Top STMN1
Localization (UniProt annotation) Cytoplasm, cytoskeleton Function (UniProt annotation) Involved in the regulation of the microtubule (MT)filament system by destabilizing microtubules Prevents assemblyand promotes disassembly of microtubules Phosphorylation at Ser-16 may be required for axon formation during neurogenesisInvolved in the control of the learned and innate fear (Bysimilarity) Catalytic Activity (UniProt annotation) N/A Protein Sequence MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEK
EVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) hsa04010 MAPK signaling pathway The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli. hsa05206 MicroRNAs in cancer MicroRNA (miRNA) is a cluster of small non-encoding RNA molecules of 21 - 23 nucleotides in length, which controls gene expression post-transcriptionally either via the degradation of target mRNAs or the inhibition of protein translation. Using high-throughput profiling, dysregulation of miRNAs has been widely observed in different stages of cancer. The upregulation (overexpression) of specific miRNAs could lead to the repression of tumor suppressor gene expression, and conversely the downregulation of specific miRNAs could result in an increase of oncogene expression; both these situations induce subsequent malignant effects on cell proliferation, differentiation, and apoptosis that lead to tumor growth and progress. The miRNA signatures of cancer observed in various studies differ significantly. These inconsistencies occur due to the differences in the study populations and methodologies used. This pathway map shows the summarized results from various studies in 9 cancers, each of which is presented in a review article.
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AHNAK Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATP6V1H Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID BAG3 Affinity Capture-Luminescence, Affinity Capture-MS physical 23824909 , (Europe PMC )NA BioGRID CAMK2G Biochemical Activity physical 21768358 , (Europe PMC )NA BioGRID CDC42 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CDK2 Affinity Capture-MS physical 21319273 , (Europe PMC )NA BioGRID CDKN1B Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 15652749 , 21423803 , (Europe PMC )0.59 BioGRID, IntAct CHEK2 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT DUT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EEF1D Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID FANCC Reconstituted Complex, Two-hybrid physical 26466335 , (Europe PMC )NA BioGRID FN1 Affinity Capture-MS physical 19738201 , (Europe PMC )NA BioGRID FOSL2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GDI2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GLP1R PCA physical 23864651 , (Europe PMC )NA BioGRID GRPEL1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HPDL Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID HSPA5 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID HSPA8 Reconstituted Complex, pull down association, physical 10197448 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct HSPA9 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPB1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HUWE1 Affinity Capture-MS physical 25147182 , (Europe PMC )NA BioGRID IMPA2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID JPT1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID JPT2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MYL6 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MYO1E Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NADK2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID NDUFV1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID NUDCD2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PAN2 Affinity Capture-MS physical 23398456 , (Europe PMC )NA BioGRID PDCD5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PDLIM1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PFDN2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PIWIL1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 26317901 , (Europe PMC )NA BioGRID PPM1G Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RAB1A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RLIM Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 24686088 , 26317901 , (Europe PMC )NA BioGRID S100A16 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SEPT2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SESTD1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SIVA1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 21768358 , (Europe PMC )NA BioGRID SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SSSCA1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID STAT3 Affinity Capture-Western physical 23333463 , (Europe PMC )NA BioGRID STIP1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TPM2 Co-fractionation physical 22939629 , 26344197 , (Europe PMC )NA BioGRID TPM3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TRIM28 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TRPC5 Affinity Capture-Western physical 12858178 , (Europe PMC )NA BioGRID TUBA1B Affinity Capture-Western physical 26317901 , (Europe PMC )NA BioGRID TUBB3 Affinity Capture-Western physical 26317901 , (Europe PMC )NA BioGRID TYMS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UBQLN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UBQLN4 Two-hybrid, two hybrid physical, physical association 16713569 , (Europe PMC )0.37 BioGRID, IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct VCP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CDKN3 pull down association 28330616 , (Europe PMC )0.35 IntAct CHEK2 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT DUSP22 pull down association 28330616 , (Europe PMC )0.35 IntAct FOSL2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HLA-B anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct HSPA5 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct HSPA8 Reconstituted Complex, pull down association, physical 10197448 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct OTUB1 anti tag coimmunoprecipitation association 26752685 , (Europe PMC )0.35 IntAct PHOSPHO1 pull down association 28330616 , (Europe PMC )0.35 IntAct PINX1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PPARG display technology physical association 20195357 , (Europe PMC )0.40 IntAct SEPT2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SESTD1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct STAT1 pull down association 26966684 , (Europe PMC )0.35 IntAct, MINT UBQLN4 Two-hybrid, two hybrid physical, physical association 16713569 , (Europe PMC )0.37 BioGRID, IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct VHL anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AHNAK Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATP6V1H Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID BAG3 Affinity Capture-Luminescence, Affinity Capture-MS physical 23824909 , (Europe PMC )NA BioGRID CAMK2G Biochemical Activity physical 21768358 , (Europe PMC )NA BioGRID CDC42 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CDK2 Affinity Capture-MS physical 21319273 , (Europe PMC )NA BioGRID CDKN1B Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 15652749 , 21423803 , (Europe PMC )0.59 BioGRID, IntAct CDKN3 pull down association 28330616 , (Europe PMC )0.35 IntAct CHEK2 Two-hybrid, two hybrid array physical, physical association 25640309 , (Europe PMC )0.37 BioGRID, IntAct, MINT DUSP22 pull down association 28330616 , (Europe PMC )0.35 IntAct DUT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EEF1D Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID FANCC Reconstituted Complex, Two-hybrid physical 26466335 , (Europe PMC )NA BioGRID FN1 Affinity Capture-MS physical 19738201 , (Europe PMC )NA BioGRID FOSL2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GDI2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GLP1R PCA physical 23864651 , (Europe PMC )NA BioGRID GRPEL1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HLA-B anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct HPDL Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID HSPA5 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID HSPA5 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct HSPA8 Reconstituted Complex, pull down association, physical 10197448 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct HSPA9 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPB1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HUWE1 Affinity Capture-MS physical 25147182 , (Europe PMC )NA BioGRID IMPA2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID JPT1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID JPT2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MYL6 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MYO1E Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NADK2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID NDUFV1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID NUDCD2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID OTUB1 anti tag coimmunoprecipitation association 26752685 , (Europe PMC )0.35 IntAct PAN2 Affinity Capture-MS physical 23398456 , (Europe PMC )NA BioGRID PDCD5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PDLIM1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PFDN2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PHOSPHO1 pull down association 28330616 , (Europe PMC )0.35 IntAct PINX1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PIWIL1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 26317901 , (Europe PMC )NA BioGRID PPARG display technology physical association 20195357 , (Europe PMC )0.40 IntAct PPM1G Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RAB1A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RLIM Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 24686088 , 26317901 , (Europe PMC )NA BioGRID S100A16 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SEPT2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SESTD1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SIVA1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 21768358 , (Europe PMC )NA BioGRID SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SSSCA1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID STAT1 pull down association 26966684 , (Europe PMC )0.35 IntAct, MINT STAT3 Affinity Capture-Western physical 23333463 , (Europe PMC )NA BioGRID STIP1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TPM2 Co-fractionation physical 22939629 , 26344197 , (Europe PMC )NA BioGRID TPM3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TRIM28 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TRPC5 Affinity Capture-Western physical 12858178 , (Europe PMC )NA BioGRID TUBA1B Affinity Capture-Western physical 26317901 , (Europe PMC )NA BioGRID TUBB3 Affinity Capture-Western physical 26317901 , (Europe PMC )NA BioGRID TYMS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UBQLN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UBQLN4 Two-hybrid, two hybrid physical, physical association 16713569 , (Europe PMC )0.37 BioGRID, IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct VCP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID VHL anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
CAMK2A S16_KELEKRAsGQAFELI , NA NA PhosphoSitePlus , CAMK2B S16_KELEKRAsGQAFELI , NA NA PhosphoSitePlus , CAMK4 S16_KELEKRAsGQAFELI , NA NA PhosphoSitePlus , CDK1 S25_QAFELILsPRSKESV , S38_SVPEFPLsPPKKKDL , in vivo 11135364 , 16427064 , 16964243 , 17287340 , 17693683 , 17924679 , 18212344 , 18452278 , 18491316 , 18578522 , 18669648 , 18707149 , 18767875 , 19413330 , 19415658 , 19651622 , 19664994 , 19664995 , 20058876 , 20068231 , 20230923 , 8125092 , 8325880 , 8376365 ,(Europe PMC )HPRD, PhosphoSitePlus , CDK2 S25_QAFELILsPRSKESV , S38_SVPEFPLsPPKKKDL , NA NA PhosphoSitePlus , CDK_group S38_SVPEFPLsPPKKKDL , LTP 8325881 ,(Europe PMC )PhosphoELM , CSNK2A1 S16_KELEKRAsGQAFELI , S63_AAEERRKsHEAEVLK , in vitro, in vivo 16964243 , 17287340 , 17693683 , 17924679 , 18212344 , 18452278 , 18669648 , 18767875 , 19413330 , 19415658 , 19651622 , 19664994 , 19664995 , 20068231 , 8002936 , 8376365 ,(Europe PMC )HPRD, MAPK13 S25_QAFELILsPRSKESV , S38_SVPEFPLsPPKKKDL , LTP 9731215 ,(Europe PMC )PhosphoELM , PhosphoSitePlus , MAPK3 S25_QAFELILsPRSKESV , S38_SVPEFPLsPPKKKDL , in vivo 11135364 , 16964243 , 17287340 , 17693683 , 17924679 , 18212344 , 18452278 , 18491316 , 18669648 , 18707149 , 18767875 , 19413330 , 19415658 , 19651622 , 19664994 , 19664995 , 20058876 , 20068231 , 20230923 , 8125092 , 8325880 , 8376365 ,(Europe PMC )HPRD, PhosphoSitePlus , MAPK_group S25_QAFELILsPRSKESV , S38_SVPEFPLsPPKKKDL , LTP 8245003 , 8325880 ,(Europe PMC )PhosphoELM , PAK1 S16_KELEKRAsGQAFELI , S38_SVPEFPLsPPKKKDL , LTP 7925472 ,(Europe PMC )PhosphoELM , PhosphoSitePlus , PKA_group S63_AAEERRKsHEAEVLK , LTP 10913145 , 11415983 ,(Europe PMC )PhosphoELM , PRKACA S16_KELEKRAsGQAFELI , S63_AAEERRKsHEAEVLK , in vitro, in vivo 16964243 , 17287340 , 17693683 , 17924679 , 18212344 , 18452278 , 18669648 , 18767875 , 19413330 , 19415658 , 19651622 , 19664994 , 19664995 , 20068231 , 8002936 , 8376365 ,(Europe PMC )HPRD, PhosphoSitePlus , PRKCB S25_QAFELILsPRSKESV , S38_SVPEFPLsPPKKKDL , NA NA PhosphoSitePlus , RPS6KA3 S16_KELEKRAsGQAFELI , NA NA PhosphoSitePlus , UHMK1 S38_SVPEFPLsPPKKKDL , NA NA PhosphoSitePlus , Unknown S16_KELEKRAsGQAFELI , S25_QAFELILsPRSKESV , S28_ELILSPRsKESVPEF , S31_LSPRSKEsVPEFPLS , S38_SVPEFPLsPPKKKDL , S46_PPKKKDLsLEEIQKK , S63_AAEERRKsHEAEVLK , T102_KMAEEKLtHKMEANK , T146_SKDPADEtEAD , HTP, LTP, in vitro, in vivo 10913145 , 11135364 , 16083285 , 16094384 , 16427064 , 16964243 , 17081983 , 17287340 , 17693683 , 17924679 , 18212344 , 18452278 , 18491316 , 18510355 , 18578522 , 18669648 , 18707149 , 18767875 , 19413330 , 19415658 , 19651622 , 19664994 , 19664995 , 20058876 , 20068231 , 20230923 , 8002936 , 8125092 , 8245003 , 8325880 , 8376365 ,(Europe PMC )HPRD, PhosphoELM ,
Statistics
