Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
DUSP26
Gene Name  | DUSP26 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | DUSP26, DUSP24, LDP4, MKP8, NATA1, SKRP3 | |
| Protein Name | DUSP26 |
|
| Alternative Name(s) |
Dual specificity protein phosphatase 26;3.1.3.16;3.1.3.48;Dual specificity phosphatase SKRP3;Low-molecular-mass dual-specificity phosphatase 4;DSP-4;LDP-4;Mitogen-activated protein kinase phosphatase 8;MAP kinase phosphatase 8;MKP-8;Novel amplified gene in thyroid anaplastic cancer; | |
| EntrezGene ID | 78986 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q9BV47 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 23946 Dalton | |
| Protein Length | 211 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000133878 (Ensembl) | | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class I Cys-based PTPs --> Family: DSP | Historic class: Class I Cys-based PTPs --> VH1-like or DSPs --> Atypical DSPs | CATH ID: 3.90.190.10 | SCOP Fold: CC1 | |
| Phosphatase activity | active | Catalytic signature motif: HCAVGVSR | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Nucleus Golgi apparatus | |||
| Function (UniProt annotation) | |||
| Inactivates MAPK1 and MAPK3 which leads todephosphorylation of heat shock factor protein 4 and a reductionin its DNA-binding activity Inhibits MAP kinase p38 bydephosphorylating it and inhibits p38-mediated apoptosis inanaplastic thyroid cancer cells Can also induce activation of MAPkinase p38 and c-Jun N-terminal kinase (JNK) | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNR RELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSA TLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000122 | P:negative regulation of transcription by RNA polymerase II |
| GO:0001102 | F:RNA polymerase II activating transcription factor binding |
| GO:0002039 | F:p53 binding |
| GO:0004647 | F:phosphoserine phosphatase activity |
| GO:0004721 | F:phosphoprotein phosphatase activity |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0005634 | C:nucleus |
| GO:0005737 | C:cytoplasm |
| GO:0005794 | C:Golgi apparatus |
| GO:0006470 | P:protein dephosphorylation |
| GO:0008138 | F:protein tyrosine/serine/threonine phosphatase activity |
| GO:0044387 | P:negative regulation of protein kinase activity by regulation of protein phosphorylation |
| GO:0045785 | P:positive regulation of cell adhesion |
| GO:0070062 | C:extracellular exosome |
| GO:0070373 | P:negative regulation of ERK1 and ERK2 cascade |
| GO:1902310 | P:positive regulation of peptidyl-serine dephosphorylation |
