Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
UNG
Gene Name  | UNG (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 1SSP |
| Synonyms | UNG , DGU, UNG1 | |
| Protein Name | UNG | |
| Alternative Name(s) | Uracil-DNA glycosylase;UDG;3.2.2.27; | |
| Protein Family | Belongs to the uracil-DNA glycosylase (UDG)superfamily UNG family | |
| EntrezGene ID | 7374 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P13051 (protein sequence) | |
| Enzyme Class | 3.2.2.27 (BRENDA ) | |
| Molecular Weight | 34645 Dalton | |
| Protein Length | 313 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000076248 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG2994 | eggNOG - COG0692 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Isoform 1: Mitochondrion Isoform 2: Nucleus | |||
| Function (UniProt annotation) | |||
| Excises uracil residues from the DNA which can arise asa result of misincorporation of dUMP residues by DNA polymerase ordue to deamination of cytosine | |||
| Catalytic Activity (UniProt annotation) | |||
| Hydrolyzes single-stranded DNA or mismatcheddouble-stranded DNA and polynucleotides, releasing free uracil | |||
| Protein Sequence | |||
| MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAA ALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPN QAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVS WLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| DEG_SCF_FBW7_1 | 58-PGTPPSS-64 | SCF ubiquitin ligase binding Phosphodegrons | [LIVMP].{0,2}(T)P..([ST]) | LIG_PCNA_PIPBox_1 | 4-QKTLYSFFSP-13 | PCNA binding PIP box | ((^.{0,3})|(Q)).[^FHWY][ILM][^P][^FHILVWYP][HFM][FMY].. | LIG_RPA_C_Vert | 73-RIQRNKAAALLRLAAR-88 | RPA32C ligand-binding site | [KRS]I[^P][^P][NK][KR][^P][^P]A[^P][^P][RKL][RKL][^P][^P][RK] | TRG_NLS_MonoExtN_4 | 15-PARKRHA-21 | NLS classical Nuclear Localization Signals | (([PKR].{0,1}[^DE])|([PKR]))((K[RK])|(RK))(([^DE][KR])|([KR][^DE]))[^DE] |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0003684 | F:damaged DNA binding |
| GO:0004844 | F:uracil DNA N-glycosylase activity |
| GO:0005634 | C:nucleus |
| GO:0005654 | C:nucleoplasm |
| GO:0006281 | P:DNA repair |
| GO:0006284 | P:base-excision repair |
| GO:0016032 | P:viral process |
| GO:0016446 | P:somatic hypermutation of immunoglobulin genes |
| GO:0016447 | P:somatic recombination of immunoglobulin gene segments |
| GO:0043024 | F:ribosomal small subunit binding |
| GO:0043066 | P:negative regulation of apoptotic process |
| GO:0045008 | P:depyrimidination |
| GO:0045830 | P:positive regulation of isotype switching |
| GO:0097510 | P:base-excision repair |
