Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
SPRY1
Gene Name  | SPRY1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: NA |
| Synonyms | SPRY1 | |
| Protein Name | SPRY1 | |
| Alternative Name(s) | Protein sprouty homolog 1;Spry-1; | |
| Protein Family | Belongs to the sprouty family | |
| EntrezGene ID | 10252 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | O43609 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 35122 Dalton | |
| Protein Length | 319 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000164056 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - ENOG410IJJB | eggNOG - ENOG410Z8F4 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Membrane; Peripheral membraneprotein Note=Found in the cytoplasm in unstimulated cells but istranslocated to the membrane ruffles in cells stimulated with EGF(epidermal growth factor) | |||
| Function (UniProt annotation) | |||
| May function as an antagonist of fibroblast growthfactor (FGF) pathways and may negatively modulate respiratoryorganogenesis | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQPTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPRQEKHERTHEI IPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPPTRPVPGHRSERAIRTQPKQ LIVDDLKGSLKEDLTQHKFICEQCGKCKCGECTAPRTLPSCLACNRQCLCSAESMVEYGTCMCLVKGIFYHCSNDDEGDS YSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCLKLCRRCYDWIHRPGCRCKNSNTVYCKLESCPSRGQGKPS | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000132 | P:establishment of mitotic spindle orientation |
| GO:0001656 | P:metanephros development |
| GO:0001657 | P:ureteric bud development |
| GO:0001759 | P:organ induction |
| GO:0005654 | C:nucleoplasm |
| GO:0005794 | C:Golgi apparatus |
| GO:0005829 | C:cytosol |
| GO:0005886 | C:plasma membrane |
| GO:0008285 | P:negative regulation of cell proliferation |
| GO:0034260 | P:negative regulation of GTPase activity |
| GO:0040037 | P:negative regulation of fibroblast growth factor receptor signaling pathway |
| GO:0042059 | P:negative regulation of epidermal growth factor receptor signaling pathway |
| GO:0043407 | P:negative regulation of MAP kinase activity |
| GO:0046580 | P:negative regulation of Ras protein signal transduction |
| GO:0051387 | P:negative regulation of neurotrophin TRK receptor signaling pathway |
| GO:0060449 | P:bud elongation involved in lung branching |
| GO:0060940 | P:epithelial to mesenchymal transition involved in cardiac fibroblast development |
| GO:0070373 | P:negative regulation of ERK1 and ERK2 cascade |
