0044877 | F:protein-containing complex binding |
| GO:0070266 | P:necroptotic process |
| GO:0120163 | P:negative regulation of cold-induced thermogenesis |
Download FASTA sequences of PGAM5-substrates in Humans
| Substrate Gene Name | Substrate UniProt_AC | DephosphoSite and sequence (+/-5) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| MAP3K5 | Q99683 | NA | In vitro and in vivo | 19590015, | Europe PMC |  |
| LPIN1 | Q14693 | NA_NA | in vitro and in vivo | 30642635, | Europe PMC | |
| DNM1L | O00429 | Ser-637_VARKLsAREQR | In vitro | 22265414, | Europe PMC | |
[Feedback|Contribution]
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04137 | Mitophagy - animal | Mitochondria act as the energy powerhouse of the cell, and are essential for eukaryotic cells to grow and function normally. However, deleterious byproducts of oxidative phosphorylation process called reactive oxidative species (ROS) lead to mitochondrial dysfunction. If the damage is too excessive to be repaired, such mitochondria are selectively recognized and targeted for degradation by a specific mode of autophagy, termed mitophagy. The loss of the mitochondrial membrane potential can induce mitophagy, involving the kinase PINK1 and the E3 ligase Parkin. PINK1 serves as the sensor for the mitochondrial depolarization and recruits Parkin, followed by ubiquitin-dependent recruitment of mitophagy receptors. There are also several PINK1/Parkin-independent mitophagy pathways, in which a group of LIR-containing receptors are required in response to different stimuli. Mitophagy contributes to the maintenance of a healthy mitochondrial network and the prevention of programmed cell death. |
| hsa04217 | Necroptosis | Necroptosis is a programmed form of necrosis. It can be initiated by different stimuli, such as tumor necrosis factor (TNF), TNF-related apoptosis-inducing ligand (TRAIL), Fas ligand (FasL), interferon (IFN), LPS, viral DNA or RNA, DNA-damage agent and requires the kinase activity of receptor-interacting protein 1 (RIPK1) and RIPK3. Its execution involves ROS generation, calcium overload, the opening of the mitochondrial permeability transition pore, mitochondrial fission, inflammatory response and chromatinolysis. Necroptosis participates in many pathogenesis of diseases, including neurological diseases, retinal disorders, acute kidney injury, inflammatory diseases and microbial infections. |
| hsa04668 | TNF signaling pathway | Tumor necrosis factor (TNF), as a critical cytokine, can induce a wide range of intracellular signal pathways including apoptosis and cell survival as well as inflammation and immunity. Activated TNF is assembled to a homotrimer and binds to its receptors (TNFR1, TNFR2) resulting in the trimerization of TNFR1 or TNFR2. TNFR1 is expressed by nearly all cells and is the major receptor for TNF (also called TNF-alpha). In contrast, TNFR2 is expressed in limited cells such as CD4 and CD8 T lymphocytes, endothelial cells, microglia, oligodendrocytes, neuron subtypes, cardiac myocytes, thymocytes and human mesenchymal stem cells. It is the receptor for both TNF and LTA (also called TNF-beta). Upon binding of the ligand, TNFR mediates the association of some adaptor proteins such as TRADD or TRAF2, which in turn initiate recruitment of signal transducers. TNFR1 signaling induces activation of many genes, primarily controlled by two distinct pathways, NF-kappa B pathway and the MAPK cascade, or apoptosis and necroptosis. TNFR2 signaling activates NF-kappa B pathway including PI3K-dependent NF-kappa B pathway and JNK pathway leading to survival. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-8934903 | Receptor Mediated Mitophagy. | Mitochondrial autophagy in mammalian cells was first observed in glucagon-stimulated hepatocytes. The mechanisms of mitophagy in mammalian cells remain unclear. Oxidative stress and mPTP are involved in the initiation of mitophagy. Receptor mediated mitophagy links both cellular differentiation signals and markers of mitochondrial function to LC3 and Atg32, scaffold proteins important for cargo selection and autophagosome formation. These scaffold proteins recruit other autophagy proteins to form the autophagosomes; destroying and recycling mitochondria.Mitophagy receptors have to meet at least three criteria: 1) it must be mitochondrially localized, 2) it must interact with LC3/ ATG8 in response to a certain stimulus, and 3) it must have a consensus sequence of W/F/YxxL/I known as the LIR motif. This tetrapeptide sequence is present in several Atg8 or LC3-binding partners that are important for selective autophagy.FUNDC1-mediated mitophagy is inhibited by its phosphorylation at the Tyr 18 position in the LIR motif by Src kinase under normoxia conditions. Upon hypoxia stimulation, Src is inactivated and FUNDC1 at the Tyr 18 position is dephosphorylated by an unknown phosphatase, resulting in an increase of the interaction between FUNDC1 and LC3-II, leading to the selective incorporation and autophagic removal of the mitochondrion.The outer mitochondrial membrane protein NIX/BNIP3L is involved in autophagic turnover of mitochondria in reticulocytes, a process essential for red blood cell maturation [43]. The mechanism through which NIX senses signals from red blood cell differentiation is unclear. Phosphorylation of serine residues 17 and 24 flanking the BNIP3 LIR promotes binding to specific LC3 family members LC3B and GATE-16 and increases lysosomal destruction of mitochondria |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AIFM1 | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 27218139, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ASB10 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB14 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB18 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB3 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| BARD1 | Affinity Capture-MS | physical | 22990118, (Europe PMC) | NA | BioGRID |
| BCL2L1 | Affinity Capture-Western | physical | 17046835, (Europe PMC) | NA | BioGRID |
| BIRC2 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 23201124, (Europe PMC) | NA | BioGRID |
| BMI1 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| BRCA1 | Affinity Capture-MS | physical | 25184681, (Europe PMC) | NA | BioGRID |
| CCDC8 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CDK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| COPS5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL3 | Affinity Capture-MS, Affinity Capture-Western | physical | 17046835, 21145461, (Europe PMC) | NA | BioGRID |
| CUL4B | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| ECT2 | Affinity Capture-MS | physical | 22990118, (Europe PMC) | NA | BioGRID |
| EIF4A3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23084401, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ESR1 | Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient | association, physical | 21182205, (Europe PMC) | 0.46 | BioGRID, IntAct |
| FN1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, (Europe PMC) | 0.35 | BioGRID, IntAct |
| G3BP1 | Affinity Capture-MS | physical | 26777405, (Europe PMC) | NA | BioGRID |
| GLI1 | Affinity Capture-MS | physical | 26603838, (Europe PMC) | NA | BioGRID |
| HAUS1 | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| HDAC5 | Affinity Capture-MS | physical | 21081666, (Europe PMC) | NA | BioGRID |
| HDGF | Affinity Capture-MS, tandem affinity purification | association, physical | 21907836, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSPA1B | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| HUWE1 | Affinity Capture-MS | physical | 25147182, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | physical, physical association | 17046835, 18387606, 19615732, 24127568, 27621311, (Europe PMC) | 0.40 | BioGRID, IntAct |
| MAGOH | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23084401, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MDC1 | Affinity Capture-MS | physical | 22990118, (Europe PMC) | NA | BioGRID |
| MIR106A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR106B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR107 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR10B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR128-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR141 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR145 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR15A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR16-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR18B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR200B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR205 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR206 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR20B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR21 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR214 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR25 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR34A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR451A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR93 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7A1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7A2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7E | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7F1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MRPL58 | Affinity Capture-MS | physical | 20186120, (Europe PMC) | NA | BioGRID |
| MYH7B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NF2 | Affinity Capture-MS | physical | 26549023, (Europe PMC) | NA | BioGRID |
| NFE2L2 | Affinity Capture-Western | physical | 18387606, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| OSBPL10 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PAXIP1 | Affinity Capture-MS | physical | 22990118, (Europe PMC) | NA | BioGRID |
| PGAM5 | Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | physical, physical association | 22265414, 27218139, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PINK1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity | physical | 21151955, (Europe PMC) | NA | BioGRID |
| PRKN | Affinity Capture-MS | physical | 24244333, (Europe PMC) | NA | BioGRID |
| RBX1 | Affinity Capture-Western | physical | 17046835, (Europe PMC) | NA | BioGRID |
| RNF2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| SETDB1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SIRT7 | Affinity Capture-MS | physical | 22586326, (Europe PMC) | NA | BioGRID |
| SLX4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 19596235, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STRN | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24366813, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STRN3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24366813, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SUZ12 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| TJP2 | Proximity Label-MS, proximity-dependent biotin identification | colocalization, physical | 24255178, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TUBA1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| USP11 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| XIAP | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 23201124, (Europe PMC) | NA | BioGRID |
| YAP1 | Affinity Capture-MS | physical | 25796446, (Europe PMC) | NA | BioGRID |
| ZBTB16 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZNF746 | Affinity Capture-MS | physical | 25315684, (Europe PMC) | NA | BioGRID |
| ZRANB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ZSCAN26 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AIFM1 | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 27218139, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ASXL1 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| BAP1 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| CANX | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CDK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1L | anti tag coimmunoprecipitation | physical association | 22265414, (Europe PMC) | 0.40 | IntAct |
| EIF4A3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23084401, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ESR1 | Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient | association, physical | 21182205, (Europe PMC) | 0.46 | BioGRID, IntAct |
| EZR | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| FN1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HDGF | Affinity Capture-MS, tandem affinity purification | association, physical | 21907836, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KEAP1 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | physical, physical association | 17046835, 18387606, 19615732, 24127568, 27621311, (Europe PMC) | 0.40 | BioGRID, IntAct |
| LMNA | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MAGOH | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23084401, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAP3K5 | anti tag coimmunoprecipitation | physical association | 19590015, (Europe PMC) | 0.40 | IntAct |
| MICAL3 | pull down | association | 27528609, (Europe PMC) | 0.35 | IntAct |
| MRPL58 | anti tag coimmunoprecipitation | association | 20186120, (Europe PMC) | 0.35 | IntAct, MINT |
| MYH7B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OSBPL10 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PCBD1 | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| PGAM5 | Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | physical, physical association | 22265414, 27218139, (Europe PMC) | 0.40 | BioGRID, IntAct |
| RIPK1 | anti tag coimmunoprecipitation | physical association | 22265414, (Europe PMC) | 0.40 | IntAct |
| RIPK3 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical association | 22265414, (Europe PMC) | 0.40, 0.46 | IntAct |
| RNPS1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| SETDB1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SLX4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 19596235, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STRN | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24366813, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STRN3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24366813, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TGOLN2 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TJP2 | Proximity Label-MS, proximity-dependent biotin identification | colocalization, physical | 24255178, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TNS2 | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| TUBA1A | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TUBA1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| USP11 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| VCAM1 | cross-linking study | association | 22623428, (Europe PMC) | 0.35 | IntAct |
| ZBTB16 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZC3H18 | anti tag coimmunoprecipitation | association | 29298432, (Europe PMC) | 0.35 | IntAct |
| ZRANB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ZSCAN26 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| MRPL58 | anti tag coimmunoprecipitation | association | 20186120, (Europe PMC) | 0.35 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AIFM1 | Affinity Capture-MS, Affinity Capture-Western, pull down | association, physical | 27218139, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ASB10 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB14 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB18 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB3 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASXL1 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| BAP1 | tandem affinity purification | association | 27705803, (Europe PMC) | 0.35 | IntAct |
| BARD1 | Affinity Capture-MS | physical | 22990118, (Europe PMC) | NA | BioGRID |
| BCL2L1 | Affinity Capture-Western | physical | 17046835, (Europe PMC) | NA | BioGRID |
| BIRC2 | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 23201124, (Europe PMC) | NA | BioGRID |
| BMI1 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| BRCA1 | Affinity Capture-MS | physical | 25184681, (Europe PMC) | NA | BioGRID |
| CANX | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CCDC8 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CDK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| COPS5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL3 | Affinity Capture-MS, Affinity Capture-Western | physical | 17046835, 21145461, (Europe PMC) | NA | BioGRID |
| CUL4B | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| DNM1L | anti tag coimmunoprecipitation | physical association | 22265414, (Europe PMC) | 0.40 | IntAct |
| ECT2 | Affinity Capture-MS | physical | 22990118, (Europe PMC) | NA | BioGRID |
| EIF4A3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23084401, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ESR1 | Affinity Capture-MS, affinity chromatography technology, cosedimentation through density gradient | association, physical | 21182205, (Europe PMC) | 0.46 | BioGRID, IntAct |
| EZR | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| FN1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, (Europe PMC) | 0.35 | BioGRID, IntAct |
| G3BP1 | Affinity Capture-MS | physical | 26777405, (Europe PMC) | NA | BioGRID |
| GLI1 | Affinity Capture-MS | physical | 26603838, (Europe PMC) | NA | BioGRID |
| HAUS1 | Affinity Capture-MS | physical | 23443559, (Europe PMC) | NA | BioGRID |
| HDAC5 | Affinity Capture-MS | physical | 21081666, (Europe PMC) | NA | BioGRID |
| HDGF | Affinity Capture-MS, tandem affinity purification | association, physical | 21907836, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSPA1B | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| HUWE1 | Affinity Capture-MS | physical | 25147182, (Europe PMC) | NA | BioGRID |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KEAP1 | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | physical, physical association | 17046835, 18387606, 19615732, 24127568, 27621311, (Europe PMC) | 0.40 | BioGRID, IntAct |
| LMNA | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MAGOH | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23084401, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAP3K5 | anti tag coimmunoprecipitation | physical association | 19590015, (Europe PMC) | 0.40 | IntAct |
| MDC1 | Affinity Capture-MS | physical | 22990118, (Europe PMC) | NA | BioGRID |
| MICAL3 | pull down | association | 27528609, (Europe PMC) | 0.35 | IntAct |
| MIR106A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR106B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR107 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR10B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR128-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR141 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR145 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR15A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR16-1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR18B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR200B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR205 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR206 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR20B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR21 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR214 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR25 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR34A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR451A | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIR93 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7A1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7A2 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7B | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7E | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MIRLET7F1 | Affinity Capture-RNA | physical | 28431233, (Europe PMC) | NA | BioGRID |
| MRPL58 | Affinity Capture-MS | physical | 20186120, (Europe PMC) | NA | BioGRID |
| MRPL58 | anti tag coimmunoprecipitation | association | 20186120, (Europe PMC) | 0.35 | IntAct, MINT |
| MYH7B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NF2 | Affinity Capture-MS | physical | 26549023, (Europe PMC) | NA | BioGRID |
| NFE2L2 | Affinity Capture-Western | physical | 18387606, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| OSBPL10 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PAXIP1 | Affinity Capture-MS | physical | 22990118, (Europe PMC) | NA | BioGRID |
| PCBD1 | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| PGAM5 | Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | physical, physical association | 22265414, 27218139, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PINK1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity | physical | 21151955, (Europe PMC) | NA | BioGRID |
| PRKN | Affinity Capture-MS | physical | 24244333, (Europe PMC) | NA | BioGRID |
| RBX1 | Affinity Capture-Western | physical | 17046835, (Europe PMC) | NA | BioGRID |
| RIPK1 | anti tag coimmunoprecipitation | physical association | 22265414, (Europe PMC) | 0.40 | IntAct |
| RIPK3 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical association | 22265414, (Europe PMC) | 0.40, 0.46 | IntAct |
| RNF2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| RNPS1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| SETDB1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SIRT7 | Affinity Capture-MS | physical | 22586326, (Europe PMC) | NA | BioGRID |
| SLX4 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 19596235, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STRN | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24366813, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STRN3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 24366813, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SUZ12 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| TGOLN2 | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TJP2 | Proximity Label-MS, proximity-dependent biotin identification | colocalization, physical | 24255178, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TNS2 | proximity-dependent biotin identification, pull down | association | 28330616, (Europe PMC) | 0.46 | IntAct |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TUBA1A | pull down | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TUBA1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| USP11 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| VCAM1 | cross-linking study | association | 22623428, (Europe PMC) | 0.35 | IntAct |
| XIAP | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 23201124, (Europe PMC) | NA | BioGRID |
| YAP1 | Affinity Capture-MS | physical | 25796446, (Europe PMC) | NA | BioGRID |
| ZBTB16 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZC3H18 | anti tag coimmunoprecipitation | association | 29298432, (Europe PMC) | 0.35 | IntAct |
| ZNF746 | Affinity Capture-MS | physical | 25315684, (Europe PMC) | NA | BioGRID |
| ZRANB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 19615732, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ZSCAN26 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| Phosphorylating Kinases | Phosphoresidues | Detection Method | PubMed IDs | Source |
| Unknown | S80_VRKRNVEsGEEELAS, S87_SGEEELAsKLDHYKA, | in vivo | 19651622, 20068231,(Europe PMC) | HPRD, |