Top LPIN3
Localization (UniProt annotation) Nucleus Function (UniProt annotation) Regulates fatty acid metabolism Magnesium-dependentphosphatidate phosphatase enzyme which catalyzes the conversion ofphosphatidic acid to diacylglycerol during triglyceride,phosphatidylcholine and phosphatidylethanolamine biosynthesis (Bysimilarity) Catalytic Activity (UniProt annotation) A 1,2-diacylglycerol 3-phosphate + H(2)O = a1,2-diacyl-sn-glycerol + phosphate Protein Sequence MNYVGQLAETVFGTVKELYRGLNPATLSGGIDVLVVKQVDGSFRCSPFHVRFGKLGVLRSREKVVDIELNGEPVDLHMKL
GDSGEAFFVQELESDDEHVPPGLCTSPIPWGGLSGFPSDSQLGTASEPEGLVMAGTASTGRRKRRRRRKPKQKEDAVATD
SSPEELEAGAESELSLPEKLRPEPPGVQLEEKSSLQPKDIYPYSDGEWPPQASLSAGELTSPKSDSELEVRTPEPSPLRA
ESHMQWAWGRLPKVARAERPESSVVLEGRAGATSPPRGGPSTPSTSVAGGVDPLGLPIQQTEAGADLQPDTEDPTLVGPP
LHTPETEESKTQSSGDMGLPPASKSWSWATLEVPVPTGQPERVSRGKGSPKRSQHLGPSDIYLDDLPSLDSENAALYFPQ
SDSGLGARRWSEPSSQKSLRDPNPEHEPEPTLDTVDTIALSLCGGLADSRDISLEKFNQHSVSYQDLTKNPGLLDDPNLV
VKINGKHYNWAVAAPMILSLQAFQKNLPKSTMDKLEREKMPRKGGRWWFSWRRRDFLAEERSAQKEKTAAKEQQGEKTEV
LSSDDDAPDSPVILEIPSLPPSTPPSTPTYKKSLRLSSDQIRRLNLQEGANDVVFSVTTQYQGTCRCKATIYLWKWDDKV
VISDIDGTITKSDALGHILPQLGKDWTHQGITSLYHKIQLNGYKFLYCSARAIGMADLTKGYLQWVSEGGCSLPKGPILL
SPSSLFSALHREVIEKKPEVFKVACLSDIQQLFLPHGQPFYAAFGNRPNDVFAYRQVGLPESRIFTVNPRGELIQELIKN
HKSTYERLGEVVELLFPPVARGPSTDLANPEYSNFCYWREPLPAVDLDTLD
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-1483191 Synthesis of PC. De novo (Kennedy pathway) synthesis of phosphatidylcholine (PC) involves phosphorylation of choline (Cho) to phosphocholine (PCho) followed by condensing with cytidine triphosphate (CTP) to form CDP-choline (CDP-Cho). Diacylglycerol (DAG) and CDP-ETA together then form PC. Alternatively, PC is formed when phosphatidylethanolamine (PE) is methylated by phosphatidylethanolamine N-methyltransferase (PEMT) (Henneberry et al. 2002; Wright & McMaster 2002)R-HSA-1483213 Synthesis of PE. De novo (Kennedy pathway) synthesis of phosphatidylethanolamine (PE) involves phosphorylation of ethanolamine (ETA) to phosphoethanolamine (PETA) followed by condensing with cytidine triphosphate (CTP) to form CDP-ethanolamine (CDP-ETA). Diacylglycerol (DAG) and CDP-ETA together then form PE. Alternatively, PE is formed when phosphatidylserine (PS) is decarboxylated by phosphatidylserine decarboxylase proenzyme (PISD) (Henneberry et al. 2002, Vance 1991, Vance 1990)R-HSA-4419969 Depolymerisation of the Nuclear Lamina. The nuclear envelope breakdown in mitotic prophase involves depolymerisation of lamin filaments, the main constituents of the nuclear lamina. The nuclear lamina is located at the nuclear face of the inner nuclear membrane and plays and important role in the structure and function of the nuclear envelope (reviewed by Burke and Stewart 2012). Depolymerisation of lamin filaments, which consist of lamin homodimers associated through electrostatic interactions in head-to-tail molecular strings, is triggered by phosphorylation of lamins. While CDK1 phosphorylates the N-termini of lamins (Heald and McKeon 1990, Peter et al. 1990, Ward and Kirschner 1990, Mall et al. 2012), PKCs (PRKCA and PRKCB) phosphorylate the C-termini of lamins (Hocevar et al. 1993, Goss et al. 1994, Mall et al. 2012). PKCs are activated by lipid-mediated signaling, where lipins, activated by CTDNEP1:CNEP1R1 serine/threonine protein phosphatase complex, catalyze the formation of DAG (Gorjanacz et al. 2009, Golden et al. 2009, Wu et al. 2011, Han et al. 2012, Mall et al. 2012) R-HSA-75109 Triglyceride biosynthesis. The overall process of triglyceride (triacylglycerol) biosynthesis consists of four biochemical pathways: fatty acyl-CoA biosynthesis, conversion of fatty acyl-CoA to phosphatidic acid, conversion of phosphatidic acid to diacylglycerol, and conversion of diacylglycerol to triacylglycerol
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CAMKK1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CAMSAP2 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID CBY1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct CDC25C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct CSNK2A1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CSNK2A2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CWC25 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct DENND1A Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID DENND4C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct GIGYF2 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID HDAC4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct HDAC6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID INPP5E Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct LPIN1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LPIN2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct MAPKAP1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct NADK Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct NF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct OSBPL6 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct PTPN13 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct RALGPS2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct RASAL2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct RPTOR Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct RTKN Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct SH3RF3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct SMG6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct TANC2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct XPO1 Affinity Capture-MS physical 26673895 , (Europe PMC )NA BioGRID ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CDC25C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct CWC25 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct DENND4C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct HDAC4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct INPP5E Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct MAPKAP1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct NADK Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct NF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct OSBPL6 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct PPP1CA anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PTPN13 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct RALGPS2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct RASAL2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct RPTOR Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct SH3RF3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct TANC2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CAMKK1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CAMSAP2 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID CBY1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct CDC25C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct CSNK2A1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CSNK2A2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CWC25 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct DENND1A Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID DENND4C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct GIGYF2 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID HDAC4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct HDAC6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID INPP5E Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct LPIN1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LPIN2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct MAPKAP1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct NADK Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct NF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct OSBPL6 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct PPP1CA anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PTPN13 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct RALGPS2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct RASAL2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct RPTOR Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct RTKN Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct SH3RF3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct SMG6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct TANC2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct XPO1 Affinity Capture-MS physical 26673895 , (Europe PMC )NA BioGRID ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , Europe PMC )0.27 BioGRID, IntAct
Statistics
