- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
VIM
Gene Name  | VIM (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 3KLT |
| Synonyms | VIM | |
| Protein Name | VIM | |
| Alternative Name(s) | Vimentin; | |
| Protein Family | Belongs to the intermediate filament family | |
| EntrezGene ID | 7431 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P08670 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 53652 Dalton | |
| Protein Length | 466 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000026025 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - ENOG410IFZ1 | eggNOG - ENOG410XRBS | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Cytoplasm, cytoskeleton Nucleus matrix | |||
| Function (UniProt annotation) | |||
| Vimentins are class-III intermediate filaments found invarious non-epithelial cells, especially mesenchymal cellsVimentin is attached to the nucleus, endoplasmic reticulum, andmitochondria, either laterally or terminally Involved with LARP6 in the stabilization of type Icollagen mRNAs for CO1A1 and CO1A2 | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLL QDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQ VDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEE EIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYR RQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATY RKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0003725 | F:double-stranded RNA binding |
| GO:0005200 | F:structural constituent of cytoskeleton |
| GO:0005212 | F:structural constituent of eye lens |
| GO:0005737 | C:cytoplasm |
| GO:0005777 | C:peroxisome |
| GO:0005829 | C:cytosol |
| GO:0005844 | C:polysome |
| GO:0005856 | C:cytoskeleton |
| GO:0005882 | C:intermediate filament |
| GO:0005886 | C:plasma membrane |
| GO:0005925 | C:focal adhesion |
| GO:0008022 | F:protein C-terminus binding |
| GO:0010977 | P:negative regulation of neuron projection development |
| GO:0014002 | P:astrocyte development |
| GO:0016032 | P:viral process |
| GO:0016363 | C:nuclear matrix |
| GO:0019221 | P:cytokine-mediated signaling pathway |
| GO:0019904 | F:protein domain specific binding |
| GO:0030049 | P:muscle filament sliding |
| GO:0031252 | C:cell leading edge |
| GO:0032967 | P:positive regulation of collagen biosynthetic process |
| GO:0042802 | F:identical protein binding |
| GO:0043005 | C:neuron projection |
| GO:0043488 | P:regulation of mRNA stability |
| GO:0045109 | P:intermediate filament organization |
| GO:0045335 | C:phagocytic vesicle |
| GO:0045727 | P:positive regulation of translation |
| GO:0060020 | P:Bergmann glial cell differentiation |
| GO:0060395 | P:SMAD protein signal transduction |
| GO:0070062 | C:extracellular exosome |
| GO:0070307 | P:lens fiber cell development |
| GO:0071222 | P:cellular response to lipopolysaccharide |
| GO:0071225 | P:cellular response to muramyl dipeptide |
| GO:0071346 | P:cellular response to interferon-gamma |
| GO:0097110 | F:scaffold protein binding |
| GO:1990254 | F:keratin filament binding |
| GO:1990904 | C:ribonucleoprotein complex |
VIM is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in VIM (P08670) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PPP2CA | P67775 | NA | In vitro and in vivo | 10359611, | Europe PMC |  |
| PPP2CB | P62714 | NA | In vitro and in vivo | 10359611, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa05169 | Epstein-Barr virus infection | Epstein-Barr virus (EBV) is a gamma-herpes virus that widely infects human populations predominantly at an early age but remains mostly asymptomatic. EBV has been linked to a wide spectrum of human malignancies, including nasopharyngeal carcinoma and other hematologic cancers, like Hodgkin's lymphoma, Burkitt's lymphoma (BL), B-cell immunoblastic lymphoma in HIV patients, and posttransplant-associated lymphoproliferative diseases. EBV has the unique ability to establish life-long latent infection in primary human B lymphocytes. During latent infection, EBV expresses a small subset of genes, including 6 nuclear antigens (EBNA-1, -2, -3A, -3B, -3C, and -LP), 3 latent membrane proteins (LMP-1, -2A, and -2B), 2 small noncoding RNAs (EBER-1 and 2). On the basis of these latent gene expression, three different latency patterns associated with the types of cancers are recognized. |
| hsa05206 | MicroRNAs in cancer | MicroRNA (miRNA) is a cluster of small non-encoding RNA molecules of 21 - 23 nucleotides in length, which controls gene expression post-transcriptionally either via the degradation of target mRNAs or the inhibition of protein translation. Using high-throughput profiling, dysregulation of miRNAs has been widely observed in different stages of cancer. The upregulation (overexpression) of specific miRNAs could lead to the repression of tumor suppressor gene expression, and conversely the downregulation of specific miRNAs could result in an increase of oncogene expression; both these situations induce subsequent malignant effects on cell proliferation, differentiation, and apoptosis that lead to tumor growth and progress. The miRNA signatures of cancer observed in various studies differ significantly. These inconsistencies occur due to the differences in the study populations and methodologies used. This pathway map shows the summarized results from various studies in 9 cancers, each of which is presented in a review article. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-264870 | Caspase-mediated cleavage of cytoskeletal proteins. | Caspase-mediated cleavage of a number of proteins in the cortical actin network ( ) microfilament system and others involved in maintenance of the cytoskeletal architecture (vimentin, or Gas2 and plectin) may directly contribute to apoptotic changes in cell shape |
| R-HSA-390522 | Striated Muscle Contraction. | Striated muscle contraction is a process whereby force is generated within striated muscle tissue, resulting in a change in muscle geometry, or in short, increased force being exerted on the tendons. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. Striated muscle is a type of muscle composed of myofibrils, containing repeating units called sarcomeres, in which the contractile myofibrils are arranged in parallel to the axis of the cell, resulting in transverse or oblique striations observable at the level of the light microscope.Here striated muscle contraction is represented on the basis of calcium binding to the troponin complex, which exposes the active sites of actin. Once the active sites of actin are exposed, the myosin complex bound to ADP can bind actin and the myosin head can pivot, pulling the thin actin and thick myosin filaments past one another. Once the myosin head pivots, ADP is ejected, a fresh ATP can be bound and the energy from the hydrolysis of ATP to ADP is channeled into kinetic energy by resetting the myosin head. With repeated rounds of this cycle the sarcomere containing the thin and thick filaments effectively shortens, forming the basis of muscle contraction |
| R-HSA-6785807 | Interleukin-4 and Interleukin-13 signaling. | Interleukin-4 (IL4) is a principal regulatory cytokine during the immune response, crucially important in allergy and asthma (Nelms et al. 1999). When resting T cells are antigen-activated and expand in response to Interleukin-2 (IL2), they can differentiate as Type 1 (Th1) or Type 2 (Th2) T helper cells. The outcome is influenced by IL4. Th2 cells secrete IL4, which both stimulates Th2 in an autocrine fashion and acts as a potent B cell growth factor to promote humoral immunity (Nelms et al. 1999). Interleukin-13 (IL13) is an immunoregulatory cytokine secreted predominantly by activated Th2 cells. It is a key mediator in the pathogenesis of allergic inflammation. IL13 shares many functional properties with IL4, stemming from the fact that they share a common receptor subunit. IL13 receptors are expressed on human B cells, basophils, eosinophils, mast cells, endothelial cells, fibroblasts, monocytes, macrophages, respiratory epithelial cells, and smooth muscle cells, but unlike IL4, not T cells. Thus IL13 does not appear to be important in the initial differentiation of CD4 T cells into Th2 cells, rather it is important in the effector phase of allergic inflammation (Hershey et al. 2003).\n\nIL4 and IL13 induce “alternative activation” of macrophages, inducing an anti-inflammatory phenotype by signaling through IL4R alpha in a STAT6 dependent manner. This signaling plays an important role in the Th2 response, mediating anti-parasitic effects and aiding wound healing (Gordon & Martinez 2010, Loke et al. 2002)\n\nThere are two types of IL4 receptor complex (Andrews et al. 2006). Type I IL4R (IL4R1) is predominantly expressed on the surface of hematopoietic cells and consists of IL4R and IL2RG, the common gamma chain. Type II IL4R (IL4R2) is predominantly expressed on the surface of nonhematopoietic cells, it consists of IL4R and IL13RA1 and is also the type II receptor for IL13. (Obiri et al. 1995, Aman et al. 1996, Hilton et al. 1996, Miloux et al. 1997, Zhang et al. 1997). The second receptor for IL13 consists of IL4R and Interleukin-13 receptor alpha 2 (IL13RA2), sometimes called Interleukin-13 binding protein (IL13BP). It has a high affinity receptor for IL13 (Kd = 250 pmol/L) but is not sufficient to render cells responsive to IL13, even in the presence of IL4R (Donaldson et al. 1998). It is reported to exist in soluble form (Zhang et al. 1997) and when overexpressed reduces JAK-STAT signaling (Kawakami et al. 2001). It's function may be to prevent IL13 signalling via the functional IL4R:IL13RA1 receptor. IL13RA2 is overexpressed and enhances cell invasion in some human cancers (Joshi & Puri 2012).The first step in the formation of IL4R1 (IL4:IL4R:IL2RB) is the binding of IL4 with IL4R (Hoffman et al. 1995, Shen et al. 1996, Hage et al. 1999). This is also the first step in formation of IL4R2 (IL4:IL4R:IL13RA1). After the initial binding of IL4 and IL4R, IL2RB binds (LaPorte et al. 2008), to form IL4R1. Alternatively, IL13RA1 binds, forming IL4R2. In contrast, the type II IL13 complex (IL13R2) forms with IL13 first binding to IL13RA1 followed by recruitment of IL4R (Wang et al. 2009).Crystal structures of the IL4:IL4R:IL2RG, IL4:IL4R:IL13RA1 and IL13:IL4R:IL13RA1 complexes have been determined (LaPorte et al. 2008). Consistent with these structures, in monocytes IL4R is tyrosine phosphorylated in response to both IL4 and IL13 (Roy et al. 2002, Gordon & Martinez 2010) while IL13RA1 phosphorylation is induced only by IL13 (Roy et al. 2002, LaPorte et al. 2008) and IL2RG phosphorylation is induced only by IL4 (Roy et al. 2002).Both IL4 receptor complexes signal through Jak/STAT cascades. IL4R is constitutively-associated with JAK2 (Roy et al. 2002) and associates with JAK1 following binding of IL4 (Yin et al. 1994) or IL13 (Roy et al. 2002). IL2RG constitutively associates with JAK3 (Boussiotis et al. 1994, Russell et al. 1994). IL13RA1 constitutively associates with TYK2 (Umeshita-Suyama et al. 2000, Roy et al. 2002, LaPorte et al. 2008, Bhattacharjee et al. 2013). IL4 binding to IL4R1 leads to phosphorylation of JAK1 (but not JAK2) and STAT6 activation (Takeda et al. 1994, Ratthe et al. 2007, Bhattacharjee et al. 2013). IL13 binding increases activating tyrosine-99 phosphorylation of IL13RA1 but not that of IL2RG. IL4 binding to IL2RG leads to its tyrosine phosphorylation (Roy et al. 2002). IL13 binding to IL4R2 leads to TYK2 and JAK2 (but not JAK1) phosphorylation (Roy & Cathcart 1998, Roy et al. 2002).Phosphorylated TYK2 binds and phosphorylates STAT6 and possibly STAT1 (Bhattacharjee et al. 2013). A second mechanism of signal transduction activated by IL4 and IL13 leads to the insulin receptor substrate (IRS) family (Kelly-Welch et al. 2003). IL4R1 associates with insulin receptor substrate 2 and activates the PI3K/Akt and Ras/MEK/Erk pathways involved in cell proliferation, survival and translational control. IL4R2 does not associate with insulin receptor substrate 2 and consequently the PI3K/Akt and Ras/MEK/Erk pathways are not activated (Busch-Dienstfertig & González-Rodríguez 2013) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABLIM1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ACTA1 | Affinity Capture-Western | physical | 11441066, (Europe PMC) | NA | BioGRID |
| AHR | Affinity Capture-Western | physical | 27752740, (Europe PMC) | NA | BioGRID |
| AHSA1 | Affinity Capture-MS | physical | 26693507, (Europe PMC) | NA | BioGRID |
| AKT1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, cosedimentation in solution, fluorescence microscopy, protein kinase assay, pull down | association, colocalization, direct interaction, phosphorylation reaction, physical, physical association | 20856200, (Europe PMC) | 0.71 | BioGRID, IntAct |
| AKT2 | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 20856200, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ALK | Affinity Capture-MS | physical | 16105984, (Europe PMC) | NA | BioGRID |
| ANKRD35 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ANXA7 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| APIP | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| APLP1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| APP | Reconstituted Complex | physical | 21832049, (Europe PMC) | NA | BioGRID |
| ARMCX2 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ARRB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17620599, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARRB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17620599, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ASB15 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB16 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB2 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB9 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATN1 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| BAG3 | Affinity Capture-MS | physical | 23824909, (Europe PMC) | NA | BioGRID |
| BASP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| BFSP1 | Reconstituted Complex | physical | 1918147, (Europe PMC) | NA | BioGRID |
| BHLHE40 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BRAF | Affinity Capture-MS | physical | 27034005, (Europe PMC) | NA | BioGRID |
| BRD1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| C2CD6 | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| CAPN1 | Affinity Capture-MS, Two-hybrid | physical | 12358155, 28514442, (Europe PMC) | NA | BioGRID |
| CASP3 | Biochemical Activity | physical | 18723680, (Europe PMC) | NA | BioGRID |
| CASP7 | Biochemical Activity | physical | 18723680, (Europe PMC) | NA | BioGRID |
| CASP8 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CBL | Affinity Capture-MS | physical | 21203488, (Europe PMC) | NA | BioGRID |
| CCT6A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| CD4 | Affinity Capture-MS | physical | 15047060, (Europe PMC) | NA | BioGRID |
| CDC5L | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CDC73 | Affinity Capture-MS | physical | 27462432, (Europe PMC) | NA | BioGRID |
| CDH5 | Affinity Capture-Western | physical | 12003790, (Europe PMC) | NA | BioGRID |
| CDK2 | Affinity Capture-MS | physical | 21319273, (Europe PMC) | NA | BioGRID |
| CDKN1A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CFTR | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 22038833, 26618866, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHD3 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CHFR | Affinity Capture-MS | physical | 19182791, (Europe PMC) | NA | BioGRID |
| CNTRL | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| COPS5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| COPS8 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CRCT1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CREB1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CRMP1 | Reconstituted Complex, Two-hybrid, pull down, two hybrid | physical, physical association | 15383276, 21900206, (Europe PMC) | 0.63 | BioGRID, IntAct, MINT |
| CTSA | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| CUL1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CWF19L2 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| DCTN1 | Affinity Capture-Western | physical | 14600259, (Europe PMC) | NA | BioGRID |
| DDOST | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DES | Affinity Capture-MS, barcode fusion genetics two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 27107012, 28514442, (Europe PMC) | 0.67 | BioGRID, IntAct |
| DIS3L2 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| DPPA4 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DSP | Reconstituted Complex, Two-hybrid | physical | 9261168, (Europe PMC) | NA | BioGRID |
| DYNLT1 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| EEF1D | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| EIF4A3 | Affinity Capture-MS | physical | 23084401, (Europe PMC) | NA | BioGRID |
| ENTR1 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| EPPK1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ESS2 | Two-hybrid | physical | 21900206, (Europe PMC) | NA | BioGRID |
| FABP4 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| FAM107A | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FAM118B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FBXO25 | Affinity Capture-MS | physical | 20473970, (Europe PMC) | NA | BioGRID |
| FBXO6 | Affinity Capture-MS | physical | 22268729, (Europe PMC) | NA | BioGRID |
| FLOT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FN1 | Affinity Capture-MS | physical | 19738201, (Europe PMC) | NA | BioGRID |
| FOXK1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| FUBP1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GADD45A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GAN | Affinity Capture-MS, Affinity Capture-Western | physical | 26460568, 28514442, (Europe PMC) | NA | BioGRID |
| GFAP | Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach | physical, physical association | 16189514, 28514442, (Europe PMC) | 0.62 | BioGRID, IntAct |
| GLB1 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| GOPC | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GRB2 | Two-hybrid, confocal microscopy, two hybrid | colocalization, physical, physical association | 21988832, (Europe PMC) | 0.44 | BioGRID, IntAct |
| GSK3B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GXYLT1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| HABP4 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| HAP1 | Two-hybrid | physical | 15383276, (Europe PMC) | NA | BioGRID |
| HDAC1 | Affinity Capture-MS | physical | 20585571, (Europe PMC) | NA | BioGRID |
| HEY1 | Affinity Capture-MS | physical | 27129302, (Europe PMC) | NA | BioGRID |
| HMG20B | Co-fractionation, Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, 22939629, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HNF1A | Affinity Capture-MS | physical | 18160415, (Europe PMC) | NA | BioGRID |
| HSPA5 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| HSPB1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HTRA2 | Biochemical Activity, Protein-peptide, protease assay | physical, protein cleavage | 17266347, (Europe PMC) | 0.44 | BioGRID, IntAct |
| HYPK | Affinity Capture-MS, Affinity Capture-Western | physical | 23272104, (Europe PMC) | NA | BioGRID |
| IDE | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| INA | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ING5 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ISG15 | Affinity Capture-MS | physical | 16009940, (Europe PMC) | NA | BioGRID |
| ITGA4 | Affinity Capture-MS | physical | 22623428, (Europe PMC) | NA | BioGRID |
| ITGB3 | Affinity Capture-Western | physical | 18840708, (Europe PMC) | NA | BioGRID |
| IVNS1ABP | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KARS | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| KAT7 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 15383276, 16169070, 16189514, 21900206, (Europe PMC) | 0.75 | BioGRID, IntAct, MINT |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KIAA0408 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KIF15 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KRT20 | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 16189514, 25416956, (Europe PMC) | 0.76 | BioGRID, IntAct |
| LGALS3 | Affinity Capture-MS | physical | 24755837, (Europe PMC) | NA | BioGRID |
| LMNB1 | Affinity Capture-Western | physical | 11441066, (Europe PMC) | NA | BioGRID |
| LOR | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LRIF1 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| LRRK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17400507, 19826009, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAFG | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAGOH | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23084401, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAN2A2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MCM5 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MCPH1 | Two-hybrid | physical | 29150431, (Europe PMC) | NA | BioGRID |
| MEN1 | Affinity Capture-Western, Reconstituted Complex | physical | 12169273, (Europe PMC) | NA | BioGRID |
| MGMT | Affinity Capture-MS | physical | 16226712, (Europe PMC) | NA | BioGRID |
| MICAL1 | Affinity Capture-Western | physical | 11827972, (Europe PMC) | NA | BioGRID |
| MRPL44 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| MTA1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MTF1 | Affinity Capture-MS | physical | 28416769, (Europe PMC) | NA | BioGRID |
| MYOC | Affinity Capture-MS | physical | 16289162, (Europe PMC) | NA | BioGRID |
| NAT10 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| NEFL | Affinity Capture-MS, Two-hybrid, inference by socio-affinity scoring, tandem affinity purification, two hybrid | association, physical, physical association | 15383276, 27173435, 28514442, (Europe PMC) | 0.64 | BioGRID, IntAct |
| NEFM | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 27173435, 28514442, (Europe PMC) | 0.69 | BioGRID, IntAct |
| NELFCD | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NES | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NFATC2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NIF3L1 | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| NME2 | Affinity Capture-Western | physical | 11082283, (Europe PMC) | NA | BioGRID |
| NMT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NOC4L | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NOD2 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, two hybrid | colocalization, physical, physical association | 21699783, 22684479, (Europe PMC) | 0.72 | BioGRID, IntAct |
| NR1H2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUDT21 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| NUP133 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OSBP2 | Co-fractionation | physical | 11802775, (Europe PMC) | NA | BioGRID |
| PA2G4 | Affinity Capture-MS | physical | 19037095, (Europe PMC) | NA | BioGRID |
| PAN2 | Affinity Capture-MS | physical | 23398456, (Europe PMC) | NA | BioGRID |
| PDIA3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PDLIM1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PIAS4 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PINK1 | Affinity Capture-MS | physical | 23885119, (Europe PMC) | NA | BioGRID |
| PKN1 | Biochemical Activity, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, 9175763, (Europe PMC) | 0.56 | BioGRID, IntAct |
| PKP1 | Reconstituted Complex, cosedimentation in solution, far western blotting, surface plasmon resonance | physical, physical association | 10852826, (Europe PMC) | 0.59 | BioGRID, IntAct |
| PLA2G2A | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex | physical | 12829607, (Europe PMC) | NA | BioGRID |
| PLA2G4A | Affinity Capture-Western | physical | 18840708, (Europe PMC) | NA | BioGRID |
| PLEC | Affinity Capture-Western, Reconstituted Complex | physical | 11441066, 3027087, (Europe PMC) | NA | BioGRID |
| PNMA5 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| POLR1C | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPHLN1 | Two-hybrid | physical | 15383276, (Europe PMC) | NA | BioGRID |
| PPL | Affinity Capture-Western, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 12244133, 12366696, 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| PPM1B | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PRKN | Affinity Capture-MS | physical | 24244333, (Europe PMC) | NA | BioGRID |
| PRMT1 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| PRMT8 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| PRPH | Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach | physical, physical association | 21900206, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| PSIP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMA1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMA2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PSMA8 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PSMB2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PSMB5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PSMC5 | Two-hybrid | physical | 15604093, (Europe PMC) | NA | BioGRID |
| PSMD7 | Two-hybrid | physical | 15383276, (Europe PMC) | NA | BioGRID |
| PSME1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PUF60 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RAB8B | Affinity Capture-Western | physical | 12639940, (Europe PMC) | NA | BioGRID |
| RABAC1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RAD23A | Affinity Capture-Western, pull down | physical, physical association | 16712842, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| RAD23B | Affinity Capture-MS, Affinity Capture-Western, pull down | physical, physical association | 16712842, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| RAD51 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBM48 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RC3H1 | Affinity Capture-MS | physical | 26170170, (Europe PMC) | NA | BioGRID |
| RCC2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RIBC2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RIOX1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| RNF2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| RPA1 | Two-hybrid, confocal microscopy, two hybrid | colocalization, physical, physical association | 21988832, (Europe PMC) | 0.44 | BioGRID, IntAct |
| RPL12 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS7 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RRP9 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RSPRY1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| RYK | Affinity Capture-MS | physical | 21875946, (Europe PMC) | NA | BioGRID |
| SCARNA22 | Affinity Capture-RNA | physical | 22751105, (Europe PMC) | NA | BioGRID |
| SERBP1 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| SERPINH1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| SETDB1 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SH3GL1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SH3GL3 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SH3YL1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SIRT6 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| SLC25A6 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SLC27A6 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| SMARCB1 | Two-hybrid | physical | 27229929, (Europe PMC) | NA | BioGRID |
| SMURF1 | Affinity Capture-MS | physical | 23184937, (Europe PMC) | NA | BioGRID |
| SNW1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| SP1 | Affinity Capture-MS | physical | 22266860, (Europe PMC) | NA | BioGRID |
| SPART | Affinity Capture-MS | physical | 19765186, (Europe PMC) | NA | BioGRID |
| SPRTN | Affinity Capture-MS | physical | 23254330, (Europe PMC) | NA | BioGRID |
| SPTAN1 | Affinity Capture-Western | physical | 11441066, (Europe PMC) | NA | BioGRID |
| SRRM2 | Affinity Capture-MS | physical | 16159877, (Europe PMC) | NA | BioGRID |
| SRRT | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| STAU1 | Affinity Capture-MS | physical | 23125841, (Europe PMC) | NA | BioGRID |
| STX1A | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| STYXL1 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| SUMO2 | Two-hybrid | physical | 16169070, 21900206, (Europe PMC) | NA | BioGRID |
| SUMO3 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| SVIL | Affinity Capture-MS | physical | 12202484, (Europe PMC) | NA | BioGRID |
| SYN1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SYNC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TAB2 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TCHP | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| TCTEX1D2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TES | Affinity Capture-MS | physical | 28378594, (Europe PMC) | NA | BioGRID |
| THOC2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| THOC3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| THOC5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| THOC7 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TJP1 | Affinity Capture-MS, pull down | association, physical | 16944923, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TNFRSF14 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TNNT1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TOX4 | Affinity Capture-MS | physical | 20516061, (Europe PMC) | NA | BioGRID |
| TP53 | Affinity Capture-MS | physical | 25144556, (Europe PMC) | NA | BioGRID |
| TRIM15 | PCA | physical | 25450970, (Europe PMC) | NA | BioGRID |
| TRIM16 | Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy | colocalization, physical, physical association | 20729920, (Europe PMC) | 0.46 | BioGRID, IntAct |
| TRIM28 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TRIM29 | Affinity Capture-MS | physical | 26381412, (Europe PMC) | NA | BioGRID |
| TRIM68 | Affinity Capture-MS | physical | 24999993, (Europe PMC) | NA | BioGRID |
| TRIOBP | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TSC22D1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TSGA10 | Affinity Capture-MS, Affinity Capture-Western | physical | 20797700, (Europe PMC) | NA | BioGRID |
| TTR | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| TUBGCP4 | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| TWIST1 | Co-localization | physical | 28779345, (Europe PMC) | NA | BioGRID |
| TXLNB | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| TXN | Two-hybrid | physical | 12099690, (Europe PMC) | NA | BioGRID |
| TXN2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| UBE2N | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| UBR1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| UBR4 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| UBTF | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UPP1 | Affinity Capture-MS, Co-purification | physical | 11278417, (Europe PMC) | NA | BioGRID |
| UPP2 | Affinity Capture-MS, Co-purification | physical | 11278417, (Europe PMC) | NA | BioGRID |
| URGCP | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| UROD | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| USP14 | Affinity Capture-Western | physical | 27448976, (Europe PMC) | NA | BioGRID |
| UTP14A | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VCP | Affinity Capture-MS | physical | 23383273, (Europe PMC) | NA | BioGRID |
| VIM | Co-crystal Structure, Two-hybrid, bimolecular fluorescence complementation, cosedimentation in solution, fluorescent resonance energy transfer, transmission electron microscopy, two hybrid, two hybrid pooling approach, x ray scattering, x-ray crystallography | direct interaction, physical, physical association | 11243787, 11889032, 15383276, 16169070, 17050693, 21900206, 22869704, (Europe PMC) | 0.91 | BioGRID, IntAct, MINT |
| VPS33A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| WHRN | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| XPNPEP3 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 26496610, 27173435, (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| XRCC4 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YAE1 | Two-hybrid | physical | 16169070, 21900206, (Europe PMC) | NA | BioGRID |
| YEATS4 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| YWHAG | Affinity Capture-MS, coimmunoprecipitation | physical, physical association | 15324660, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| YWHAQ | Affinity Capture-MS, Co-fractionation, Reconstituted Complex | physical | 15161933, 20618440, (Europe PMC) | NA | BioGRID |
| YWHAZ | Affinity Capture-Western, Reconstituted Complex, pull down, tandem affinity purification | association, physical, physical association | 10887173, 15161933, 20618440, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| ZHX1 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZYG11B | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| ZYX | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACTB | molecular sieving | physical association | 15047060, (Europe PMC) | 0.40 | IntAct |
| AKT1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, cosedimentation in solution, fluorescence microscopy, protein kinase assay, pull down | association, colocalization, direct interaction, phosphorylation reaction, physical, physical association | 20856200, (Europe PMC) | 0.71 | BioGRID, IntAct |
| AKT2 | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 20856200, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ANKRD35 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ANXA7 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| APIP | two hybrid pooling approach | physical association | 16189514, (Europe PMC) | 0.37 | IntAct |
| APLP1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ARMCX2 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ARRB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17620599, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARRB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17620599, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BCAS3 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy | colocalization, physical association | 22300583, (Europe PMC) | 0.56 | IntAct |
| BECN1 | anti tag coimmunoprecipitation | association, physical association | 23112296, (Europe PMC) | 0.50 | IntAct |
| BHLHE40 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BRD1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| C2CD6 | two hybrid pooling approach | physical association | 16189514, (Europe PMC) | 0.37 | IntAct |
| CASP8 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CDC5L | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CDKN1A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CEP126 {ECO:0000303|PubMed:24867236, | two hybrid | physical association | 15383276, (Europe PMC) | 0.37 | IntAct |
| CFTR | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 22038833, 26618866, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHD3 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CNTRL | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| COPS6 | two hybrid | physical association | 15383276, (Europe PMC) | 0.37 | IntAct |
| CRCT1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CREB1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CRMP1 | Reconstituted Complex, Two-hybrid, pull down, two hybrid | physical, physical association | 15383276, 21900206, (Europe PMC) | 0.63 | BioGRID, IntAct, MINT |
| CTSA | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| CWF19L2 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| DDOST | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DES | Affinity Capture-MS, barcode fusion genetics two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 27107012, 28514442, (Europe PMC) | 0.67 | BioGRID, IntAct |
| DIS3L2 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| DPPA4 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DUX4 | pull down | association | 26816005, (Europe PMC) | 0.35 | IntAct |
| DYNLT1 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| EBI-11943672 | tandem affinity purification | association | 27173435, (Europe PMC) | 0.35 | IntAct |
| ESR2 | affinity chromatography technology | association | 21182203, (Europe PMC) | 0.35 | IntAct |
| ESS2 | two hybrid | physical association | 21900206, (Europe PMC) | 0.37 | IntAct, MINT |
| FABP4 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| FAM107A | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FAM118B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FLOT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FUBP1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GABARAP | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL2 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GADD45A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GFAP | Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach | physical, physical association | 16189514, 28514442, (Europe PMC) | 0.62 | BioGRID, IntAct |
| GLB1 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| GOPC | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GRB2 | Two-hybrid, confocal microscopy, two hybrid | colocalization, physical, physical association | 21988832, (Europe PMC) | 0.44 | BioGRID, IntAct |
| GSK3B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| HABP4 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| HMG20B | Co-fractionation, Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, 22939629, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HSPA5 | inference by socio-affinity scoring, tandem affinity purification | association, physical association | 27173435, (Europe PMC) | 0.51 | IntAct |
| HSPB1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HTRA2 | Biochemical Activity, Protein-peptide, protease assay | physical, protein cleavage | 17266347, (Europe PMC) | 0.44 | BioGRID, IntAct |
| IKBKG | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| ING5 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IVNS1ABP | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KARS | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| KAT7 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 15383276, 16169070, 16189514, 21900206, (Europe PMC) | 0.75 | BioGRID, IntAct, MINT |
| KIAA0408 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KIF15 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KRT20 | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 16189514, 25416956, (Europe PMC) | 0.76 | BioGRID, IntAct |
| KRT8 | anti bait coimmunoprecipitation | association | 15846844, (Europe PMC) | 0.35 | IntAct |
| KSR1 | anti tag coimmunoprecipitation | association | 27086506, (Europe PMC) | 0.35 | IntAct |
| LOR | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LRRK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17400507, 19826009, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAD1L1 | two hybrid | physical association | 27107012, (Europe PMC) | 0.37 | IntAct |
| MAFG | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAGOH | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23084401, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAN2A2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAP1LC3A | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP1LC3B | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP3K1 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| MAP3K3 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| MAPK6 | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| MRPL44 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| MTA1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NAT10 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| NCR1 | anti bait coimmunoprecipitation, enzyme linked immunosorbent assay, far western blotting | direct interaction, physical association | 17056548, (Europe PMC) | 0.61 | IntAct |
| NEFL | Affinity Capture-MS, Two-hybrid, inference by socio-affinity scoring, tandem affinity purification, two hybrid | association, physical, physical association | 15383276, 27173435, 28514442, (Europe PMC) | 0.64 | BioGRID, IntAct |
| NEFM | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 27173435, 28514442, (Europe PMC) | 0.69 | BioGRID, IntAct |
| NEK6 | two hybrid | physical association | 27107012, (Europe PMC) | 0.37 | IntAct |
| NELFCD | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NES | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NFATC2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NFKB1 | tandem affinity purification | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| NIF3L1 | two hybrid pooling approach | physical association | 16189514, (Europe PMC) | 0.37 | IntAct |
| NMT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NOC4L | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NOD2 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, two hybrid | colocalization, physical, physical association | 21699783, 22684479, (Europe PMC) | 0.72 | BioGRID, IntAct |
| NR1H2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NUP133 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OCRL | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PAWR | anti bait coimmunoprecipitation | physical association | 25218743, (Europe PMC) | 0.40 | IntAct |
| PDLIM1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PECAM1 | fluorescence microscopy | colocalization | 10801826, (Europe PMC) | 0.27 | IntAct |
| PIAS4 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PKN1 | Biochemical Activity, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, 9175763, (Europe PMC) | 0.56 | BioGRID, IntAct |
| PKP1 | Reconstituted Complex, cosedimentation in solution, far western blotting, surface plasmon resonance | physical, physical association | 10852826, (Europe PMC) | 0.59 | BioGRID, IntAct |
| PKP2 | far western blotting | physical association | 10852826, (Europe PMC) | 0.40 | IntAct |
| PNMA5 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| POLR1C | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPHLN1 | two hybrid | physical association | 15383276, (Europe PMC) | 0.37 | IntAct |
| PPL | Affinity Capture-Western, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 12244133, 12366696, 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| PPP2R2B | pull down | association | 19156129, (Europe PMC) | 0.35 | IntAct |
| PRMT1 | inference by socio-affinity scoring, tandem affinity purification | association, physical association | 27173435, (Europe PMC) | 0.51 | IntAct |
| PRPH | Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach | physical, physical association | 21900206, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| PSIP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMA1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSME1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PUF60 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RABAC1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RAD23A | Affinity Capture-Western, pull down | physical, physical association | 16712842, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| RAD23B | Affinity Capture-MS, Affinity Capture-Western, pull down | physical, physical association | 16712842, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| RAD51 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBM48 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RELA | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RERE | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| RIBC2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RIF1 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| RIOX1 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| RIPK2 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RIPK3 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RPA1 | Two-hybrid, confocal microscopy, two hybrid | colocalization, physical, physical association | 21988832, (Europe PMC) | 0.44 | BioGRID, IntAct |
| RPL12 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS7 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SDCCAG3 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| SETDB1 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SH3GL1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SH3GL3 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SH3YL1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SIRT6 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| SLC25A6 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SNCA | fluorescence microscopy | colocalization | 16678164, (Europe PMC) | 0.27 | IntAct, MINT |
| SNW1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| SPART | tandem affinity purification | association | 19765186, (Europe PMC) | 0.35 | IntAct |
| SQSTM1 | anti tag coimmunoprecipitation | physical association | 20562859, (Europe PMC) | 0.40 | IntAct |
| SRRT | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| STX1A | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SUMO2 | two hybrid, two hybrid pooling approach | physical association | 16169070, 21900206, (Europe PMC) | 0.55 | IntAct, MINT |
| SUMO3 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| SYN1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SYNC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TAB2 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TCHP | two hybrid pooling approach | physical association | 16189514, (Europe PMC) | 0.37 | IntAct |
| TCTEX1D2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TJP1 | Affinity Capture-MS, pull down | association, physical | 16944923, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TNFRSF14 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TNFRSF1B | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| TNNT1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TRADD | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| TRIM16 | Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy | colocalization, physical, physical association | 20729920, (Europe PMC) | 0.46 | BioGRID, IntAct |
| TRIM28 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TRIOBP | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TSC22D1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TTR | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| TUBA1C | barcode fusion genetics two hybrid, two hybrid, validated two hybrid | physical association | 27107012, (Europe PMC) | 0.56 | IntAct |
| TXLNB | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| TXN2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| UBE2N | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| UBTF | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UROD | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| UTP14A | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VIM | Co-crystal Structure, Two-hybrid, bimolecular fluorescence complementation, cosedimentation in solution, fluorescent resonance energy transfer, transmission electron microscopy, two hybrid, two hybrid pooling approach, x ray scattering, x-ray crystallography | direct interaction, physical, physical association | 11243787, 11889032, 15383276, 16169070, 17050693, 21900206, 22869704, (Europe PMC) | 0.91 | BioGRID, IntAct, MINT |
| XBP1 | fluorescence microscopy | colocalization | 19941857, (Europe PMC) | 0.27 | IntAct, MINT |
| XPNPEP3 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 26496610, 27173435, (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct |
| XRCC4 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YAE1D1 | two hybrid, two hybrid pooling approach | physical association | 16169070, 21900206, (Europe PMC) | 0.55 | IntAct, MINT |
| YWHAB | fluorescence microscopy, proximity ligation assay | colocalization, physical association | 21112954, (Europe PMC) | 0.46 | IntAct |
| YWHAG | Affinity Capture-MS, coimmunoprecipitation | physical, physical association | 15324660, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| YWHAZ | Affinity Capture-Western, Reconstituted Complex, pull down, tandem affinity purification | association, physical, physical association | 10887173, 15161933, 20618440, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| ZC3H18 | anti tag coimmunoprecipitation | association | 29298432, (Europe PMC) | 0.35 | IntAct |
| ZHX1 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZYG11B | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ANXA7 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| APLP1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CDC5L | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CDKN1A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CRMP1 | Reconstituted Complex, Two-hybrid, pull down, two hybrid | physical, physical association | 15383276, 21900206, (Europe PMC) | 0.63 | BioGRID, IntAct, MINT |
| ESS2 | two hybrid | physical association | 21900206, (Europe PMC) | 0.37 | IntAct, MINT |
| FABP4 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| FAM118B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GADD45A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GSK3B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KARS | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| KAT7 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 15383276, 16169070, 16189514, 21900206, (Europe PMC) | 0.75 | BioGRID, IntAct, MINT |
| MRPL44 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| NFKB1 | tandem affinity purification | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| NR1H2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| OCRL | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PRPH | Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach | physical, physical association | 21900206, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| RAD23A | Affinity Capture-Western, pull down | physical, physical association | 16712842, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| RAD23B | Affinity Capture-MS, Affinity Capture-Western, pull down | physical, physical association | 16712842, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| SH3GL1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SIRT6 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| SNCA | fluorescence microscopy | colocalization | 16678164, (Europe PMC) | 0.27 | IntAct, MINT |
| SNW1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| SUMO2 | two hybrid, two hybrid pooling approach | physical association | 16169070, 21900206, (Europe PMC) | 0.55 | IntAct, MINT |
| TNNT1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TSC22D1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TTR | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| UROD | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| VIM | Co-crystal Structure, Two-hybrid, bimolecular fluorescence complementation, cosedimentation in solution, fluorescent resonance energy transfer, transmission electron microscopy, two hybrid, two hybrid pooling approach, x ray scattering, x-ray crystallography | direct interaction, physical, physical association | 11243787, 11889032, 15383276, 16169070, 17050693, 21900206, 22869704, (Europe PMC) | 0.91 | BioGRID, IntAct, MINT |
| XBP1 | fluorescence microscopy | colocalization | 19941857, (Europe PMC) | 0.27 | IntAct, MINT |
| YAE1D1 | two hybrid, two hybrid pooling approach | physical association | 16169070, 21900206, (Europe PMC) | 0.55 | IntAct, MINT |
| YWHAG | Affinity Capture-MS, coimmunoprecipitation | physical, physical association | 15324660, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| YWHAZ | Affinity Capture-Western, Reconstituted Complex, pull down, tandem affinity purification | association, physical, physical association | 10887173, 15161933, 20618440, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABLIM1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ACTA1 | Affinity Capture-Western | physical | 11441066, (Europe PMC) | NA | BioGRID |
| ACTB | molecular sieving | physical association | 15047060, (Europe PMC) | 0.40 | IntAct |
| AHR | Affinity Capture-Western | physical | 27752740, (Europe PMC) | NA | BioGRID |
| AHSA1 | Affinity Capture-MS | physical | 26693507, (Europe PMC) | NA | BioGRID |
| AKT1 | Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, cosedimentation in solution, fluorescence microscopy, protein kinase assay, pull down | association, colocalization, direct interaction, phosphorylation reaction, physical, physical association | 20856200, (Europe PMC) | 0.71 | BioGRID, IntAct |
| AKT2 | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 20856200, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ALK | Affinity Capture-MS | physical | 16105984, (Europe PMC) | NA | BioGRID |
| ANKRD35 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ANXA7 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| APIP | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| APIP | two hybrid pooling approach | physical association | 16189514, (Europe PMC) | 0.37 | IntAct |
| APLP1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| APP | Reconstituted Complex | physical | 21832049, (Europe PMC) | NA | BioGRID |
| ARMCX2 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ARRB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17620599, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARRB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17620599, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ASB15 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB16 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB2 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ASB9 | Affinity Capture-MS | physical | 24337577, (Europe PMC) | NA | BioGRID |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATN1 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| BAG3 | Affinity Capture-MS | physical | 23824909, (Europe PMC) | NA | BioGRID |
| BASP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| BCAS3 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy | colocalization, physical association | 22300583, (Europe PMC) | 0.56 | IntAct |
| BECN1 | anti tag coimmunoprecipitation | association, physical association | 23112296, (Europe PMC) | 0.50 | IntAct |
| BFSP1 | Reconstituted Complex | physical | 1918147, (Europe PMC) | NA | BioGRID |
| BHLHE40 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BRAF | Affinity Capture-MS | physical | 27034005, (Europe PMC) | NA | BioGRID |
| BRD1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| C2CD6 | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| C2CD6 | two hybrid pooling approach | physical association | 16189514, (Europe PMC) | 0.37 | IntAct |
| CAPN1 | Affinity Capture-MS, Two-hybrid | physical | 12358155, 28514442, (Europe PMC) | NA | BioGRID |
| CASP3 | Biochemical Activity | physical | 18723680, (Europe PMC) | NA | BioGRID |
| CASP7 | Biochemical Activity | physical | 18723680, (Europe PMC) | NA | BioGRID |
| CASP8 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CBL | Affinity Capture-MS | physical | 21203488, (Europe PMC) | NA | BioGRID |
| CCT6A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| CD4 | Affinity Capture-MS | physical | 15047060, (Europe PMC) | NA | BioGRID |
| CDC5L | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CDC73 | Affinity Capture-MS | physical | 27462432, (Europe PMC) | NA | BioGRID |
| CDH5 | Affinity Capture-Western | physical | 12003790, (Europe PMC) | NA | BioGRID |
| CDK2 | Affinity Capture-MS | physical | 21319273, (Europe PMC) | NA | BioGRID |
| CDKN1A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CEP126 {ECO:0000303|PubMed:24867236, | two hybrid | physical association | 15383276, (Europe PMC) | 0.37 | IntAct |
| CFTR | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 22038833, 26618866, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHD3 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CHFR | Affinity Capture-MS | physical | 19182791, (Europe PMC) | NA | BioGRID |
| CNTRL | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| COPS5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| COPS6 | two hybrid | physical association | 15383276, (Europe PMC) | 0.37 | IntAct |
| COPS8 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CRCT1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CREB1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CRMP1 | Reconstituted Complex, Two-hybrid, pull down, two hybrid | physical, physical association | 15383276, 21900206, (Europe PMC) | 0.63 | BioGRID, IntAct, MINT |
| CTSA | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| CUL1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CWF19L2 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| DCTN1 | Affinity Capture-Western | physical | 14600259, (Europe PMC) | NA | BioGRID |
| DDOST | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DES | Affinity Capture-MS, barcode fusion genetics two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 27107012, 28514442, (Europe PMC) | 0.67 | BioGRID, IntAct |
| DIS3L2 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| DIS3L2 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| DPPA4 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DSP | Reconstituted Complex, Two-hybrid | physical | 9261168, (Europe PMC) | NA | BioGRID |
| DUX4 | pull down | association | 26816005, (Europe PMC) | 0.35 | IntAct |
| DYNLT1 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| EBI-11943672 | tandem affinity purification | association | 27173435, (Europe PMC) | 0.35 | IntAct |
| EEF1D | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| EIF4A3 | Affinity Capture-MS | physical | 23084401, (Europe PMC) | NA | BioGRID |
| ENTR1 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| EPPK1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ESR2 | affinity chromatography technology | association | 21182203, (Europe PMC) | 0.35 | IntAct |
| ESS2 | Two-hybrid | physical | 21900206, (Europe PMC) | NA | BioGRID |
| ESS2 | two hybrid | physical association | 21900206, (Europe PMC) | 0.37 | IntAct, MINT |
| FABP4 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| FAM107A | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FAM118B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FBXO25 | Affinity Capture-MS | physical | 20473970, (Europe PMC) | NA | BioGRID |
| FBXO6 | Affinity Capture-MS | physical | 22268729, (Europe PMC) | NA | BioGRID |
| FLOT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FN1 | Affinity Capture-MS | physical | 19738201, (Europe PMC) | NA | BioGRID |
| FOXK1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| FUBP1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GABARAP | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL2 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GADD45A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GAN | Affinity Capture-MS, Affinity Capture-Western | physical | 26460568, 28514442, (Europe PMC) | NA | BioGRID |
| GFAP | Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach | physical, physical association | 16189514, 28514442, (Europe PMC) | 0.62 | BioGRID, IntAct |
| GLB1 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| GOPC | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GRB2 | Two-hybrid, confocal microscopy, two hybrid | colocalization, physical, physical association | 21988832, (Europe PMC) | 0.44 | BioGRID, IntAct |
| GSK3B | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GXYLT1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| HABP4 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| HABP4 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| HAP1 | Two-hybrid | physical | 15383276, (Europe PMC) | NA | BioGRID |
| HDAC1 | Affinity Capture-MS | physical | 20585571, (Europe PMC) | NA | BioGRID |
| HEY1 | Affinity Capture-MS | physical | 27129302, (Europe PMC) | NA | BioGRID |
| HMG20B | Co-fractionation, Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, 22939629, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HNF1A | Affinity Capture-MS | physical | 18160415, (Europe PMC) | NA | BioGRID |
| HSPA5 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| HSPA5 | inference by socio-affinity scoring, tandem affinity purification | association, physical association | 27173435, (Europe PMC) | 0.51 | IntAct |
| HSPB1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HTRA2 | Biochemical Activity, Protein-peptide, protease assay | physical, protein cleavage | 17266347, (Europe PMC) | 0.44 | BioGRID, IntAct |
| HYPK | Affinity Capture-MS, Affinity Capture-Western | physical | 23272104, (Europe PMC) | NA | BioGRID |
| IDE | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| IKBKG | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| INA | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ING5 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ISG15 | Affinity Capture-MS | physical | 16009940, (Europe PMC) | NA | BioGRID |
| ITGA4 | Affinity Capture-MS | physical | 22623428, (Europe PMC) | NA | BioGRID |
| ITGB3 | Affinity Capture-Western | physical | 18840708, (Europe PMC) | NA | BioGRID |
| IVNS1ABP | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KARS | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| KAT7 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 15383276, 16169070, 16189514, 21900206, (Europe PMC) | 0.75 | BioGRID, IntAct, MINT |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KIAA0408 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KIF15 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| KRT20 | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 16189514, 25416956, (Europe PMC) | 0.76 | BioGRID, IntAct |
| KRT8 | anti bait coimmunoprecipitation | association | 15846844, (Europe PMC) | 0.35 | IntAct |
| KSR1 | anti tag coimmunoprecipitation | association | 27086506, (Europe PMC) | 0.35 | IntAct |
| LGALS3 | Affinity Capture-MS | physical | 24755837, (Europe PMC) | NA | BioGRID |
| LMNB1 | Affinity Capture-Western | physical | 11441066, (Europe PMC) | NA | BioGRID |
| LOR | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LRIF1 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| LRRK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17400507, 19826009, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAD1L1 | two hybrid | physical association | 27107012, (Europe PMC) | 0.37 | IntAct |
| MAFG | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAGOH | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 23084401, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAN2A2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAP1LC3A | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP1LC3B | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP3K1 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| MAP3K3 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| MAPK6 | anti tag coimmunoprecipitation | association | 26972000, (Europe PMC) | 0.35 | IntAct |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MCM5 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MCPH1 | Two-hybrid | physical | 29150431, (Europe PMC) | NA | BioGRID |
| MEN1 | Affinity Capture-Western, Reconstituted Complex | physical | 12169273, (Europe PMC) | NA | BioGRID |
| MGMT | Affinity Capture-MS | physical | 16226712, (Europe PMC) | NA | BioGRID |
| MICAL1 | Affinity Capture-Western | physical | 11827972, (Europe PMC) | NA | BioGRID |
| MRPL44 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| MTA1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MTF1 | Affinity Capture-MS | physical | 28416769, (Europe PMC) | NA | BioGRID |
| MYOC | Affinity Capture-MS | physical | 16289162, (Europe PMC) | NA | BioGRID |
| NAT10 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| NAT10 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| NCR1 | anti bait coimmunoprecipitation, enzyme linked immunosorbent assay, far western blotting | direct interaction, physical association | 17056548, (Europe PMC) | 0.61 | IntAct |
| NEFL | Affinity Capture-MS, Two-hybrid, inference by socio-affinity scoring, tandem affinity purification, two hybrid | association, physical, physical association | 15383276, 27173435, 28514442, (Europe PMC) | 0.64 | BioGRID, IntAct |
| NEFM | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 27173435, 28514442, (Europe PMC) | 0.69 | BioGRID, IntAct |
| NEK6 | two hybrid | physical association | 27107012, (Europe PMC) | 0.37 | IntAct |
| NELFCD | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NES | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NFATC2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NFKB1 | tandem affinity purification | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| NIF3L1 | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| NIF3L1 | two hybrid pooling approach | physical association | 16189514, (Europe PMC) | 0.37 | IntAct |
| NME2 | Affinity Capture-Western | physical | 11082283, (Europe PMC) | NA | BioGRID |
| NMT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NOC4L | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NOD2 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, two hybrid | colocalization, physical, physical association | 21699783, 22684479, (Europe PMC) | 0.72 | BioGRID, IntAct |
| NR1H2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUDT21 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| NUP133 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OCRL | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| OSBP2 | Co-fractionation | physical | 11802775, (Europe PMC) | NA | BioGRID |
| PA2G4 | Affinity Capture-MS | physical | 19037095, (Europe PMC) | NA | BioGRID |
| PAN2 | Affinity Capture-MS | physical | 23398456, (Europe PMC) | NA | BioGRID |
| PAWR | anti bait coimmunoprecipitation | physical association | 25218743, (Europe PMC) | 0.40 | IntAct |
| PDIA3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PDLIM1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PECAM1 | fluorescence microscopy | colocalization | 10801826, (Europe PMC) | 0.27 | IntAct |
| PIAS4 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PINK1 | Affinity Capture-MS | physical | 23885119, (Europe PMC) | NA | BioGRID |
| PKN1 | Biochemical Activity, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, 9175763, (Europe PMC) | 0.56 | BioGRID, IntAct |
| PKP1 | Reconstituted Complex, cosedimentation in solution, far western blotting, surface plasmon resonance | physical, physical association | 10852826, (Europe PMC) | 0.59 | BioGRID, IntAct |
| PKP2 | far western blotting | physical association | 10852826, (Europe PMC) | 0.40 | IntAct |
| PLA2G2A | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex | physical | 12829607, (Europe PMC) | NA | BioGRID |
| PLA2G4A | Affinity Capture-Western | physical | 18840708, (Europe PMC) | NA | BioGRID |
| PLEC | Affinity Capture-Western, Reconstituted Complex | physical | 11441066, 3027087, (Europe PMC) | NA | BioGRID |
| PNMA5 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| POLR1C | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPHLN1 | Two-hybrid | physical | 15383276, (Europe PMC) | NA | BioGRID |
| PPHLN1 | two hybrid | physical association | 15383276, (Europe PMC) | 0.37 | IntAct |
| PPL | Affinity Capture-Western, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 12244133, 12366696, 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| PPM1B | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PPP2R2B | pull down | association | 19156129, (Europe PMC) | 0.35 | IntAct |
| PRKN | Affinity Capture-MS | physical | 24244333, (Europe PMC) | NA | BioGRID |
| PRMT1 | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| PRMT1 | inference by socio-affinity scoring, tandem affinity purification | association, physical association | 27173435, (Europe PMC) | 0.51 | IntAct |
| PRMT8 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| PRPH | Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach | physical, physical association | 21900206, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| PSIP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMA1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMA2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PSMA8 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PSMB2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PSMB5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PSMC5 | Two-hybrid | physical | 15604093, (Europe PMC) | NA | BioGRID |
| PSMD7 | Two-hybrid | physical | 15383276, (Europe PMC) | NA | BioGRID |
| PSME1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PUF60 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RAB8B | Affinity Capture-Western | physical | 12639940, (Europe PMC) | NA | BioGRID |
| RABAC1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RAD23A | Affinity Capture-Western, pull down | physical, physical association | 16712842, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| RAD23B | Affinity Capture-MS, Affinity Capture-Western, pull down | physical, physical association | 16712842, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| RAD51 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RBM48 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RC3H1 | Affinity Capture-MS | physical | 26170170, (Europe PMC) | NA | BioGRID |
| RCC2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RELA | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RERE | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| RIBC2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RIF1 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| RIOX1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| RIOX1 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| RIPK2 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RIPK3 | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| RNF2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| RPA1 | Two-hybrid, confocal microscopy, two hybrid | colocalization, physical, physical association | 21988832, (Europe PMC) | 0.44 | BioGRID, IntAct |
| RPL12 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS7 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RRP9 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RSPRY1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| RYK | Affinity Capture-MS | physical | 21875946, (Europe PMC) | NA | BioGRID |
| SCARNA22 | Affinity Capture-RNA | physical | 22751105, (Europe PMC) | NA | BioGRID |
| SDCCAG3 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| SERBP1 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| SERPINH1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| SETDB1 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SH3GL1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SH3GL3 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SH3YL1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SIRT6 | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| SLC25A6 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SLC27A6 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| SMARCB1 | Two-hybrid | physical | 27229929, (Europe PMC) | NA | BioGRID |
| SMURF1 | Affinity Capture-MS | physical | 23184937, (Europe PMC) | NA | BioGRID |
| SNCA | fluorescence microscopy | colocalization | 16678164, (Europe PMC) | 0.27 | IntAct, MINT |
| SNW1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| SP1 | Affinity Capture-MS | physical | 22266860, (Europe PMC) | NA | BioGRID |
| SPART | Affinity Capture-MS | physical | 19765186, (Europe PMC) | NA | BioGRID |
| SPART | tandem affinity purification | association | 19765186, (Europe PMC) | 0.35 | IntAct |
| SPRTN | Affinity Capture-MS | physical | 23254330, (Europe PMC) | NA | BioGRID |
| SPTAN1 | Affinity Capture-Western | physical | 11441066, (Europe PMC) | NA | BioGRID |
| SQSTM1 | anti tag coimmunoprecipitation | physical association | 20562859, (Europe PMC) | 0.40 | IntAct |
| SRRM2 | Affinity Capture-MS | physical | 16159877, (Europe PMC) | NA | BioGRID |
| SRRT | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| STAU1 | Affinity Capture-MS | physical | 23125841, (Europe PMC) | NA | BioGRID |
| STX1A | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| STYXL1 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| SUMO2 | Two-hybrid | physical | 16169070, 21900206, (Europe PMC) | NA | BioGRID |
| SUMO2 | two hybrid, two hybrid pooling approach | physical association | 16169070, 21900206, (Europe PMC) | 0.55 | IntAct, MINT |
| SUMO3 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| SUMO3 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| SVIL | Affinity Capture-MS | physical | 12202484, (Europe PMC) | NA | BioGRID |
| SYN1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SYNC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TAB2 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TCHP | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| TCHP | two hybrid pooling approach | physical association | 16189514, (Europe PMC) | 0.37 | IntAct |
| TCTEX1D2 | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| TES | Affinity Capture-MS | physical | 28378594, (Europe PMC) | NA | BioGRID |
| THOC2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| THOC3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| THOC5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| THOC7 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TJP1 | Affinity Capture-MS, pull down | association, physical | 16944923, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TNFRSF14 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TNFRSF1B | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| TNNT1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TOX4 | Affinity Capture-MS | physical | 20516061, (Europe PMC) | NA | BioGRID |
| TP53 | Affinity Capture-MS | physical | 25144556, (Europe PMC) | NA | BioGRID |
| TRADD | tandem affinity purification | physical association | 14743216, (Europe PMC) | 0.40 | IntAct |
| TRIM15 | PCA | physical | 25450970, (Europe PMC) | NA | BioGRID |
| TRIM16 | Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy | colocalization, physical, physical association | 20729920, (Europe PMC) | 0.46 | BioGRID, IntAct |
| TRIM28 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TRIM29 | Affinity Capture-MS | physical | 26381412, (Europe PMC) | NA | BioGRID |
| TRIM68 | Affinity Capture-MS | physical | 24999993, (Europe PMC) | NA | BioGRID |
| TRIOBP | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TSC22D1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TSGA10 | Affinity Capture-MS, Affinity Capture-Western | physical | 20797700, (Europe PMC) | NA | BioGRID |
| TTR | Two-hybrid, two hybrid, two hybrid pooling approach | physical, physical association | 16169070, 21900206, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| TUBA1C | barcode fusion genetics two hybrid, two hybrid, validated two hybrid | physical association | 27107012, (Europe PMC) | 0.56 | IntAct |
| TUBGCP4 | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| TWIST1 | Co-localization | physical | 28779345, (Europe PMC) | NA | BioGRID |
| TXLNB | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| TXN | Two-hybrid | physical | 12099690, (Europe PMC) | NA | BioGRID |
| TXN2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| UBE2N | Affinity Capture-MS, inference by socio-affinity scoring | physical, physical association | 27173435, (Europe PMC) | 0.27 | BioGRID, IntAct |
| UBR1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| UBR4 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| UBTF | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UPP1 | Affinity Capture-MS, Co-purification | physical | 11278417, (Europe PMC) | NA | BioGRID |
| UPP2 | Affinity Capture-MS, Co-purification | physical | 11278417, (Europe PMC) | NA | BioGRID |
| URGCP | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| UROD | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| USP14 | Affinity Capture-Western | physical | 27448976, (Europe PMC) | NA | BioGRID |
| UTP14A | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VCP | Affinity Capture-MS | physical | 23383273, (Europe PMC) | NA | BioGRID |
| VIM | Co-crystal Structure, Two-hybrid, bimolecular fluorescence complementation, cosedimentation in solution, fluorescent resonance energy transfer, transmission electron microscopy, two hybrid, two hybrid pooling approach, x ray scattering, x-ray crystallography | direct interaction, physical, physical association | 11243787, 11889032, 15383276, 16169070, 17050693, 21900206, 22869704, (Europe PMC) | 0.91 | BioGRID, IntAct, MINT |
| VPS33A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| WHRN | Affinity Capture-MS | physical | 27173435, (Europe PMC) | NA | BioGRID |
| XBP1 | fluorescence microscopy | colocalization | 19941857, (Europe PMC) | 0.27 | IntAct, MINT |
| XPNPEP3 | Affinity Capture-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 26496610, 27173435, (Europe PMC) | 0.35, 0.51 | BioGRID, IntAct |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| XRCC4 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YAE1 | Two-hybrid | physical | 16169070, 21900206, (Europe PMC) | NA | BioGRID |
| YAE1D1 | two hybrid, two hybrid pooling approach | physical association | 16169070, 21900206, (Europe PMC) | 0.55 | IntAct, MINT |
| YEATS4 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| YWHAB | fluorescence microscopy, proximity ligation assay | colocalization, physical association | 21112954, (Europe PMC) | 0.46 | IntAct |
| YWHAG | Affinity Capture-MS, coimmunoprecipitation | physical, physical association | 15324660, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| YWHAQ | Affinity Capture-MS, Co-fractionation, Reconstituted Complex | physical | 15161933, 20618440, (Europe PMC) | NA | BioGRID |
| YWHAZ | Affinity Capture-Western, Reconstituted Complex, pull down, tandem affinity purification | association, physical, physical association | 10887173, 15161933, 20618440, (Europe PMC) | 0.56 | BioGRID, IntAct, MINT |
| ZC3H18 | anti tag coimmunoprecipitation | association | 29298432, (Europe PMC) | 0.35 | IntAct |
| ZHX1 | Two-hybrid, two hybrid | physical, physical association | 15383276, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZYG11B | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| ZYX | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |