- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
OCRL
Gene Name  | OCRL (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | OCRL, INPP5F, OCRL1 | |
| Protein Name | OCRL |
|
| Alternative Name(s) |
Inositol polyphosphate 5-phosphatase OCRL-1;3.1.3.36;Lowe oculocerebrorenal syndrome protein; | |
| EntrezGene ID | 4952 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q01968 (protein sequence) | |
| Enzyme Class | EC 3.1.3.36 (BRENDA ) | |
| Molecular Weight | 104205 Dalton | |
| Protein Length | 901 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000122126 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: inositol-5-phosphatases (IP) | Historic class: Inositol-1,4,5-trisphosphate 5-phosphatase | CATH ID: 3.60.10.10 | SCOP Fold: DNase I | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasmic vesicle, phagosome membrane Early endosome membrane Membrane, clathrin-coated pit Cell projection, cilium,photoreceptor outer segment Cellprojection, cilium Cytoplasmicvesicle Endosome Golgi apparatus, trans-Golginetwork Note=Also found onmacropinosomes | |||
| Function (UniProt annotation) | |||
| Converts phosphatidylinositol 4,5-bisphosphate tophosphatidylinositol 4-phosphate Also converts inositol 1,4,5-trisphosphate to inositol 1,4-bisphosphate and inositol 1,3,4,5-tetrakisphosphate to inositol 1,3,4-trisphosphate(PubMed:25869668, PubMed:7761412, PubMed:9430698) May function inlysosomal membrane trafficking by regulating the specific pool ofphosphatidylinositol 4,5-bisphosphate that is associated withlysosomes Involved in primary cilia assembly (PubMed:22228094,PubMed:22543976) | |||
| Catalytic Activity (UniProt annotation) | |||
| 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 4-phosphate+ phosphate | |||
| Protein Sequence | |||
| MEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEETLLIDIASNS GCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQSQLLVPEQKDSSSWYQKLDTKDKPSVFSGLLGFEDNFSSMNL DKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQTF RFFVGTWNVNGQSPDSGLEPWLNCDPNPPDIYCIGFQELDLSTEAFFYFESVKEQEWSMAVERGLHSKAKYKKVQLVRLV GMMLLIFARKDQCRYIRDIATETVGTGIMGKMGNKGGVAVRFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFV VPNQTLPQLNIMKHEVVIWLGDLNYRLCMPDANEVKSLINKKDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYD SKTDRWDSSGKCRVPAWCDRILWRGTNVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFEDSVRIMDRMEND FLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSK DSVTILNSGEDKIEDILVLHLDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSLLQM VPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETIPGSNHSVAEALLIFLEALPE PVICYELYQRCLDSAYDPRICRQVISQLPRCHRNVFRYLMAFLRELLKFSEYNSVNANMIATLFTSLLLRPPPNLMARQT PSDRQRAIQFLLGFLLGSEED |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0001701 | P:in utero embryonic development |
| GO:0001750 | C:photoreceptor outer segment |
| GO:0004439 | F:phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity |
| GO:0005096 | F:GTPase activator activity |
| GO:0005634 | C:nucleus |
| GO:0005737 | C:cytoplasm |
| GO:0005769 | C:early endosome |
| GO:0005795 | C:Golgi stack |
| GO:0005798 | C:Golgi-associated vesicle |
| GO:0005802 | C:trans-Golgi network |
| GO:0005829 | C:cytosol |
| GO:0005886 | C:plasma membrane |
| GO:0005905 | C:clathrin-coated pit |
| GO:0006629 | P:lipid metabolic process |
| GO:0006661 | P:phosphatidylinositol biosynthetic process |
| GO:0007165 | P:signal transduction |
| GO:0030136 | C:clathrin-coated vesicle |
| GO:0030670 | C:phagocytic vesicle membrane |
| GO:0031901 | C:early endosome membrane |
| GO:0034596 | F:phosphatidylinositol phosphate 4-phosphatase activity |
| GO:0043087 | P:regulation of GTPase activity |
| GO:0043647 | P:inositol phosphate metabolic process |
| GO:0043813 | F:phosphatidylinositol-3,5-bisphosphate 5-phosphatase activity |
| GO:0046856 | P:phosphatidylinositol dephosphorylation |
| GO:0048365 | F:Rac GTPase binding |
| GO:0051056 | P:regulation of small GTPase mediated signal transduction |
| GO:0052658 | F:inositol-1,4,5-trisphosphate 5-phosphatase activity |
| GO:0052659 | F:inositol-1,3,4,5-tetrakisphosphate 5-phosphatase activity |
| GO:0052745 | F:inositol phosphate phosphatase activity |
| GO:0060271 | P:cilium assembly |
| GO:0061024 | P:membrane organization |
[Feedback|Contribution]
| Substrate ChEBI-ID | Substrate KEGG ID | DephosphoSite | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction | Molecule |
| CHEBI:16595 | C01245 | D5 position | N/A | UniProt, | Europe PMC |  |  |
| CHEBI:16618 | C05981 | D5 position | N/A | UniProt, | Europe PMC | |  |
| CHEBI:16783 | C01272 | D5 position | N/A | UniProt, | Europe PMC | |  |
| CHEBI:18348 | C04637 | D5 position | N/A | UniProt, | Europe PMC | |  |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa00562 | Inositol phosphate metabolism | |
| hsa01100 | Metabolic pathways | |
| hsa04070 | Phosphatidylinositol signaling system | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-1660499 | Synthesis of PIPs at the plasma membrane. | At the plasma membrane, subsequent phosphorylation of phosphatidylinositol 4-phosphate (PI4P) produces phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2) and phosphatidylinositol 3,4,5-trisphosphate (PI(3,4,5)P3) while the actions of various other kinases and phosphatases produces phosphatidylinositol 3-phosphate (PI3P), phosphatidylinositol 5-phosphate (PI5P), phosphatidylinositol 3,4-bisphosphate (PI(3,4)P2), and phosphatidylinositol 3,5-bisphosphate (PI(3,5)P2) (Zhang et al. 1997, Gurung et al. 2003, Guo et al. 1999, Vanhaesebroeck et al. 1997, Tolias et al. 1998, Schaletzky et al. 2003, Kim et al. 2002, Clarke et al. 2010). Many of the phosphatidylinositol phosphatases that act at the plasma membrane belong to the myotubularin family. Enzymatically inactive myotubularin family members can heterodimerize with catalytically active mytotubularins to regulate their stability, activity and/or substrate specificity (Berger et al. 2006, Zou et al. 2012) |
| R-HSA-1660514 | Synthesis of PIPs at the Golgi membrane. | At the Golgi membrane, phosphatidylinositol 4-phosphate (PI4P) is primarily generated from phosphorylation of phosphatidylinositol (PI). Other phosphoinositides are also generated by the action of various kinases and phosphatases such as: phosphatidylinositol 3-phosphate (PI3P), phosphatidylinositol 3,4-bisphosphate (PI(3,4)P2), phosphatidylinositol 3,5-bisphosphate (PI(3,5)P2) (Godi et al. 1999, Minogue et al. 2001, Rohde et al. 2003, Sbrissa et al. 2007, Sbrissa et al. 2008, Domin et al. 2000, Arcaro et al. 2000) |
| R-HSA-1855183 | Synthesis of IP2, IP, and Ins in the cytosol. | Inositol phosphates IP2, IP and the six-carbon cyclic alcohol inositol (Ins) are produced by various phosphatases and the inositol-3-phosphate synthase 1 (ISYNA1) (Ju et al. 2004, Ohnishi et al. 2007, Irvine & Schell 2001, Bunney & Katan 2010) |
| R-HSA-1855204 | Synthesis of IP3 and IP4 in the cytosol. | An array of inositol trisphosphate (IP3) and tetrakisphosphate (IP4) molecules are synthesised by the action of various kinases and phosphatases in the cytosol (Irvine & Schell 2001, Bunney & Katan 2010) |
| R-HSA-194840 | Rho GTPase cycle. | The cycling of Rho GTPases is tightly controlled by three classes of protein. These are (1) guanine nucleotide dissociation inhibitors or GDIs, which maintain Rho proteins in an inactive state in the cytoplasm, (2) guanine nucleotide exchange factors or GEFs, which destabilize the interaction between Rho proteins and their bound nucleotide, the net result of which is the exchange of bound GDP for the more abundant GTP, and (3) GTPase Activating Proteins or GAPs, which stimulate the low intrinsic GTP hydrolysis activity of Rho family members, thus promoting their inactivation. GDIs, GEFs, and GAPs are themselves subject to tight regulation, and the overall level of Rho activity reflects the balance of their activities. In their active GTP-bound state, Rho family members have the ability to interact with a large variety of so-called effector proteins. By changing the subcellular localization of effectors, by altering their enzymatic properties, or by directing the formation of specific effector complexes, members of the Rho family mediate their various effects. This Rho GTPase cycle is diagrammed in the figure below. External or internal cues promote the release of Rho GTPases from the inhibitory complex (1) which allows them to associate with the plasma membrane (2) where they are activated by GEFs (3) and can signal to effector proteins. Then, GAPs inactivate the GTPases by accelerating the intrinsic GTPase activity, leading to the GDP bound form (4). Once again, the GDI molecules stabilize the inactive GDP bound form in the cytoplasm, waiting for further instructions (5). (Figure and text from Tcherkezian and Lamarche Vane, 2007) |
| R-HSA-432722 | Golgi Associated Vesicle Biogenesis. | Proteins that have been synthesized, processed and sorted eventually reach the final steps of the secretory pathway. This pathway is responsible not only for proteins that are secreted from the cell but also enzymes and other resident proteins in the lumen of the ER, Golgi, and lysosomes as well as integral proteins transported in the vesicle membranes |
| R-HSA-8856828 | Clathrin-mediated endocytosis. | Clathrin-mediated endocytosis (CME) is one of a number of process that control the uptake of material from the plasma membrane, and leads to the formation of clathrin-coated vesicles (Pearse et al, 1975; reviewed in Robinson, 2015; McMahon and Boucrot, 2011; Kirchhausen et al, 2014). CME contributes to signal transduction by regulating the cell surface expression and signaling of receptor tyrosine kinases (RTKs) and G-protein coupled receptors (GPCRs). Most RTKs exhibit a robust increase in internalization rate after binding specific ligands; however, some RTKs may also exhibit significant ligand-independent internalization (reviewed in Goh and Sorkin, 2013). CME controls RTK and GPCR signaling by organizing signaling both within the plasma membrane and on endosomes (reviewed in Eichel et al, 2016; Garay et al, 2015; Vieira et al, 1996; Sorkin and von Zastrow, 2014; Di Fiori and von Zastrow, 2014; Barbieri et al, 2016). CME also contributes to the uptake of material such as metabolites, hormones and other proteins from the extracellular space, and regulates membrane composition by recycling membrane components and/or targeting them for degradation. Clathrin-mediated endocytosis involves initiation of clathrin-coated pit (CCP) formation, cargo selection, coat assembly and stabilization, membrane scission and vesicle uncoating. Although for simplicity in this pathway, the steps leading to a mature CCP are represented in a linear and temporally distinct fashion, the formation of a clathrin-coated vesicle is a highly heterogeneous process and clear temporal boundaries between these processes may not exist (see for instance Taylor et al, 2011; Antonescu et al, 2011; reviewed in Kirchhausen et al, 2014). Cargo selection in particular is a critical aspect of the formation of a mature and stable CCP, and many of the proteins involved in the initiation and maturation of a CCP contribute to cargo selection and are themselves stabilized upon incorporation of cargo into the nascent vesicle (reviewed in Kirchhausen et al, 2014; McMahon and Boucrot, 2011).Although the clathrin triskelion was identified early as a major component of the coated vesicles, clathrin does not bind directly to membranes or to the endocytosed cargo. Vesicle formation instead relies on many proteins and adaptors that can bind the plasma membrane and interact with cargo molecules. Cargo selection depends on the recognition of endocytic signals in cytoplasmic tails of the cargo proteins by adaptors that interact with components of the vesicle's inner coat. The classic adaptor for clathrin-coated vesicles is the tetrameric AP-2 complex, which along with clathrin was identified early as a major component of the coat. Some cargo indeed bind directly to AP-2, but subsequent work has revealed a large family of proteins collectively known as CLASPs (clathrin- associated sorting proteins) that mediate the recruitment of diverse cargo into the emerging clathrin-coated vesicles (reviewed in Traub and Bonifacino, 2013). Many of these CLASP proteins themselves interact with AP-2 and clathrin, coordinating cargo recruitment with coat formation (Schmid et al, 2006; Edeling et al, 2006; reviewed in Traub and Bonifacino, 2013; Kirchhausen et al, 2014). Initiation of CCP formation is also influenced by lipid composition, regulated by clathrin-associated phosphatases and kinases (reviewed in Picas et al, 2016). The plasma membrane is enriched in PI(4,5)P2. Many of the proteins involved in initiating clathrin-coated pit formation bind to PI(4,5)P2 and induce membrane curvature through their BAR domains (reviewed in McMahon and Boucrot, 2011; Daumke et al, 2014). Epsin also contributes to early membrane curvature through its Epsin N-terminal homology (ENTH) domain, which promotes membrane curvature by inserting into the lipid bilayer (Ford et al, 2002). Following initiation, some CCPs progress to formation of vesicles, while others undergo disassembly at the cell surface without producing vesicles (Ehrlich et al, 2004; Loerke et al, 2009; Loerke et al, 2011; Aguet et al, 2013; Taylor et al, 2011). The assembly and stabilization of nascent CCPs is regulated by several proteins and lipids (Mettlen et al, 2009; Antonescu et al, 2011).Maturation of the emerging clathrin-coated vesicle is accompanied by further changes in the lipid composition of the membrane and increased membrane curvature, promoted by the recruitment of N-BAR domain containing proteins (reviewed in Daumke et al, 2014; Ferguson and De Camilli, 2012; Picas et al, 2016). Some N-BAR domain containing proteins also contribute to the recruitment of the large GTPase dynamin, which is responsible for scission of the mature vesicle from the plasma membrane (Koh et al, 2007; Lundmark and Carlsson, 2003; Soulet et al, 2005; David et al, 1996; Owen et al, 1998; Shupliakov et al, 1997; Taylor et al, 2011; Ferguson et al, 2009; Aguet et al, 2013; Posor et al, 2013; Chappie et al, 2010; Shnyrova et al, 2013; reviewed in Mettlen et al, 2009; Daumke et al, 2014). After vesicle scission, the clathrin coat is dissociated from the new vesicle by the ATPase HSPA8 (also known as HSC70) and its DNAJ cofactor auxilin, priming the vesicle for fusion with a subsequent endocytic compartment and releasing clathrin for reuse (reviewed in McMahon and Boucrot, 2011; Sousa and Laufer, 2015) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AP2A2 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| AP2B1 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| AP2M1 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| AP2S1 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, , (Europe PMC) | 0.27, 0.35 | BioGRID, IntAct |
| APPL1 | Affinity Capture-MS, inference by socio-affinity scoring, pull down, tandem affinity purification | association, physical, physical association | 21378754, 27173435, , (Europe PMC) | 0.35, 0.53 | BioGRID, IntAct, MINT |
| BTN2A1 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| C16orf70 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| C9orf78 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| CACNG4 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| CEP128 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP170 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTA | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| CLTB | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| CLTC | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, pull down, surface plasmon resonance | association, direct interaction, physical, physical association | 16902405, 19536138, 25107275, 26496610, (Europe PMC) | 0.80 | BioGRID, IntAct, MINT |
| DHX9 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| EIF3CL | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, , (Europe PMC) | 0.27, 0.35 | BioGRID, IntAct |
| EIF3E | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| ELAVL1 | Affinity Capture-RNA, anti tag coimmunoprecipitation | association, physical | 19322201, 25107275, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| ENPP6 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| GOLGA5 | Two-hybrid | physical | 9915833, (Europe PMC) | NA | BioGRID |
| GRB2 | Reconstituted Complex | physical | 9038219, (Europe PMC) | NA | BioGRID |
| GTSE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25107275, 26496610, (Europe PMC) | 0.53 | BioGRID, IntAct, MINT |
| HERC2 | Affinity Capture-MS | physical | 25476789, (Europe PMC) | NA | BioGRID |
| IL1R2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| INPP5B | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NXF1 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| PAK2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| PCBP3 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| PHETA1 | Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification | physical | 20133602, 28514442, (Europe PMC) | NA | BioGRID |
| PHETA2 | Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification | physical | 20133602, 28514442, (Europe PMC) | NA | BioGRID |
| PLEKHJ1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25107275, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| RAB14 | Reconstituted Complex, enzyme linked immunosorbent assay, pull down, two hybrid | direct interaction, physical, physical association | 16902405, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| RAB1A | Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, pull down, two hybrid | association, direct interaction, physical, physical association | 16902405, 25107275, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| RAB5A | Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, fluorescence polarization spectroscopy, imaging technique, molecular sieving, pull down, two hybrid | association, colocalization, direct interaction, physical, physical association | 16902405, 21378754, 25107275, (Europe PMC) | 0.80 | BioGRID, IntAct, MINT |
| RAB6A | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, fluorescence polarization spectroscopy, inference by socio-affinity scoring, molecular sieving, pull down, tandem affinity purification, two hybrid | association, direct interaction, physical, physical association | 16902405, 21378754, 25107275, 27173435, 28514442, , (Europe PMC) | 0.35, 0.84 | BioGRID, IntAct, MINT |
| RAB6B | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| RAB8A | Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, fluorescence microscopy, fluorescence polarization spectroscopy, molecular sieving, pull down, two hybrid, x-ray crystallography | association, colocalization, direct interaction, physical, physical association | 16902405, 21378754, 26824392, (Europe PMC) | 0.82 | BioGRID, IntAct, MINT |
| SCLT1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SCN2B | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| SNX21 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| SNX33 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, , (Europe PMC) | 0.27, 0.35 | BioGRID, IntAct |
| SNX9 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.61 | BioGRID, IntAct, MINT |
| SPINT2 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| SSX2IP | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TMEM17 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TPCN2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| VSIG4 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACTA2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTB | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTBL2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTC1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTG1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTG2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| AP1B1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| AP1G1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| AP2A1 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, 28514442, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| AP2A2 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| AP2B1 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| AP2M1 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| AP2S1 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, , (Europe PMC) | 0.27, 0.35 | BioGRID, IntAct |
| APPL1 | Affinity Capture-MS, inference by socio-affinity scoring, pull down, tandem affinity purification | association, physical, physical association | 21378754, 27173435, , (Europe PMC) | 0.35, 0.53 | BioGRID, IntAct, MINT |
| ATG9A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ATP2C1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| B4GALT1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| BCAR1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| BET1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| BMP2K | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CAPZA1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CAPZB | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CBX8 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CEP128 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP170 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CFL1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CHPT1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CLINT1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CLTA | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| CLTB | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| CLTC | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, pull down, surface plasmon resonance | association, direct interaction, physical, physical association | 16902405, 19536138, 25107275, 26496610, (Europe PMC) | 0.80 | BioGRID, IntAct, MINT |
| CLTCL1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CMYA5 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| DBN1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| DHX9 | inference by socio-affinity scoring, tandem affinity purification | association, physical association | 27173435, , (Europe PMC) | 0.27, 0.35 | IntAct |
| DNAJC13 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| EEF2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| EIF3CL | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, , (Europe PMC) | 0.27, 0.35 | BioGRID, IntAct |
| EIF3E | inference by socio-affinity scoring, tandem affinity purification | association, physical association | 27173435, , (Europe PMC) | 0.27, 0.35 | IntAct |
| ELAVL1 | Affinity Capture-RNA, anti tag coimmunoprecipitation | association, physical | 19322201, 25107275, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| ERC1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ERC2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ESR2 | tandem affinity purification | association | 25604459, (Europe PMC) | 0.35 | IntAct |
| EXOSC10 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| EZR | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| FAM109A | anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach | association, physical association | 25107275, , (Europe PMC) | 0.35, 0.49 | IntAct, MINT |
| FAM109B | anti tag coimmunoprecipitation, barcode fusion genetics two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | association, physical association | 25107275, 27107012, , (Europe PMC) | 0.35, 0.67 | IntAct, MINT |
| FLOT1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| FYN | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GAK | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GALNT2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GLG1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GLT8D1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GNAI1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GNAI2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GNAI3 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GNAO1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLGA1 | fluorescence microscopy | colocalization | 21971085, (Europe PMC) | 0.27 | IntAct, MINT |
| GOLGA2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLGB1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLIM4 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLM1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLT1B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOSR1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOSR2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GTSE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25107275, 26496610, (Europe PMC) | 0.53 | BioGRID, IntAct, MINT |
| H1FX | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HEATR1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HERC2 | anti tag coimmunoprecipitation | association | 29426014, (Europe PMC) | 0.35 | IntAct |
| HS2ST1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HSP90AA1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HSP90AB1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HSPD1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| IGF2R | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| LIMA1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| LMO7 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| LPL | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| LRP2 | fluorescence microscopy | colocalization | 21971085, (Europe PMC) | 0.27 | IntAct, MINT |
| MISP | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MLF2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYH10 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYH9 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYL12A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYL12B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYL6 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYL9 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYO1B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYO1C | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYO1E | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NAPA | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NEXN | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NONO | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NSF | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NUMB | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PHGDH | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PHLDB2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PICALM | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PIK3C2A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PKM | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PLEC | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| PLEKHJ1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25107275, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| PRDX3 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PRRC2A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB11A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB13 | fluorescence polarization spectroscopy | direct interaction | 21378754, (Europe PMC) | 0.44 | IntAct, MINT |
| RAB14 | Reconstituted Complex, enzyme linked immunosorbent assay, pull down, two hybrid | direct interaction, physical, physical association | 16902405, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| RAB1A | Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, pull down, two hybrid | association, direct interaction, physical, physical association | 16902405, 25107275, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| RAB1B | anti tag coimmunoprecipitation, fluorescence polarization spectroscopy, molecular sieving | association, direct interaction | 21378754, 25107275, (Europe PMC) | 0.67 | IntAct, MINT |
| RAB1C | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB31 | fluorescence polarization spectroscopy | direct interaction | 21378754, (Europe PMC) | 0.44 | IntAct, MINT |
| RAB3A | fluorescence polarization spectroscopy | direct interaction | 21378754, (Europe PMC) | 0.44 | IntAct, MINT |
| RAB5A | Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, fluorescence polarization spectroscopy, imaging technique, molecular sieving, pull down, two hybrid | association, colocalization, direct interaction, physical, physical association | 16902405, 21378754, 25107275, (Europe PMC) | 0.80 | BioGRID, IntAct, MINT |
| RAB5B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB5C | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB6A | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, fluorescence polarization spectroscopy, inference by socio-affinity scoring, molecular sieving, pull down, tandem affinity purification, two hybrid | association, direct interaction, physical, physical association | 16902405, 21378754, 25107275, 27173435, 28514442, , (Europe PMC) | 0.35, 0.84 | BioGRID, IntAct, MINT |
| RAB7A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB8A | Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, fluorescence microscopy, fluorescence polarization spectroscopy, molecular sieving, pull down, two hybrid, x-ray crystallography | association, colocalization, direct interaction, physical, physical association | 16902405, 21378754, 26824392, (Europe PMC) | 0.82 | BioGRID, IntAct, MINT |
| RAC1 | anti bait coimmunoprecipitation, fluorescence microscopy, pull down | colocalization, physical association | 12915445, (Europe PMC) | 0.56 | IntAct, MINT |
| RAN | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| REXO4 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SAP30BP | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SCFD1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SCLT1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC13 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SEC16A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SEC22B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SFN | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SFPQ | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SLC35E1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SLC38A2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SLC3A2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SLC7A5 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SMAP2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SNX33 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, , (Europe PMC) | 0.27, 0.35 | BioGRID, IntAct |
| SNX9 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.61 | BioGRID, IntAct, MINT |
| SORBS2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SPTAN1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SPTBN1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SRC | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SSX2IP | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STX10 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| STX16 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| STX8 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SURF4 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SYNPO | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TFRC | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TGOLN2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TMED10 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TMED7 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TMED9 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TMEM17 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TMOD3 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TNK2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TPR | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TRIM27 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| USP7 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| VIM | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| VPS45 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| VTI1B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| WNK1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| YES1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACTA2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTB | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTBL2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTC1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTG1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTG2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| AP1B1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| AP1G1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| AP2A1 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, 28514442, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| AP2A2 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| AP2B1 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| AP2M1 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| APPL1 | Affinity Capture-MS, inference by socio-affinity scoring, pull down, tandem affinity purification | association, physical, physical association | 21378754, 27173435, , (Europe PMC) | 0.35, 0.53 | BioGRID, IntAct, MINT |
| ATG9A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ATP2C1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| B4GALT1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| BMP2K | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CAPZA1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CAPZB | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CBX8 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CFL1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CHPT1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CLINT1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CLTA | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| CLTB | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| CLTC | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, pull down, surface plasmon resonance | association, direct interaction, physical, physical association | 16902405, 19536138, 25107275, 26496610, (Europe PMC) | 0.80 | BioGRID, IntAct, MINT |
| CLTCL1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CMYA5 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| DBN1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| DNAJC13 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| EEF2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ELAVL1 | Affinity Capture-RNA, anti tag coimmunoprecipitation | association, physical | 19322201, 25107275, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| ERC1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ERC2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| EXOSC10 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| FAM109A | anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach | association, physical association | 25107275, , (Europe PMC) | 0.35, 0.49 | IntAct, MINT |
| FAM109B | anti tag coimmunoprecipitation, barcode fusion genetics two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | association, physical association | 25107275, 27107012, , (Europe PMC) | 0.35, 0.67 | IntAct, MINT |
| FLOT1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| FYN | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GAK | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GALNT2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GLG1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GLT8D1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GNAI1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GNAI2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GNAI3 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GNAO1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLGA1 | fluorescence microscopy | colocalization | 21971085, (Europe PMC) | 0.27 | IntAct, MINT |
| GOLGA2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLGB1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLIM4 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLM1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLT1B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOSR1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOSR2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GTSE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25107275, 26496610, (Europe PMC) | 0.53 | BioGRID, IntAct, MINT |
| H1FX | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HEATR1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HS2ST1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HSP90AA1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HSP90AB1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HSPD1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| IGF2R | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| LIMA1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| LMO7 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| LPL | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| LRP2 | fluorescence microscopy | colocalization | 21971085, (Europe PMC) | 0.27 | IntAct, MINT |
| MISP | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MLF2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYH10 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYH9 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYL12A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYL12B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYL6 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYL9 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYO1B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYO1C | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYO1E | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NAPA | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NEXN | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NONO | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NSF | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NUMB | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PHGDH | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PHLDB2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PICALM | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PIK3C2A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PKM | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PLEC | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PLEKHJ1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25107275, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| PRDX3 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PRRC2A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB11A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB13 | fluorescence polarization spectroscopy | direct interaction | 21378754, (Europe PMC) | 0.44 | IntAct, MINT |
| RAB14 | Reconstituted Complex, enzyme linked immunosorbent assay, pull down, two hybrid | direct interaction, physical, physical association | 16902405, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| RAB1A | Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, pull down, two hybrid | association, direct interaction, physical, physical association | 16902405, 25107275, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| RAB1B | anti tag coimmunoprecipitation, fluorescence polarization spectroscopy, molecular sieving | association, direct interaction | 21378754, 25107275, (Europe PMC) | 0.67 | IntAct, MINT |
| RAB1C | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB31 | fluorescence polarization spectroscopy | direct interaction | 21378754, (Europe PMC) | 0.44 | IntAct, MINT |
| RAB3A | fluorescence polarization spectroscopy | direct interaction | 21378754, (Europe PMC) | 0.44 | IntAct, MINT |
| RAB5A | Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, fluorescence polarization spectroscopy, imaging technique, molecular sieving, pull down, two hybrid | association, colocalization, direct interaction, physical, physical association | 16902405, 21378754, 25107275, (Europe PMC) | 0.80 | BioGRID, IntAct, MINT |
| RAB5B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB5C | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB6A | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, fluorescence polarization spectroscopy, inference by socio-affinity scoring, molecular sieving, pull down, tandem affinity purification, two hybrid | association, direct interaction, physical, physical association | 16902405, 21378754, 25107275, 27173435, 28514442, , (Europe PMC) | 0.35, 0.84 | BioGRID, IntAct, MINT |
| RAB7A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB8A | Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, fluorescence microscopy, fluorescence polarization spectroscopy, molecular sieving, pull down, two hybrid, x-ray crystallography | association, colocalization, direct interaction, physical, physical association | 16902405, 21378754, 26824392, (Europe PMC) | 0.82 | BioGRID, IntAct, MINT |
| RAC1 | anti bait coimmunoprecipitation, fluorescence microscopy, pull down | colocalization, physical association | 12915445, (Europe PMC) | 0.56 | IntAct, MINT |
| RAN | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| REXO4 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SAP30BP | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SCFD1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SEC13 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SEC16A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SEC22B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SFN | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SFPQ | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SLC35E1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SLC38A2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SLC3A2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SLC7A5 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SMAP2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SNX9 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.61 | BioGRID, IntAct, MINT |
| SORBS2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SPTAN1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SPTBN1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SRC | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| STX10 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| STX16 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| STX8 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SURF4 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SYNPO | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TFRC | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TMED10 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TMED7 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TMED9 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TMOD3 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TNK2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TPR | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TRIM27 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| USP7 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| VIM | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| VPS45 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| VTI1B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| WNK1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| YES1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACTA2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTB | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTBL2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTC1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTG1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ACTG2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| AP1B1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| AP1G1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| AP2A1 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, 28514442, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| AP2A2 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| AP2B1 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| AP2M1 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| AP2S1 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, , (Europe PMC) | 0.27, 0.35 | BioGRID, IntAct |
| APPL1 | Affinity Capture-MS, inference by socio-affinity scoring, pull down, tandem affinity purification | association, physical, physical association | 21378754, 27173435, , (Europe PMC) | 0.35, 0.53 | BioGRID, IntAct, MINT |
| ATG9A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ATP2C1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| B4GALT1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| BCAR1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| BET1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| BMP2K | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| BTN2A1 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| C16orf70 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| C9orf78 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| CACNG4 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| CAPZA1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CAPZB | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CBX8 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CEP128 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP170 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CFL1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CHPT1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CLINT1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CLTA | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| CLTB | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct, MINT |
| CLTC | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, pull down, surface plasmon resonance | association, direct interaction, physical, physical association | 16902405, 19536138, 25107275, 26496610, (Europe PMC) | 0.80 | BioGRID, IntAct, MINT |
| CLTCL1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| CMYA5 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| DBN1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| DHX9 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| DHX9 | inference by socio-affinity scoring, tandem affinity purification | association, physical association | 27173435, , (Europe PMC) | 0.27, 0.35 | IntAct |
| DNAJC13 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| EEF2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| EIF3CL | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, , (Europe PMC) | 0.27, 0.35 | BioGRID, IntAct |
| EIF3E | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| EIF3E | inference by socio-affinity scoring, tandem affinity purification | association, physical association | 27173435, , (Europe PMC) | 0.27, 0.35 | IntAct |
| ELAVL1 | Affinity Capture-RNA, anti tag coimmunoprecipitation | association, physical | 19322201, 25107275, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| ENPP6 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| ERC1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ERC2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| ESR2 | tandem affinity purification | association | 25604459, (Europe PMC) | 0.35 | IntAct |
| EXOSC10 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| EZR | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| FAM109A | anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach | association, physical association | 25107275, , (Europe PMC) | 0.35, 0.49 | IntAct, MINT |
| FAM109B | anti tag coimmunoprecipitation, barcode fusion genetics two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | association, physical association | 25107275, 27107012, , (Europe PMC) | 0.35, 0.67 | IntAct, MINT |
| FLOT1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| FYN | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GAK | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GALNT2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GLG1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GLT8D1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GNAI1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GNAI2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GNAI3 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GNAO1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLGA1 | fluorescence microscopy | colocalization | 21971085, (Europe PMC) | 0.27 | IntAct, MINT |
| GOLGA2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLGA5 | Two-hybrid | physical | 9915833, (Europe PMC) | NA | BioGRID |
| GOLGB1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLIM4 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLM1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOLT1B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOSR1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GOSR2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| GRB2 | Reconstituted Complex | physical | 9038219, (Europe PMC) | NA | BioGRID |
| GTSE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25107275, 26496610, (Europe PMC) | 0.53 | BioGRID, IntAct, MINT |
| H1FX | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HEATR1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HERC2 | Affinity Capture-MS | physical | 25476789, (Europe PMC) | NA | BioGRID |
| HERC2 | anti tag coimmunoprecipitation | association | 29426014, (Europe PMC) | 0.35 | IntAct |
| HS2ST1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HSP90AA1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HSP90AB1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| HSPD1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| IGF2R | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| IL1R2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| INPP5B | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| LIMA1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| LMO7 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| LPL | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| LRP2 | fluorescence microscopy | colocalization | 21971085, (Europe PMC) | 0.27 | IntAct, MINT |
| MISP | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MLF2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYH10 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYH9 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYL12A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYL12B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYL6 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYL9 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYO1B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYO1C | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| MYO1E | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NAPA | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NEXN | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NONO | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NSF | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUMB | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| NXF1 | Affinity Capture-RNA | physical | 22658674, (Europe PMC) | NA | BioGRID |
| PAK2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| PCBP3 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| PHETA1 | Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification | physical | 20133602, 28514442, (Europe PMC) | NA | BioGRID |
| PHETA2 | Affinity Capture-MS, Affinity Capture-Western, Co-localization, Co-purification | physical | 20133602, 28514442, (Europe PMC) | NA | BioGRID |
| PHGDH | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PHLDB2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PICALM | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PIK3C2A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PKM | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PLEC | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| PLEKHJ1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25107275, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| PRDX3 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PRRC2A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB11A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB13 | fluorescence polarization spectroscopy | direct interaction | 21378754, (Europe PMC) | 0.44 | IntAct, MINT |
| RAB14 | Reconstituted Complex, enzyme linked immunosorbent assay, pull down, two hybrid | direct interaction, physical, physical association | 16902405, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| RAB1A | Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, pull down, two hybrid | association, direct interaction, physical, physical association | 16902405, 25107275, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| RAB1B | anti tag coimmunoprecipitation, fluorescence polarization spectroscopy, molecular sieving | association, direct interaction | 21378754, 25107275, (Europe PMC) | 0.67 | IntAct, MINT |
| RAB1C | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB31 | fluorescence polarization spectroscopy | direct interaction | 21378754, (Europe PMC) | 0.44 | IntAct, MINT |
| RAB3A | fluorescence polarization spectroscopy | direct interaction | 21378754, (Europe PMC) | 0.44 | IntAct, MINT |
| RAB5A | Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, fluorescence polarization spectroscopy, imaging technique, molecular sieving, pull down, two hybrid | association, colocalization, direct interaction, physical, physical association | 16902405, 21378754, 25107275, (Europe PMC) | 0.80 | BioGRID, IntAct, MINT |
| RAB5B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB5C | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB6A | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, fluorescence polarization spectroscopy, inference by socio-affinity scoring, molecular sieving, pull down, tandem affinity purification, two hybrid | association, direct interaction, physical, physical association | 16902405, 21378754, 25107275, 27173435, 28514442, , (Europe PMC) | 0.35, 0.84 | BioGRID, IntAct, MINT |
| RAB6B | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| RAB7A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB8A | Reconstituted Complex, anti tag coimmunoprecipitation, enzyme linked immunosorbent assay, fluorescence microscopy, fluorescence polarization spectroscopy, molecular sieving, pull down, two hybrid, x-ray crystallography | association, colocalization, direct interaction, physical, physical association | 16902405, 21378754, 26824392, (Europe PMC) | 0.82 | BioGRID, IntAct, MINT |
| RAC1 | anti bait coimmunoprecipitation, fluorescence microscopy, pull down | colocalization, physical association | 12915445, (Europe PMC) | 0.56 | IntAct, MINT |
| RAN | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| REXO4 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SAP30BP | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SCFD1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SCLT1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SCN2B | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| SEC13 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SEC16A | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SEC22B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SFN | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SFPQ | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SLC35E1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SLC38A2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SLC3A2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SLC7A5 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SMAP2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SNX21 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| SNX33 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, , (Europe PMC) | 0.27, 0.35 | BioGRID, IntAct |
| SNX9 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 25107275, 27173435, , (Europe PMC) | 0.35, 0.61 | BioGRID, IntAct, MINT |
| SORBS2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SPINT2 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| SPTAN1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SPTBN1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SRC | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SSX2IP | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STX10 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| STX16 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| STX8 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SURF4 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| SYNPO | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TFRC | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TGOLN2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TMED10 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TMED7 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TMED9 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TMEM17 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TMOD3 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TNK2 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TPCN2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| TPR | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| TRIM27 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| USP7 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| VIM | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| VPS45 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| VSIG4 | Affinity Capture-MS | physical | 26186194, (Europe PMC) | NA | BioGRID |
| VTI1B | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| WNK1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| YES1 | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
[Feedback|Contribution]