Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
RBM38
Gene Name  | RBM38 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 2CQD |
| Synonyms | RBM38, RNPC1, SEB4 | |
| Protein Name | RBM38 | |
| Alternative Name(s) | RNA-binding protein 38;CLL-associated antigen KW-5;HSRNASEB;RNA-binding motif protein 38;RNA-binding region-containing protein 1;ssDNA-binding protein SEB4; | |
| Protein Family | Belongs to the RBM38 family | |
| EntrezGene ID | 55544 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q9H0Z9 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 25498 Dalton | |
| Protein Length | 239 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000132819 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG0149 | eggNOG - ENOG4111PGT | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm, cytosol Nucleus | |||
| Function (UniProt annotation) | |||
| RNA-binding protein that specifically bind the 3'-UTR ofCDKN1A transcripts, leading to maintain the stability of CDKN1Atranscripts, thereby acting as a mediator of the p53/TP53 familyto regulate CDKN1A CDKN1A is a cyclin-dependent kinase inhibitortranscriptionally regulated by the p53/TP53 family to induce cellcycle arrest Isoform 1, but not isoform 2, has the ability toinduce cell cycle arrest in G1 and maintain the stability ofCDKN1A transcripts induced by p53/TP53 Also acts as a mRNAsplicing factor Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2 Plays a rolein myogenic differentiation | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFV TMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGLTPHYIYPPAIVQPSVVIPAA PVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0003723 | F:RNA binding |
| GO:0003729 | F:mRNA binding |
| GO:0003730 | F:mRNA 3'-UTR binding |
| GO:0005634 | C:nucleus |
| GO:0005829 | C:cytosol |
| GO:0006397 | P:mRNA processing |
| GO:0006977 | P:DNA damage response |
| GO:0006978 | signal transduction by p53 class mediator resulting in cell cycle arrest |
| GO:0007049 | P:DNA damage response |
| GO:0007050 | signal transduction by p53 class mediator resulting in transcription of p21 class mediator |
| GO:0008285 | P:cell cycle |
| GO:0008380 | P:cell cycle arrest |
| GO:0010830 | P:negative regulation of cell proliferation |
| GO:0030154 | P:RNA splicing |
| GO:0043484 | P:regulation of myotube differentiation |
| GO:0070935 | P:cell differentiation |
